Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0D032308.837ON37537513920.0
KAFR0B039008.837ON3793899621e-128
Skud_13.4488.837ON3643779361e-124
Smik_13.4898.837ON3723809291e-123
TDEL0B006008.837ON3693879151e-121
NCAS0C004308.837ON3693929131e-121
Kpol_1068.118.837ON3813948971e-118
SAKL0D01540g8.837ON3653778851e-117
YMR276W (DSK2)8.837ON3733798851e-117
Kwal_27.102758.837ON3794008781e-115
KLLA0D01859g8.837ON3713778761e-115
TPHA0I002208.837ON3773828691e-114
Suva_13.4648.837ON3663837971e-103
KNAG0J002908.837ON3673917536e-97
CAGL0M02937g8.837ON3732397432e-95
ZYRO0G14124g8.837ON3692506971e-88
ABL129W8.837ON3452346933e-88
KLTH0C03938g8.837ON3762446954e-88
NDAI0K004408.837ON4042436923e-87
Ecym_46088.837ON4062456384e-79
TBLA0B032408.837ON2842441451e-09
TDEL0G017504.16ON77711243e-08
NDAI0H002704.16ON77711225e-08
Smik_9.215.701ON124591248e-08
Kwal_YGOB_Anc_5.7015.701ON128711221e-07
ZYRO0G06622g5.701ON128711221e-07
KLTH0E01078g5.701ON128711221e-07
SAKL0E14894g5.701ON128711222e-07
KLLA0A00616g5.701ON128711222e-07
TPHA0E002405.701ON128711222e-07
TPHA0D046005.701ON128711222e-07
TBLA0E021105.701ON128711222e-07
CAGL0G02475g5.701ON128711222e-07
KAFR0D022305.701ON128711222e-07
KAFR0H002205.701ON128711222e-07
Suva_11.3305.701ON128711222e-07
Skud_11.3335.701ON128711222e-07
YIL148W (RPL40A)5.701ON128711222e-07
YKR094C (RPL40B)5.701ON128711222e-07
Kpol_1043.695.701ON128711222e-07
NDAI0E050305.701ON128711212e-07
NCAS0A032105.701ON128711212e-07
NCAS0G002405.701ON128711212e-07
TDEL0B022005.701ON128711212e-07
KAFR0E005301.480ON379581282e-07
Ecym_40195.701ON128711212e-07
AFR285C5.701ON128711202e-07
KNAG0L021205.701ON128711202e-07
Kwal_27.101521.480ON381531273e-07
Skud_9.205.701ON125601194e-07
Smik_11.3575.701ON125601194e-07
Kpol_1036.628.311ON77711154e-07
Suva_10.32singletonON62561144e-07
TPHA0C023908.386ON150711204e-07
NCAS0C029408.386ON152711204e-07
Ecym_41818.386ON152711205e-07
Ecym_84084.16ON153711205e-07
KLTH0F08734g8.386ON150711205e-07
KNAG0J028804.16ON153711205e-07
KAFR0H020008.386ON152711205e-07
Kwal_23.33118.386ON150711195e-07
TPHA0K022504.16ON153711205e-07
ZYRO0C04026g8.386ON152711195e-07
NDAI0G022808.386ON152711195e-07
YLR167W (RPS31)8.386ON152711196e-07
SAKL0H13926g8.386ON154711196e-07
AGL128W8.386ON152711187e-07
CAGL0G08173g8.386ON152711187e-07
KLLA0D18304g8.386ON150711187e-07
TDEL0F051008.386ON150711188e-07
NDAI0F003005.701ON187781208e-07
Suva_9.405.701ON144601178e-07
Suva_10.34singletonON151711189e-07
KNAG0A027308.386ON150711189e-07
KNAG0C065805.701ON149711179e-07
TBLA0H031808.386ON152711171e-06
Suva_10.2668.386ON152711171e-06
Skud_12.2348.386ON152711171e-06
Smik_12.2298.386ON152711171e-06
Kpol_1030.58.386ON152711161e-06
Kpol_1024.168.386ON152711161e-06
TBLA0G006704.16ON229711191e-06
NDAI0D049304.16ON229711191e-06
KAFR0I014704.16ON229711191e-06
Kwal_55.206074.16ON231711191e-06
KLTH0E05852g4.16ON409711222e-06
Suva_10.33singletonON254711192e-06
SAKL0H25784g4.16ON305711202e-06
TPHA0C008908.311ON77711093e-06
Skud_12.294.16ON381711203e-06
YLL039C (UBI4)4.16ON381711203e-06
Suva_10.304.16ON381711193e-06
ACL062C4.16ON382711193e-06
KLLA0E00749g4.16ON381711193e-06
ZYRO0G07854g4.16ON460711193e-06
Kpol_1070.64.16ON533711204e-06
Smik_12.184.16ON460711194e-06
NCAS0C058504.16ON388711194e-06
CAGL0D05082g4.16ON533711194e-06
TDEL0F043808.311ON77711041e-05
KLTH0C03410g1.480ON391531151e-05
CAGL0B01589g8.311ON77711041e-05
KLLA0F17974g8.311ON77711013e-05
ZYRO0D05962g8.311ON77711004e-05
KAFR0C030008.142ON397531089e-05
NDAI0J010708.311ON7771962e-04
SAKL0H15818g8.311ON7756952e-04
NDAI0G003301.480ON427531034e-04
NCAS0B035208.311ON7778934e-04
NCAS0B045908.142ON447421015e-04
AFR358W1.480ON413691008e-04
Kpol_370.61.480ON40453990.001
KNAG0G005101.480ON37565970.002
TBLA0B021601.480ON40457960.002
Suva_5.321.480ON40953940.004
SAKL0D11814g1.480ON40053940.004
Skud_5.531.480ON39753920.007
ZYRO0F05192g1.480ON38453910.009
NCAS0G041201.480ON39251910.009
YDR139C (RUB1)8.311ON7771830.009
Smik_5.561.480ON39753900.011
TPHA0O004401.480ON36953900.012
YEL037C (RAD23)1.480ON39853900.012
KLTH0G12540g8.311ON7771810.017
CAGL0L01309g1.480ON39267880.024
Suva_10.31singletonON6451790.025
TDEL0C025901.480ON36853860.036
TBLA0D022108.142ON56341860.048
NDAI0B01850singletonON40338850.052
SAKL0H24772g8.142ON41438850.053
KLLA0E22133g1.480ON38353840.075
Ecym_35721.480ON44369830.082
YGL181W (GTS1)8.142ON39638830.087
Smik_7.918.142ON39938830.088
CAGL0L06028g8.142ON50538830.095
Suva_7.818.142ON40138790.25
ZYRO0D08140g6.343ON7341720.27
TDEL0B046908.142ON44238780.36
KAFR0I027801.480ON21454760.47
KLLA0C08470g6.343ON7457680.86
KLTH0A06820g6.343ON7349671.3
Kpol_541.508.142ON51138741.4
CAGL0G07645gsingletonON9341662.2
Kwal_23.63386.343ON7349652.4
Skud_7.908.142ON39638712.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0D03230
         (375 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa] {O...   540   0.0  
KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.8...   375   e-128
Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276...   365   e-124
Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276...   362   e-123
TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {O...   357   e-121
NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}...   356   e-121
Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {O...   350   e-118
SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {...   345   e-117
YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}  DSK2Nucle...   345   e-117
Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa] {...   342   e-115
KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} simila...   342   e-115
TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837...   339   e-114
Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276...   311   e-103
KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON...   294   6e-97
CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highl...   290   2e-95
ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} simi...   273   1e-88
ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic ho...   271   3e-88
KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {...   272   4e-88
NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {O...   271   3e-87
Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar...   250   4e-79
TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.83...    60   1e-09
TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16 ...    52   3e-08
NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON} A...    52   5e-08
Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C (REAL)     52   8e-08
Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128...    52   1e-07
ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128 a...    52   1e-07
KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128 a...    52   1e-07
SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212) ...    52   2e-07
KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa] {...    52   2e-07
TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa] {O...    52   2e-07
TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083) [...    52   2e-07
TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387 ...    52   2e-07
CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387...    52   2e-07
KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa...    52   2e-07
KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa] {O...    52   2e-07
Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387...    52   2e-07
Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387...    52   2e-07
YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}  ...    52   2e-07
YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,...    52   2e-07
Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa] {...    52   2e-07
NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634) [...    51   2e-07
NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa...    51   2e-07
NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa] {O...    51   2e-07
TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa...    51   2e-07
KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa] {O...    54   2e-07
Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}...    51   2e-07
AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp, ...    51   2e-07
KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387...    51   2e-07
Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa] {...    54   3e-07
Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C (REAL)     50   4e-07
Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa] {O...    50   4e-07
Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [23...    49   4e-07
Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON} Y...    49   4e-07
TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON...    51   4e-07
NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON...    51   4e-07
Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON} ...    51   5e-07
Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to...    51   5e-07
KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa] {O...    51   5e-07
KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.1...    51   5e-07
KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON...    51   5e-07
Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON...    50   5e-07
TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.1...    51   5e-07
ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar...    50   5e-07
NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON...    50   5e-07
YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusio...    50   6e-07
SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa] ...    50   6e-07
AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic hom...    50   7e-07
CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly ...    50   7e-07
KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON} simil...    50   7e-07
TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.38...    50   8e-07
NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701        51   8e-07
Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W (REAL)     50   8e-07
Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON} ...    50   9e-07
KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON...    50   9e-07
KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304) [...    50   9e-07
TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.38...    50   1e-06
Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W...    50   1e-06
Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W...    50   1e-06
Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W...    50   1e-06
Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}...    49   1e-06
Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON...    49   1e-06
TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16...    50   1e-06
NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON}              50   1e-06
KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.70...    50   1e-06
Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa] {O...    50   1e-06
KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {...    52   2e-06
Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON} ...    50   2e-06
SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highl...    51   2e-06
TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]...    47   3e-06
Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,...    51   3e-06
YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}  U...    51   3e-06
Suva_10.30 Chr10 complement(67747..67841,68061..68288,68558..690...    50   3e-06
ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON} S...    50   3e-06
KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON...    50   3e-06
ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa] {...    50   3e-06
Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON...    51   4e-06
Smik_12.18 Chr12 complement(49088..49552,49091..49552,49091..495...    50   4e-06
NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON}             50   4e-06
CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} simila...    50   4e-06
TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234 ...    45   1e-05
KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa] {...    49   1e-05
CAGL0B01589g Chr2 (145132..145280,145404..145488) [234 bp, 77 aa...    45   1e-05
KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 7...    44   3e-05
ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa...    43   4e-05
KAFR0C03000 Chr3 (597127..598320) [1194 bp, 397 aa] {ON} Anc_8.1...    46   9e-05
NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa...    42   2e-04
SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 7...    41   2e-04
NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}...    44   4e-04
NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234 ...    40   4e-04
NCAS0B04590 Chr2 complement(835478..836821) [1344 bp, 447 aa] {O...    44   5e-04
AFR358W Chr6 (1087725..1088966) [1242 bp, 413 aa] {ON} Syntenic ...    43   8e-04
Kpol_370.6 s370 (10094..11308) [1215 bp, 404 aa] {ON} (10094..11...    43   0.001
KNAG0G00510 Chr7 complement(85742..86869) [1128 bp, 375 aa] {ON}...    42   0.002
TBLA0B02160 Chr2 complement(496901..498115) [1215 bp, 404 aa] {O...    42   0.002
Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON} Y...    41   0.004
SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} simila...    41   0.004
Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON} Y...    40   0.007
ZYRO0F05192g Chr6 (434982..436136) [1155 bp, 384 aa] {ON} simila...    40   0.009
NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON} Anc_1.4...    40   0.009
YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp, ...    37   0.009
Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON} Y...    39   0.011
TPHA0O00440 Chr15 (78697..79806) [1110 bp, 369 aa] {ON} Anc_1.48...    39   0.012
YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}  RA...    39   0.012
KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 7...    36   0.017
CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa] ...    39   0.024
Suva_10.31 Chr10 complement(68008..68199) [192 bp, 64 aa] {ON} Y...    35   0.025
TDEL0C02590 Chr3 complement(448900..450006) [1107 bp, 368 aa] {O...    38   0.036
TBLA0D02210 Chr4 (555236..556927) [1692 bp, 563 aa] {ON} Anc_8.1...    38   0.048
NDAI0B01850 Chr2 complement(440321..441532) [1212 bp, 403 aa] {O...    37   0.052
SAKL0H24772g Chr8 complement(2155837..2157081) [1245 bp, 414 aa]...    37   0.053
KLLA0E22133g Chr5 complement(1974635..1975786) [1152 bp, 383 aa]...    37   0.075
Ecym_3572 Chr3 complement(1083184..1084515) [1332 bp, 443 aa] {O...    37   0.082
YGL181W Chr7 (157906..159096) [1191 bp, 396 aa] {ON}  GTS1Protei...    37   0.087
Smik_7.91 Chr7 (152642..153637,153905..154108) [1200 bp, 399 aa]...    37   0.088
CAGL0L06028g Chr12 complement(677581..679098) [1518 bp, 505 aa] ...    37   0.095
Suva_7.81 Chr7 (153418..154434,154933..155121) [1206 bp, 401 aa]...    35   0.25 
ZYRO0D08140g Chr4 (705216..705437) [222 bp, 73 aa] {ON} similar ...    32   0.27 
TDEL0B04690 Chr2 (832571..833899) [1329 bp, 442 aa] {ON} Anc_8.1...    35   0.36 
KAFR0I02780 Chr9 (560687..561331) [645 bp, 214 aa] {ON} Anc_1.48...    34   0.47 
KLLA0C08470g Chr3 (742530..742754) [225 bp, 74 aa] {ON} highly s...    31   0.86 
KLTH0A06820g Chr1 complement(569895..570116) [222 bp, 73 aa] {ON...    30   1.3  
Kpol_541.50 s541 complement(162130..163665) [1536 bp, 511 aa] {O...    33   1.4  
CAGL0G07645g Chr7 complement(725259..725540) [282 bp, 93 aa] {ON...    30   2.2  
Kwal_23.6338 s23 complement(1539443..1539664) [222 bp, 73 aa] {O...    30   2.4  
Skud_7.90 Chr7 (163529..164719) [1191 bp, 396 aa] {ON} YGL181W (...    32   2.9  

>TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa] {ON}
           Anc_8.837 YMR276W
          Length = 375

 Score =  540 bits (1392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/375 (75%), Positives = 283/375 (75%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY
Sbjct: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60

Query: 61  KIQDGHSIHMVKSGAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNPLSDLTSA 120
           KIQDGHSIHMVKSGAH                                  FNPLSDLTSA
Sbjct: 61  KIQDGHSIHMVKSGAHATASSTTNSMTTTNTTAPQNNNGSSGMSTGRGSGFNPLSDLTSA 120

Query: 121 RYAGYTNLPSADMFGPDGGSFASQSQDDMLHMLENPVFQSQMNEMLSNPEIVDFLINSNP 180
           RYAGYTNLPSADMFGPDGGSFASQSQDDMLHMLENPVFQSQMNEMLSNPEIVDFLINSNP
Sbjct: 121 RYAGYTNLPSADMFGPDGGSFASQSQDDMLHMLENPVFQSQMNEMLSNPEIVDFLINSNP 180

Query: 181 QLQSLGPQARTMFQSPMFRQMLTNPDMIRQSMRMAQMMNGGEGTASASSFPAPGDXXXXX 240
           QLQSLGPQARTMFQSPMFRQMLTNPDMIRQSMRMAQMMNGGEGTASASSFPAPGD     
Sbjct: 181 QLQSLGPQARTMFQSPMFRQMLTNPDMIRQSMRMAQMMNGGEGTASASSFPAPGDSTTTT 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXPTDVPGTTNSGTAAANPFAALFDPSMXXXXXXXXXXX 300
                                  PTDVPGTTNSGTAAANPFAALFDPSM           
Sbjct: 241 QPTSTNIDSDTNATNNTNNATNTPTDVPGTTNSGTAAANPFAALFDPSMNPYAALGGGNG 300

Query: 301 XXXXXXXXXXXXXXXXXXXPHTQEPEDNRPPEERYEHQLRQLNDMGFFDFDKNVAALRRS 360
                              PHTQEPEDNRPPEERYEHQLRQLNDMGFFDFDKNVAALRRS
Sbjct: 301 NANNMFNPAAFAQALQAAAPHTQEPEDNRPPEERYEHQLRQLNDMGFFDFDKNVAALRRS 360

Query: 361 GGSVQGAVNALLSEQ 375
           GGSVQGAVNALLSEQ
Sbjct: 361 GGSVQGAVNALLSEQ 375

>KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.837
           YMR276W
          Length = 379

 Score =  375 bits (962), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 206/389 (52%), Positives = 242/389 (62%), Gaps = 29/389 (7%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M+I++HIKSGQN WDV    S +I   K++I+ +SEIPA NQRLIYSGKILKDDQT+ESY
Sbjct: 1   MSITIHIKSGQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESY 60

Query: 61  KIQDGHSIHMVKSG---AHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNPLSDL 117
           KI++GHSIH+VKSG   A                                   FNPL+DL
Sbjct: 61  KIEEGHSIHLVKSGGNVARNSAATNTTPTATSNENTNSAPSVPSNIASGQTGGFNPLNDL 120

Query: 118 TSARYAGYTNLPSADMFGPDGGSFASQSQDDMLHMLENPVFQSQMNEMLSNPEIVDFLIN 177
           TSARYAGY N+PSADMFGPDGG  +  SQDDML ML+NPVFQSQMNEMLSNP+++DF+I 
Sbjct: 121 TSARYAGYLNMPSADMFGPDGGLNSGPSQDDMLRMLDNPVFQSQMNEMLSNPQMIDFMIQ 180

Query: 178 SNPQLQSLGPQARTMFQSPMFRQMLTNPDMIRQSMRMAQMMNGGEGTASA----SSFPAP 233
           SNPQLQ++GPQAR M QSPMFRQML NPDMIRQSM+ A+MMNGG   A+     S+FPAP
Sbjct: 181 SNPQLQAMGPQARQMLQSPMFRQMLINPDMIRQSMQFARMMNGGNDPAATGNDPSAFPAP 240

Query: 234 GDXXXXXXXXXXXXXXXXXXXXXXXXXXXXPTDVPGTTN-----SGTAAANPFAALFDPS 288
           G+                             T   G TN     S  AAANPF ALF+P+
Sbjct: 241 GEASASTNEQNTNASGES-------------TTAGGATNNTNSTSAPAAANPFDALFNPA 287

Query: 289 MXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXPHTQEP---EDNRPPEERYEHQLRQLND 344
                                           P +Q+    +DNRPPEERYE QLRQLND
Sbjct: 288 ANPFGAMSSNTNGSQPQQPAFDPALLASMLGMPQSQQTPAQQDNRPPEERYEAQLRQLND 347

Query: 345 MGFFDFDKNVAALRRSGGSVQGAVNALLS 373
           MGFFDFD+NVAALRRSGGSVQGA++ALL+
Sbjct: 348 MGFFDFDRNVAALRRSGGSVQGALDALLN 376

>Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276W
           (REAL)
          Length = 364

 Score =  365 bits (936), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 188/377 (49%), Positives = 237/377 (62%), Gaps = 20/377 (5%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M++++HIKSGQ+ W+V +    T+  FK+ I+  + IP  NQRLIYSGKILKDDQT++SY
Sbjct: 1   MSLNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSY 60

Query: 61  KIQDGHSIHMVKSGAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNPLSDLTSA 120
            IQDGHS+H+VKS                                     FNPL+DLTSA
Sbjct: 61  HIQDGHSVHLVKSQPKPDAGGATGANNATATSAAVGTSATPNMSSGQSAGFNPLADLTSA 120

Query: 121 RYAGYTNLPSADMFGPDGGSFA--SQSQDDMLHMLENPVFQSQMNEMLSNPEIVDFLINS 178
           RYAGY N+PSADMFGPDGG+    S +QD++L M+ENP+FQSQMNEMLSNP+++DF+I S
Sbjct: 121 RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180

Query: 179 NPQLQSLGPQARTMFQSPMFRQMLTNPDMIRQSMRMAQMMNGGEGTASASSFPAPGDXXX 238
           NPQLQ++GPQAR M QSPMFRQMLTNP+M+RQSM+ A+MM+     ++AS+FPAPG    
Sbjct: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPEMMRQSMQFARMMDPNADNSAASAFPAPG---- 236

Query: 239 XXXXXXXXXXXXXXXXXXXXXXXXXPTDVPGTTNSGTAAANPFAALFDPSMXXXXXXXXX 298
                                    P+   GT  S  AAANPFA+L +P++         
Sbjct: 237 ------------GDASEEGANTNAVPSSNAGTNGSANAAANPFASLLNPALNPFANAGNT 284

Query: 299 XXXXXXXXXXXXXXXXXXXXXPHTQ--EPEDNRPPEERYEHQLRQLNDMGFFDFDKNVAA 356
                                   Q  +PED+RPPEERYEHQLRQLNDMGFFDFD+NVAA
Sbjct: 285 APTGMPAFDPALLASMFQPQQASAQASQPEDSRPPEERYEHQLRQLNDMGFFDFDRNVAA 344

Query: 357 LRRSGGSVQGAVNALLS 373
           LRRSGGSVQGA+++LL+
Sbjct: 345 LRRSGGSVQGALDSLLN 361

>Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276W
           (REAL)
          Length = 372

 Score =  362 bits (929), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 191/380 (50%), Positives = 235/380 (61%), Gaps = 20/380 (5%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M++++HIKSGQ+ W+V +   ST+  FK+ I+  + +P  NQRLIYSGKILKDDQT+ESY
Sbjct: 1   MSLNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESY 60

Query: 61  KIQDGHSIHMVKSGAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNPLSDLTSA 120
            IQDGHS+H+VKS                                     FNPL+DLTSA
Sbjct: 61  HIQDGHSVHLVKSQPKPQPGAAAGTNNATATGAAAGTVATPNMSSGQSAGFNPLADLTSA 120

Query: 121 RYAGYTNLPSADMFGPDGGSFA--SQSQDDMLHMLENPVFQSQMNEMLSNPEIVDFLINS 178
           RYAGY N+PSADMFGPDGG+    S +QD++L M+ENP+FQSQMNEMLSNP+++DF+I S
Sbjct: 121 RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180

Query: 179 NPQLQSLGPQARTMFQSPMFRQMLTNPDMIRQSMRMAQMMNGGEGTAS----ASSFPAPG 234
           NPQLQ++GPQAR M QSPMFRQMLTNPDMIRQSM+ A+MM+   GT S    AS+FPAPG
Sbjct: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNAGTGSTGGAASAFPAPG 240

Query: 235 DXXXXXXXXXXXXXXXXXXXXXXXXXXXXPTDVPGTTNSGTAAANPFAALFDPSMXXXXX 294
                                             G+  S + AANPFA+L +P++     
Sbjct: 241 GDAPEESANTNTNTNTASSPNA------------GSNASSSTAANPFASLLNPALNPFAS 288

Query: 295 XXXXXXXXXXXXXXXXXXXXXXXXXPHTQ--EPEDNRPPEERYEHQLRQLNDMGFFDFDK 352
                                       Q  +PED RPPEERYEHQLRQLNDMGFFDFD+
Sbjct: 289 AGNATGTGMPAFDPALLASMFQPQQASAQASQPEDTRPPEERYEHQLRQLNDMGFFDFDR 348

Query: 353 NVAALRRSGGSVQGAVNALL 372
           NVAALRRSGGSVQGA+++LL
Sbjct: 349 NVAALRRSGGSVQGALDSLL 368

>TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score =  357 bits (915), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 198/387 (51%), Positives = 232/387 (59%), Gaps = 35/387 (9%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M+I+V +K GQ+ W+V +    T+ +FKD+IA VSEIPA NQRLIYSGKILKDDQ +ESY
Sbjct: 1   MSITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESY 60

Query: 61  KIQDGHSIHMVKSGAHXXXXXXXXXXXXXXXXXXX--XXXXXXXXXXXXXXXFNPLSDLT 118
           KIQDGH+IH+VKSG                                      FNPLSDLT
Sbjct: 61  KIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIASGQTGGFNPLSDLT 120

Query: 119 SARYAGYTNLPSADMFGPDGGSFASQSQDDMLHMLENPVFQSQMNEMLSNPEIVDFLINS 178
           SARYAG+TNLPSADMFGPDGG     +QDDML MLENP+FQSQMNEMLSNP++VDF+I S
Sbjct: 121 SARYAGFTNLPSADMFGPDGGLTNMPNQDDMLGMLENPIFQSQMNEMLSNPQMVDFMIQS 180

Query: 179 NPQLQSLGPQARTMFQSPMFRQMLTNPDMIRQSMRMAQMMN-GGEGTASASSFPAPGDXX 237
           NPQLQ++GPQAR + QSP FRQMLTNP M+RQSM+ + MMN  G   A+A+SFPAPGD  
Sbjct: 181 NPQLQAMGPQARQLLQSPFFRQMLTNPQMLRQSMQFSSMMNPSGGNDAAAASFPAPGDST 240

Query: 238 XXXXXXXXXXXXXXXXXXXXXXXXXXPTDV---PGTT-------NSGTAAA-NPFAALFD 286
                                     P      PG+        N G  AA N     FD
Sbjct: 241 TEASSTEANTDANANTNANANTNAANPFAAMFNPGSNPLASMFGNQGVGAADNQQNQPFD 300

Query: 287 PSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPHTQEPEDNRPPEERYEHQLRQLNDMG 346
           PSM                                 +  +DNRPPEERYE QLRQLNDMG
Sbjct: 301 PSMLASLLGGGAA---------------------QQRAEQDNRPPEERYEQQLRQLNDMG 339

Query: 347 FFDFDKNVAALRRSGGSVQGAVNALLS 373
           FFDF+KNVAALRRSGGSVQGA+++LL+
Sbjct: 340 FFDFEKNVAALRRSGGSVQGALDSLLN 366

>NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score =  356 bits (913), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 203/392 (51%), Positives = 241/392 (61%), Gaps = 45/392 (11%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M+IS+H+KSGQN W V I+ +STI   K++IA VSE+PA NQRLI+SGKILKDDQT+E Y
Sbjct: 1   MSISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFY 60

Query: 61  KIQDGHSIHMVKSGAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNPLSDLTSA 120
           KI DG SIHMVKSG                                    FNPLSDLTSA
Sbjct: 61  KILDGLSIHMVKSGGGSANKNKSPPPQANTTATPVAPNMAAGETGG----FNPLSDLTSA 116

Query: 121 RYAGYTNLPSADMFGPDGG-SFASQSQDDMLHMLENPVFQSQMNEMLSNPEIVDFLINSN 179
           RYAGY NLPSAD FGPDGG + +  +QD+ML ML+NPVFQSQMNEMLSNP+++DF+I +N
Sbjct: 117 RYAGYLNLPSADTFGPDGGLNNSGPNQDEMLRMLDNPVFQSQMNEMLSNPQMLDFIIQAN 176

Query: 180 PQLQSLGPQARTMFQSPMFRQMLTNPDMIRQSMRMAQMMNG-----GEGTASASS-FPAP 233
           PQLQ++GPQAR + Q+PMFRQMLTNPDMIRQSM+MA+ MNG     G G A+ SS FPAP
Sbjct: 177 PQLQAMGPQARQILQNPMFRQMLTNPDMIRQSMQMARAMNGGVDPNGNGQANTSSDFPAP 236

Query: 234 GDXXXXXXXXXXXXXXXXXXXXXXXXXXXXPTDVPGTTNSG---------TAAANPFAAL 284
           G                               + P TTN+          T AANPFA+L
Sbjct: 237 GGDDDNTVSE----------------------NTPSTTNTASTNPSSTATTNAANPFASL 274

Query: 285 FDPSMXXXXXXXXXXXXXXXXXXXX---XXXXXXXXXXPHTQEPEDNRPPEERYEHQLRQ 341
           F+P+M                                    Q+ ED RPPEERYEHQLRQ
Sbjct: 275 FNPAMNPFAAGMANTNAAGSGNPPAFDPSFFASMFQPPAAQQQQEDTRPPEERYEHQLRQ 334

Query: 342 LNDMGFFDFDKNVAALRRSGGSVQGAVNALLS 373
           LNDMGFFDFD+NVAALRRSGG+V+ A+NALL+
Sbjct: 335 LNDMGFFDFDRNVAALRRSGGNVESALNALLN 366

>Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {ON}
           complement(21199..22344) [1146 nt, 382 aa]
          Length = 381

 Score =  350 bits (897), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 202/394 (51%), Positives = 234/394 (59%), Gaps = 37/394 (9%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I +HIKSGQN W+V ++ S+T+   K++IA VSEIP  NQRLIYSGKILKDDQ +E Y
Sbjct: 1   MGIKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFY 60

Query: 61  KIQDGHSIHMVKSGAHXXXXXXXXXXXXXXXXXXXXXXXX---XXXXXXXXXXFNPLSDL 117
           KIQD HSIH+VKSG                                       FNPLSDL
Sbjct: 61  KIQDEHSIHLVKSGGASKTNTSASAAAASTSTATNSDSNAPLPSNIAAGQSGGFNPLSDL 120

Query: 118 TSARYAGY-TNLPSADMFGPDGGSFASQSQDDMLHMLENPVFQSQMNEMLSNPEIVDFLI 176
           TSARYAGY  NLPSADMFGPDGG  +  +QDDML MLENPVFQSQMNEMLSNP+++DF+I
Sbjct: 121 TSARYAGYGLNLPSADMFGPDGGMNSMPNQDDMLRMLENPVFQSQMNEMLSNPQMIDFMI 180

Query: 177 NSNPQLQSLGPQARTMFQSPMFRQMLTNPDMIRQSMRMAQMMNGGEG----TASASSFPA 232
            SNPQLQ++GP+AR MFQSP FRQMLTNP+MIRQSM+MA MM GG G     A+ASSFPA
Sbjct: 181 QSNPQLQAMGPEARQMFQSPFFRQMLTNPEMIRQSMQMANMM-GGNGQFGANAAASSFPA 239

Query: 233 PGDXXXXXXXXXXXXXXXXXXXXXXXXXXXXPTDVPGTTNSGTAAANPFAALFDPSMXXX 292
           PG+                                  T  +     NPFA+LF+P+M   
Sbjct: 240 PGETDTTAAAETNTETTSTPAA---------------TGAAAAGQQNPFASLFNPAMNPF 284

Query: 293 XXXXXXXXXXXXXXXXXXXX-------------XXXXXXXPHTQEPEDNRPPEERYEHQL 339
                                                      Q+ +DNRPPEERYE QL
Sbjct: 285 AAMMNNNAAAAAGAGATGAAGATGTPAFDPSLFASMFQPPQQQQQEQDNRPPEERYESQL 344

Query: 340 RQLNDMGFFDFDKNVAALRRSGGSVQGAVNALLS 373
           RQLNDMGFFDFD+NVAALRRSGGSVQGA++ALLS
Sbjct: 345 RQLNDMGFFDFDRNVAALRRSGGSVQGALDALLS 378

>SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {ON}
           similar to uniprot|P48510 Saccharomyces cerevisiae
           YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin- binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 365

 Score =  345 bits (885), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 187/377 (49%), Positives = 231/377 (61%), Gaps = 19/377 (5%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M+I++HIKSGQN WDV IE ++T+ + K+ I+ VSEIP  NQRLIYSGKILKDDQT+ESY
Sbjct: 1   MSITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESY 60

Query: 61  KIQDGHSIHMVKSGAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNPLSDLTSA 120
           KI D H++H+V+SG                                    FNPL+DLT A
Sbjct: 61  KIADDHAVHLVRSGGPKPAASKSESTSATDTGAAAAAAVPSNISSGQTGGFNPLADLTGA 120

Query: 121 RYAGYTNLPSADMFGPDGGSFASQSQDDMLHMLENPVFQSQMNEMLSNPEIVDFLINSNP 180
           RYAGY NLPSADMFGPDGG   + + D++L+ML+NP+ QSQMNEMLSNP++VDF+I  NP
Sbjct: 121 RYAGYANLPSADMFGPDGGLTNAPNSDEILNMLDNPIVQSQMNEMLSNPQMVDFMIQQNP 180

Query: 181 QLQSLGPQARTMFQSPMFRQMLTNPDMIRQSMRMAQMMNGGEGTASASSFPAPGDXXXXX 240
           QLQ++GP+AR + QS  FRQM+TNPDMIRQSM+ A+M        +  +FPAPG      
Sbjct: 181 QLQAMGPRARELLQSDYFRQMMTNPDMIRQSMQFARMFGMEGAEGAGGAFPAPGTATQTA 240

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXPTDVPGTTNSGTA---AANPFAALFDPSMXXXXXXXX 297
                                   T  P TT +G+A   AANPFA+LF+           
Sbjct: 241 STEGGPAGT---------------TASPSTTGNGSANSEAANPFASLFNGQANPFASMFP 285

Query: 298 XXXXXXXXXXXXXXXXXXXXXXP-HTQEPEDNRPPEERYEHQLRQLNDMGFFDFDKNVAA 356
                                 P   Q+P+DNRPPEERYE QLRQLNDMGFFDFD+NVAA
Sbjct: 286 NGRAPQFDPSLLSSFLGGNTAAPGQQQQPQDNRPPEERYEQQLRQLNDMGFFDFDRNVAA 345

Query: 357 LRRSGGSVQGAVNALLS 373
           LRRSGGSVQGA++ALL+
Sbjct: 346 LRRSGGSVQGALDALLN 362

>YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}
           DSK2Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein, required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle, involved in proteolysis,
           interacts with the proteasome
          Length = 373

 Score =  345 bits (885), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 189/379 (49%), Positives = 231/379 (60%), Gaps = 15/379 (3%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M++++HIKSGQ+ W+V +   ST+  FK+ I   + IP  NQRLIYSGKILKDDQT+ESY
Sbjct: 1   MSLNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESY 60

Query: 61  KIQDGHSIHMVKSGAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNPLSDLTSA 120
            IQDGHS+H+VKS                                     FNPL+DLTSA
Sbjct: 61  HIQDGHSVHLVKSQPKPQTASAAGANNATATGAAAGTGATPNMSSGQSAGFNPLADLTSA 120

Query: 121 RYAGYTNLPSADMFGPDGGSFA--SQSQDDMLHMLENPVFQSQMNEMLSNPEIVDFLINS 178
           RYAGY N+PSADMFGPDGG+    S +QD++L M+ENP+FQSQMNEMLSNP+++DF+I S
Sbjct: 121 RYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQS 180

Query: 179 NPQLQSLGPQARTMFQSPMFRQMLTNPDMIRQSMRMAQMMN----GGEGTASASSFPAPG 234
           NPQLQ++GPQAR M QSPMFRQMLTNPDMIRQSM+ A+MM+     G    +AS+FPAPG
Sbjct: 181 NPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNAGMGSAGGAASAFPAPG 240

Query: 235 DXXXXXXXXXXXXXXXXXXXXXXXXXXXXPTDVPGTTNSGTAAANPFAALFDPSMXXXXX 294
                                             GT      AANPFA+L +P++     
Sbjct: 241 GDAPEEGSNTNTTSSSNTGNNAGTNA--------GTNAGANTAANPFASLLNPALNPFAN 292

Query: 295 XXXXXXXXXXXXXXXXXXXXXXXXXPHTQEPEDNRPPEERYEHQLRQLNDMGFFDFDKNV 354
                                      +Q  ED RPPEERYEHQLRQLNDMGFFDFD+NV
Sbjct: 293 AGNAASTGMPAFDPALLASMFQPPVQASQA-EDTRPPEERYEHQLRQLNDMGFFDFDRNV 351

Query: 355 AALRRSGGSVQGAVNALLS 373
           AALRRSGGSVQGA+++LL+
Sbjct: 352 AALRRSGGSVQGALDSLLN 370

>Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa] {ON}
           YMR276W (DSK2) - ubiquitin-like protein [contig 37] FULL
          Length = 379

 Score =  342 bits (878), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 192/400 (48%), Positives = 232/400 (58%), Gaps = 53/400 (13%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M+I+VH+KSGQ+ WDV ++A ST+  FK  IA  S+I   NQRLIYSGKILKDDQT+ESY
Sbjct: 1   MSITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESY 60

Query: 61  KIQDGHSIHMVKSGAHXXXXX----XXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNPLSD 116
           KI DGH++H+VKSG                                        FNPLSD
Sbjct: 61  KILDGHAVHLVKSGTKSGSGAIGAPGSGSTAPTNTASSGAAAAPASLSSGQAGGFNPLSD 120

Query: 117 LTSARYAGYTNLPSADMFGPDGGSFASQSQDDMLHMLENPVFQSQMNEMLSNPEIVDFLI 176
           LTSARYAGY NLPSAD FGPDGG  ++ + DDML MLENPV QSQMNEMLSNP+++DFLI
Sbjct: 121 LTSARYAGYLNLPSADSFGPDGGMTSAPNSDDMLRMLENPVMQSQMNEMLSNPQMIDFLI 180

Query: 177 NSNPQLQSLGPQARTMFQSPMFRQMLTNPDMIRQSMRMAQMMNGGEG---TASASSFPAP 233
             +PQLQS+GPQAR M QSP FRQM+TNP+MIRQSM+ + ++ GG G    A A++FPAP
Sbjct: 181 QQSPQLQSMGPQARQMLQSPFFRQMMTNPEMIRQSMQFSGVL-GGAGDPSAAGANAFPAP 239

Query: 234 GDXXXXXXXXXXXXXXXXXXXXXXXXXXXXPTDVPGTTNSGTA-------AANPFAALF- 285
           G                                 P +TN+ TA        ANPFA+L  
Sbjct: 240 GTADSDASAQ------------------------PASTNTSTADAAQSATNANPFASLLA 275

Query: 286 -------------DPSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPHTQEPEDNRPPE 332
                        +P +                                +Q+P+D RPPE
Sbjct: 276 GQAAAPGGASAPANPFLSMLGQQAPGAGGLPAFDPAMLSALLGGAGNNASQQPQDTRPPE 335

Query: 333 ERYEHQLRQLNDMGFFDFDKNVAALRRSGGSVQGAVNALL 372
           ERYE QLRQLNDMGFF+FD+NVAALRRSGGSVQGA++ALL
Sbjct: 336 ERYEQQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDALL 375

>KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} similar
           to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
           Nuclear-enriched ubiquitin-like polyubiquitin- binding
           protein required for spindle pole body (SPB) duplication
           and for transit through the G2/M phase of the cell cycle
           involved in proteolysis interacts with the proteasome
          Length = 371

 Score =  342 bits (876), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 192/377 (50%), Positives = 223/377 (59%), Gaps = 18/377 (4%)

Query: 3   ISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESYKI 62
           ISVH+KSGQN W VEIE+++TI+ FK+ I+ VS +PA NQRLIYSGKILKD +T+ESYKI
Sbjct: 4   ISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKI 63

Query: 63  QDGHSIHMVKSGAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNPLSDLTSARY 122
           QDGHS+HMVKSG                                    FNPL+DLT ARY
Sbjct: 64  QDGHSVHMVKSGGASAATTGSTTTGSAASPAATNSAAPSNISAGQTGGFNPLADLTGARY 123

Query: 123 AGYTNLPSADMFGPDGGSFASQSQ--DDMLHMLENPVFQSQMNEMLSNPEIVDFLINSNP 180
           AG  NLPSADMFGPDGG  +S     + ML MLENP+FQSQMNEMLSNP++VDFLI  NP
Sbjct: 124 AGLANLPSADMFGPDGGLNSSNGANPESMLQMLENPIFQSQMNEMLSNPQMVDFLIQQNP 183

Query: 181 QLQSLGPQARTMFQSPMFRQMLTNPDMIRQSMRMAQMMNGGEGTASASSFPAPGDXXXXX 240
           QLQ+LGP+AR M QSP FRQM+T+P MIRQSM+MA  M G     +AS+FPAPG      
Sbjct: 184 QLQALGPRARDMLQSPFFRQMMTDPQMIRQSMQMANSM-GMSPDGAASAFPAPGSASGAG 242

Query: 241 XXXXXXXXXXXXXXXXXXXXXXXPTD----VPGTTNSGTAAANPFAALFDPSMXXXXXXX 296
                                    +    + G T    AAANPFA LF           
Sbjct: 243 GANETSTNDADSAATGAAASSTGQANPFAGLFGATPGNAAAANPFAGLFPGGQQPQFNQE 302

Query: 297 XXXXXXXXXXXXXXXXXXXXXXXPHTQEPEDNRPPEERYEHQLRQLNDMGFFDFDKNVAA 356
                                         DNRPPEERYE QLRQLNDMGFFDFD+NVAA
Sbjct: 303 LLASMFGGNSNATGAAPAV-----------DNRPPEERYESQLRQLNDMGFFDFDRNVAA 351

Query: 357 LRRSGGSVQGAVNALLS 373
           LRR+GGSVQGA++ALL+
Sbjct: 352 LRRAGGSVQGALDALLN 368

>TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837
           YMR276W
          Length = 377

 Score =  339 bits (869), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 198/382 (51%), Positives = 228/382 (59%), Gaps = 17/382 (4%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M+ISV IKSGQN WDV +E S+TI +FK+ I+  S+IPA NQRLIYSGKILKD +T+ESY
Sbjct: 1   MSISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESY 60

Query: 61  KIQDGHSIHMVKSG---AHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNPLSDL 117
           KIQDGHSIH+VKSG   A+                                  FNPL+DL
Sbjct: 61  KIQDGHSIHLVKSGDASANAAKSSTAAAATANAAAGSAESAVPTNITSGQTNGFNPLADL 120

Query: 118 TSARYAGYT-NLPSADMFGPDGGSFASQSQDDMLHMLENPVFQSQMNEMLSNPEIVDFLI 176
           TSARYAGY   +PSADMFGPDGG     +QDDML MLENPVFQSQMNEMLSNP++V+++I
Sbjct: 121 TSARYAGYNLPMPSADMFGPDGGMTNMPNQDDMLSMLENPVFQSQMNEMLSNPQMVEYMI 180

Query: 177 NSNPQLQSLGPQARTMFQSPMFRQMLTNPDMIRQSMRMAQMMNGGEGTASA-----SSFP 231
           NSNPQLQ+LGPQAR MFQSP FRQMLTNPDMIRQSM MA+MM G            SSFP
Sbjct: 181 NSNPQLQALGPQAREMFQSPFFRQMLTNPDMIRQSMEMARMMGGEGVGIGGGLNGDSSFP 240

Query: 232 APGDXXXXXXXXXXXXXXXXXXXXXXXXXXXXPTDVPGTTNSGTAAANPFAALFDPSMXX 291
           APG+                                    N G    NPFA L +P+   
Sbjct: 241 APGETSTESATAEDNAAARNPAATNPAAANPA-NPFAALFNPGM---NPFAGLGNPA--- 293

Query: 292 XXXXXXXXXXXXXXXXXXXXXXXXXXXXPHTQEPEDNRPPEERYEHQLRQLNDMGFFDFD 351
                                       P     ED RPPE RYE QLRQLNDMGFF+FD
Sbjct: 294 -AAGSTGAPGTPQYPGFNPSMLASMLQQPRQPAQEDTRPPEVRYESQLRQLNDMGFFEFD 352

Query: 352 KNVAALRRSGGSVQGAVNALLS 373
           +N+AALRRSGGSVQGA++ALL+
Sbjct: 353 RNIAALRRSGGSVQGALDALLN 374

>Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276W
           (REAL)
          Length = 366

 Score =  311 bits (797), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 181/383 (47%), Positives = 226/383 (59%), Gaps = 30/383 (7%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M+++V++KSGQ+ W+V +   ST+  FK+ I+  + IP  NQRLIYSGKILKDDQT+ESY
Sbjct: 1   MSLNVYVKSGQDKWEVSVAPESTVLQFKEAISEANGIPVANQRLIYSGKILKDDQTVESY 60

Query: 61  KIQDGHSIHMVKSGAHXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXXXXFNPLSDLTS 119
            IQDGHS+H+VKS                                      FNPL+DLTS
Sbjct: 61  HIQDGHSVHLVKSQPRPQAGAATGAGGDAGASATNASVSATPNMSSGQSAGFNPLADLTS 120

Query: 120 ARYAGYTNLPSADMFGPDGGSFA--SQSQDDMLHMLENPVFQSQMNEMLSNPEIVDFLIN 177
           ARYAGY N+PSADMFGPDGG+    S +QD++L M++NP+FQSQMNEMLSNP+++DF+I 
Sbjct: 121 ARYAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMDNPIFQSQMNEMLSNPQMLDFMIQ 180

Query: 178 SNPQLQSLGPQARTMFQSPMFRQMLTNPDMIRQSMRMAQMMN----GGEGTASASSFPAP 233
           SNPQLQ++GPQAR M QSPMFRQMLTNPDMIRQSM+ A+MM+     G    +AS+FPAP
Sbjct: 181 SNPQLQAMGPQARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNAGNGSAGGAASAFPAP 240

Query: 234 GDXXXXXXXXXXXX---XXXXXXXXXXXXXXXXPTDVPGTTNSGTAAANPFAALFDPSMX 290
           G                                P   P   N+G +AA      FDP++ 
Sbjct: 241 GGDAPEETTDTDAAPSSNAGANAAANPFASLLNPALNP-FANAGNSAAATGMPAFDPALL 299

Query: 291 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXPHTQEPEDNRPPEERYEHQLRQLNDMGFFDF 350
                                          T+ PE      ERYE QLRQLNDMGFFDF
Sbjct: 300 ASMFQPQQAAAQAPQPE-------------DTRPPE------ERYEQQLRQLNDMGFFDF 340

Query: 351 DKNVAALRRSGGSVQGAVNALLS 373
           D+NVAALRRSGGSVQGA+++LL+
Sbjct: 341 DRNVAALRRSGGSVQGALDSLLN 363

>KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON}
           Anc_8.837 YMR276W
          Length = 367

 Score =  294 bits (753), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 181/391 (46%), Positives = 224/391 (57%), Gaps = 45/391 (11%)

Query: 1   MTISVHIKSGQNTWDVEIEAS---STIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTI 57
           M I+V +K GQN WDV + +    +T+  FK+ +A V+ +P  NQRLIYSGKILKD QT+
Sbjct: 1   MGITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTL 60

Query: 58  ESYKIQDGHSIHMVKSGAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--FNPLS 115
           E YKI DGH++H+VKSG                                      FNPL+
Sbjct: 61  EEYKITDGHTVHLVKSGGAKSAGSSSSSSEATTAAGTAGTAPAAGASMAAGQQPGFNPLA 120

Query: 116 DLTSARYAGYT-NLPSADMFGPDGGSFASQSQ------DDMLHMLENPVFQSQMNEMLSN 168
           DLTSARYAGY   +PSADMFGPDGG  +          +++L MLENP+FQSQMNEM SN
Sbjct: 121 DLTSARYAGYNLPMPSADMFGPDGGLTSGGGPGGPQSQEEILSMLENPIFQSQMNEMFSN 180

Query: 169 PEIVDFLINSNPQLQSLGPQARTMFQSPMFRQMLTNPDMIRQSMRMAQMMNGGEGTASA- 227
           P++VDFLI SNPQLQ++GPQAR M QSPMFRQMLTNPDM+RQSM+ +QMM G    A   
Sbjct: 181 PQMVDFLIQSNPQLQAMGPQAREMLQSPMFRQMLTNPDMVRQSMQFSQMMQGSGAGAGGA 240

Query: 228 --SSFPAPGDXXXXXXXXXXXXXXXXXXXXXXXXXXXXPTDVPGTTN---SGTAAANPFA 282
             ++FPAPG                             PT+   +TN   +G A ANPF+
Sbjct: 241 DPNAFPAPGG-----------------------DDTGAPTNT--STNASAAGPAGANPFS 275

Query: 283 ALFDPSMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPHTQEPEDNRPPEERYEHQLRQL 342
           +LF  +                                    P+D RPPEERYE QLRQL
Sbjct: 276 SLFGGA--PAPAAQPFQSAPGFDAAAFMQAMSRNGATAPAAAPQDTRPPEERYEQQLRQL 333

Query: 343 NDMGFFDFDKNVAALRRSGGSVQGAVNALLS 373
           NDMGF DFD+NVAALRR+GGS+QGA++ALL+
Sbjct: 334 NDMGFSDFDRNVAALRRAGGSLQGALDALLN 364

>CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highly
           similar to uniprot|P48510 Saccharomyces cerevisiae
           YMR276w DSK2
          Length = 373

 Score =  290 bits (743), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 145/239 (60%), Positives = 170/239 (71%), Gaps = 7/239 (2%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M+I++HIKSGQN WDV I+ S TI + K++IA VSEIP+ NQRLIYSGKILKDDQT+ESY
Sbjct: 1   MSITIHIKSGQNKWDVSIDPSQTILNLKEEIAKVSEIPSGNQRLIYSGKILKDDQTVESY 60

Query: 61  KIQDGHSIHMVKSGAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNPLSDLTSA 120
            I+D H+IHMVKSG +                                  FNPL+DLT A
Sbjct: 61  NIKDDHAIHMVKSGGNASTSNAPTNANESSNSSTTAVPSNIASGQTGG--FNPLADLTGA 118

Query: 121 RYAGYTNLPSADMFGPDGGSFASQSQDDMLHMLENPVFQSQMNEMLSNPEIVDFLINSNP 180
           RYAGY NLPSADMFGPDGG   +  QD+ML M+ENP+FQSQMNEMLSNPE++DF+I SNP
Sbjct: 119 RYAGYANLPSADMFGPDGGINNAPDQDEMLRMMENPIFQSQMNEMLSNPEMLDFMIQSNP 178

Query: 181 QLQSLGPQARTMFQSPMFRQMLTNPDMIRQSMRMAQMMNG-----GEGTASASSFPAPG 234
           QLQ++GPQAR M QSP FRQMLTNP MIRQSM+ A+MMNG     G     AS+FPAPG
Sbjct: 179 QLQAMGPQARQMLQSPFFRQMLTNPAMIRQSMQFARMMNGQGGMPGADATDASAFPAPG 237

 Score = 96.7 bits (239), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 43/48 (89%), Positives = 47/48 (97%)

Query: 326 EDNRPPEERYEHQLRQLNDMGFFDFDKNVAALRRSGGSVQGAVNALLS 373
           EDNRPPEERYE QLRQLNDMGFFDFD+NVAALRRSGGSVQGA++ALL+
Sbjct: 323 EDNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLN 370

>ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} similar
           to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
           Nuclear-enriched ubiquitin-like polyubiquitin- binding
           protein required for spindle pole body (SPB) duplication
           and for transit through the G2/M phase of the cell cycle
           involved in proteolysis interacts with the proteasome
          Length = 369

 Score =  273 bits (697), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 140/250 (56%), Positives = 174/250 (69%), Gaps = 17/250 (6%)

Query: 2   TISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESYK 61
           TI+V IKSGQN W+V ++  ST+  FK++I+ VSEIPA +QRLIYSGKILKDDQT++ Y 
Sbjct: 3   TITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYN 62

Query: 62  IQDGHSIHMVKSGAHXXXXXXXXXXX--------------XXXXXXXXXXXXXXXXXXXX 107
           +QDGHS+H+VKS                                                
Sbjct: 63  LQDGHSVHLVKSSKAPGNASGGSSSTAAATAGSGASAVPPSGNASTTPTTGAPSNLSAGQ 122

Query: 108 XXXFNPLSDLTSARYAGYTNLPSADMFGPDGGSFASQSQDDMLHMLENPVFQSQMNEMLS 167
              FNPL+DLTSARYAG+T+LPSADMFGPDGG+    +Q+D+L+ML+NP+FQSQMNEMLS
Sbjct: 123 SGGFNPLADLTSARYAGFTSLPSADMFGPDGGATNMPNQEDLLNMLDNPIFQSQMNEMLS 182

Query: 168 NPEIVDFLINSNPQLQSLGPQARTMFQSPMFRQMLTNPDMIRQSMRMAQMMN--GGEGTA 225
           NP++VDF+I SNPQLQ++GPQAR MFQSP FRQMLTNP MIRQSM+ A+MMN  GGE  A
Sbjct: 183 NPQMVDFMIQSNPQLQAMGPQARQMFQSPFFRQMLTNPQMIRQSMQFARMMNPGGGENDA 242

Query: 226 SASSFPAPGD 235
            A++FPAPG+
Sbjct: 243 -ANAFPAPGN 251

 Score = 96.3 bits (238), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 50/51 (98%)

Query: 323 QEPEDNRPPEERYEHQLRQLNDMGFFDFDKNVAALRRSGGSVQGAVNALLS 373
           Q+P+DNRPPEERYE QLRQLN+MGFFDFD+NVAALRRSGGSVQGA+++LL+
Sbjct: 316 QQPQDNRPPEERYETQLRQLNEMGFFDFDRNVAALRRSGGSVQGALDSLLN 366

>ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR276W (DSK2)
          Length = 345

 Score =  271 bits (693), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 133/234 (56%), Positives = 162/234 (69%), Gaps = 1/234 (0%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           MTI + +KSGQN W+V +EAS ++ + K +IA VSEIPA NQRLIYSGKILKDDQT+ESY
Sbjct: 1   MTIKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESY 60

Query: 61  KIQDGHSIHMVKSGAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNPLSDLTSA 120
           KI DGH+IH+VKSG                                    FNPL+DLT A
Sbjct: 61  KIADGHAIHLVKSGGAKAAPAASAAGGESTGAAAGAGAVPSSISAGQSGGFNPLADLTGA 120

Query: 121 RYAGYTNLPSADMFGPDGGSFASQSQDDMLHMLENPVFQSQMNEMLSNPEIVDFLINSNP 180
           RYAGYTNLPS DMFGPDGG  ++  Q++++ MLENP+FQSQMNEML+NP+++DFLI  +P
Sbjct: 121 RYAGYTNLPSTDMFGPDGGLNSAVGQEEIIGMLENPIFQSQMNEMLNNPQMIDFLIQQHP 180

Query: 181 QLQSLGPQARTMFQSPMFRQMLTNPDMIRQSMRMAQMMNGGEGTASASSFPAPG 234
            LQ++GP AR M QSP FRQMLTNPD+IRQ  R+ QM  GG G    + FPAPG
Sbjct: 181 HLQAMGPAAREMLQSPFFRQMLTNPDIIRQMSRL-QMGMGGAGAEQGTDFPAPG 233

 Score = 92.8 bits (229), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 46/47 (97%)

Query: 327 DNRPPEERYEHQLRQLNDMGFFDFDKNVAALRRSGGSVQGAVNALLS 373
           DNRPPEERYE QLRQLNDMGFFDFD+NVAALRR+GGSVQGA++ALL+
Sbjct: 296 DNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDALLN 342

>KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {ON}
           some similarities with uniprot|P48510 Saccharomyces
           cerevisiae YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 376

 Score =  272 bits (695), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 141/244 (57%), Positives = 162/244 (66%), Gaps = 10/244 (4%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M+I+VHIKSGQN WDV I+ SSTI  FK  IA  SEI   NQRLIYSGKILKDDQT+ESY
Sbjct: 1   MSITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESY 60

Query: 61  KIQDGHSIHMVKSGAHXXXXXXXXXXXXXXXXXXXXXXXXXXX----------XXXXXXX 110
           KI D HS+H+VKSG                                              
Sbjct: 61  KILDDHSVHLVKSGGSKKATSPGATAAASGDATATGATSTPAAQPQQSAPANLSTGQGNG 120

Query: 111 FNPLSDLTSARYAGYTNLPSADMFGPDGGSFASQSQDDMLHMLENPVFQSQMNEMLSNPE 170
           FNPLSDLTSARYAG+ NLPSAD FGPDGG  ++ + DD+L MLENPV QSQMNEMLSNP+
Sbjct: 121 FNPLSDLTSARYAGFLNLPSADSFGPDGGMTSAPNSDDVLRMLENPVMQSQMNEMLSNPQ 180

Query: 171 IVDFLINSNPQLQSLGPQARTMFQSPMFRQMLTNPDMIRQSMRMAQMMNGGEGTASASSF 230
           ++DFLI  +PQLQS+GPQART+ QSP FRQM+TNPDMIRQSM+ + M+ G       SSF
Sbjct: 181 MIDFLIQQSPQLQSMGPQARTLLQSPFFRQMMTNPDMIRQSMQFSSMLGGDSAAGGGSSF 240

Query: 231 PAPG 234
           PAPG
Sbjct: 241 PAPG 244

 Score =  100 bits (248), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 49/50 (98%)

Query: 323 QEPEDNRPPEERYEHQLRQLNDMGFFDFDKNVAALRRSGGSVQGAVNALL 372
           Q+P+D RPPEERYEHQLRQLNDMGFF+FD+NVAALRRSGGSVQGA++ALL
Sbjct: 323 QQPQDTRPPEERYEHQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDALL 372

>NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {ON}
           Anc_8.837 YMR276W
          Length = 404

 Score =  271 bits (692), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 142/243 (58%), Positives = 167/243 (68%), Gaps = 14/243 (5%)

Query: 2   TISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESYK 61
           TIS+HIKSGQN W V I+ +++I   KD+IA VSEIPA NQRLIYSGKILKDDQ ++ Y 
Sbjct: 3   TISIHIKSGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYN 62

Query: 62  IQDGHSIHMVKSGAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNPLSDLTSAR 121
           IQDGHS+H+V+SG                                    FNPL+DLTSAR
Sbjct: 63  IQDGHSVHLVRSGKKSTPTPATTNTTTNASNNTVPSNISAGQTGG----FNPLADLTSAR 118

Query: 122 YAGYT-NLPSADMFGPDGGSFASQSQ-DDMLHMLENPVFQSQMNEMLSNPEIVDFLINSN 179
           YAGY  NLPSAD FGPDGG   S +  D+ L ML+NP+ QSQMNEMLSNP+++DF+I SN
Sbjct: 119 YAGYNLNLPSADAFGPDGGMNQSGTNPDEFLSMLDNPIVQSQMNEMLSNPQMIDFMIQSN 178

Query: 180 PQLQSLGPQARTMFQSPMFRQMLTNPDMIRQSMRMAQMMNGGEGTA--------SASSFP 231
           PQLQ++GPQAR MFQSPMFRQMLTNPDMIRQSM++A MM  G G          +ASSFP
Sbjct: 179 PQLQAMGPQARQMFQSPMFRQMLTNPDMIRQSMQLANMMGMGPGARGSTNATDNAASSFP 238

Query: 232 APG 234
           APG
Sbjct: 239 APG 241

 Score = 91.3 bits (225), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 40/52 (76%), Positives = 47/52 (90%)

Query: 322 TQEPEDNRPPEERYEHQLRQLNDMGFFDFDKNVAALRRSGGSVQGAVNALLS 373
           T + +D RPPEERYE QLRQLNDMGFFDFD+N+AALRR+GGSV+ AVNALL+
Sbjct: 350 TPQQQDTRPPEERYETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNALLN 401

>Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar to
           Ashbya gossypii ABL129W
          Length = 406

 Score =  250 bits (638), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 127/245 (51%), Positives = 156/245 (63%), Gaps = 12/245 (4%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M+IS+H+KSGQN W V  + SS+I   K +IA VS IPA NQRLIYSGKILKDDQT+ESY
Sbjct: 1   MSISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESY 60

Query: 61  KIQDGHSIHMVK-----------SGAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 109
           KI DGHSIH+V+           +                                    
Sbjct: 61  KIADGHSIHLVRSGGGKVSGSSGATGGASGSVEAVGSGGRNSTAGSGSTVPNNITAGQMG 120

Query: 110 XFNPLSDLTSARYAGYTNLPSADMFGPDGGSFASQSQDDMLHMLENPVFQSQMNEMLSNP 169
            FNPL+DLT ARYAGY NLPS DMFGPDGG  ++  Q+++L ML+NP+FQSQ+NEML+NP
Sbjct: 121 GFNPLADLTGARYAGYANLPSTDMFGPDGGLNSAIGQEEILGMLDNPIFQSQVNEMLANP 180

Query: 170 EIVDFLINSNPQLQSLGPQARTMFQSPMFRQMLTNPDMIRQSMRMAQMMNGGEGTASASS 229
           +++DFLI  +P LQ++GP AR M QSP FRQM+TNPD+IRQ  R  QM  G     S + 
Sbjct: 181 QMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMMTNPDVIRQVSRF-QMDMGAANGQSTND 239

Query: 230 FPAPG 234
           FPAPG
Sbjct: 240 FPAPG 244

 Score = 92.4 bits (228), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 46/50 (92%)

Query: 323 QEPEDNRPPEERYEHQLRQLNDMGFFDFDKNVAALRRSGGSVQGAVNALL 372
           Q+ EDNRPPEERY+ QL QLN+MGF DFD+NVAALRRSGGSVQGA+NALL
Sbjct: 353 QQTEDNRPPEERYQQQLEQLNEMGFVDFDRNVAALRRSGGSVQGALNALL 402

>TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.837
           YMR276W
          Length = 284

 Score = 60.5 bits (145), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 103/244 (42%), Gaps = 38/244 (15%)

Query: 3   ISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESYKI 62
           ISV+IK  +  + +E E    I D   KI    +IP  NQRLIYSG+IL  ++T++ Y  
Sbjct: 2   ISVNIKFKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNF 61

Query: 63  QDGHSIHMV-----KSGAHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNPLSD- 116
           +DGH I ++     K+  H                                    P S+ 
Sbjct: 62  KDGHCIIVIIHKEEKNNLHPPPNNTTNLNPNNSVY--------------------PASNT 101

Query: 117 -LTSARYAGYTNLPSADMFGPDGGSFAS------QSQDDMLHMLENPVFQSQMNEM-LSN 168
            + S    G  N+ +     PD     S      + + ++L +L++P    Q NEM L+N
Sbjct: 102 PINSPTPFGEGNIITITTTSPDPYGVRSNEVHDPEVERELLQVLDHP-RSFQENEMLLNN 160

Query: 169 PEIVDFLINSNPQLQSLGPQ-ARTMFQSPMFRQMLTNPDMIRQ--SMRMAQMMNGGEGTA 225
             ++ FLI +NP L+ +    AR + + P  ++   + + + Q  S+R   + +   G  
Sbjct: 161 QNLLRFLIQTNPHLRHMDINGARQVLRDPRLQRAFMDVNFLNQQISLRRTAIEHANNGIT 220

Query: 226 SASS 229
              S
Sbjct: 221 HPGS 224

>TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16
          YLL039C
          Length = 77

 Score = 52.4 bits (124), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON}
          Anc_4.16
          Length = 77

 Score = 51.6 bits (122), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C
          (REAL)
          Length = 124

 Score = 52.4 bits (124), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 25/59 (42%), Positives = 37/59 (62%)

Query: 13 TWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESYKIQDGHSIHMV 71
          T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y IQ   ++H+V
Sbjct: 8  TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 66

>Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128
          aa] {ON} ANNOTATED BY YGOB -
          Length = 128

 Score = 51.6 bits (122), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128
          aa] {ON} highly similar to uniprot|P14796 Saccharomyces
          cerevisiae YKR094C RPL40B
          Length = 128

 Score = 51.6 bits (122), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128
          aa] {ON} highly similar to uniprot|P61864 Saccharomyces
          cerevisiae YKR094c RPL40B and highly similar to
          uniprot|P61864 Saccharomyces cerevisiae YIL148w RPL40A
          Length = 128

 Score = 51.6 bits (122), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212)
          [387 bp, 128 aa] {ON} highly similar to uniprot|P61864
          Saccharomyces cerevisiae YLR167W RPS31 and highly
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YIL148W and highly similar to uniprot|P04838
          Saccharomyces cerevisiae YKR094C and highly similar to
          uniprot|P04838 Saccharomyces cerevisiae YLL039C Fusion
          proteins that are cleaved to yield a ribosomal protein
          of the small (40S) subunit and ubiquitin
          Length = 128

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa]
          {ON} highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YKR094C RPL40B Fusion protein, identical to
          Rpl40Ap, that is cleaved to yield ubiquitin and a
          ribosomal protein of the large (60S) ribosomal subunit
          with similarity to rat L40; ubiquitin may facilitate
          assembly of the ribosomal protein into ribosomes
          Length = 128

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa]
          {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083)
          [387 bp, 128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387
          bp, 128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387
          bp, 128 aa] {ON} highly similar to uniprot|P04838
          Saccharomyces cerevisiae YKR094c UBI2 ubiquitin and
          highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YIL148w UBI1 ubiquitin
          Length = 128

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa]
          {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa]
          {ON} 
          Length = 128

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387
          bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387
          bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}
          RPL40AFusion protein, identical to Rpl40Bp, that is
          cleaved to yield ubiquitin and a ribosomal protein of
          the large (60S) ribosomal subunit with similarity to
          rat L40; ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes
          Length = 128

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,
          128 aa] {ON}  RPL40BFusion protein, identical to
          Rpl40Ap, that is cleaved to yield ubiquitin and a
          ribosomal protein of the large (60S) ribosomal subunit
          with similarity to rat L40; ubiquitin may facilitate
          assembly of the ribosomal protein into ribosomes
          Length = 128

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa]
          {ON} complement(145335..145721) [387 nt, 129 aa]
          Length = 128

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634)
          [387 bp, 128 aa] {ON} Anc_5.701
          Length = 128

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa]
          {ON} Anc_5.701
          Length = 128

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa]
          {ON} Anc_5.701
          Length = 128

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa]
          {ON} 
          Length = 128

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa]
          {ON} Anc_1.480 YEL037C
          Length = 379

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 39/58 (67%)

Query: 16 VEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESYKIQDGHSIHMVKS 73
          VE+E+SSTI D K+K+A +        +LI+SGK+LKDDQT+ S  ++D   + M+ S
Sbjct: 15 VELESSSTILDAKNKLASIKSCDIDQIKLIFSGKVLKDDQTVSSCGLKDNDQVIMMIS 72

>Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}
          similar to Ashbya gossypii AFR285C 1-intron
          Length = 128

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp,
          128 aa] {ON} Syntenic homolog of Saccharomyces
          cerevisiae YKR094C (RPL40B) and YIL148W (RPL40A);
          1-intron
          Length = 128

 Score = 50.8 bits (120), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387
          bp, 128 aa] {ON} 
          Length = 128

 Score = 50.8 bits (120), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa]
          {ON} YEL037C (RAD23) - ubiquitin-like protein [contig
          41] FULL
          Length = 381

 Score = 53.5 bits (127), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 36/53 (67%)

Query: 16 VEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESYKIQDGHSI 68
          +E+E SST+ + K K+A   E      +LIYSGKIL+DD+TI  YK++DG  +
Sbjct: 16 LELELSSTVNEAKQKLAENKECDDSQIKLIYSGKILQDDRTIGDYKLKDGDQV 68

>Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C
          (REAL)
          Length = 125

 Score = 50.4 bits (119), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 37/60 (61%)

Query: 12 NTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESYKIQDGHSIHMV 71
           T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y IQ   ++H+V
Sbjct: 8  KTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 67

>Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa]
          {ON} YKR094C (REAL)
          Length = 125

 Score = 50.4 bits (119), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 37/60 (61%)

Query: 12 NTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESYKIQDGHSIHMV 71
           T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y IQ   ++H+V
Sbjct: 8  KTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 67

>Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [234
          bp, 77 aa] {ON}
          complement(173662..173746,173844..173992) [234 nt, 78
          aa]
          Length = 77

 Score = 48.9 bits (115), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M + V   +G+    VEI+ S  +   K+ +     IP   QRLI+ GK + D+QT++S 
Sbjct: 1  MYVKVKTLTGKEI-SVEIQGSDKVYHIKELLEEKEGIPPSQQRLIFQGKQIDDEQTVDSA 59

Query: 61 KIQDGHSIHMV 71
          K+ DG  +H+V
Sbjct: 60 KLTDGMQLHLV 70

>Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON}
          YLL039C (REAL)
          Length = 62

 Score = 48.5 bits (114), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 24/56 (42%), Positives = 35/56 (62%)

Query: 16 VEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESYKIQDGHSIHMV 71
          +E+E S TI + K KI     IP   QRLI++GK L+D +T+  Y IQ   ++H+V
Sbjct: 1  LEVEYSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 56

>TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON}
          Anc_8.386 YLR167W
          Length = 150

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON}
          Anc_8.386
          Length = 152

 Score = 50.8 bits (120), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON}
          similar to Ashbya gossypii AGL128W
          Length = 152

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to
          Ashbya gossypii ACL062C
          Length = 153

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 136 NIQKESTLHLV 146

>KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa]
          {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167W RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 150

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.16
          YLL039C
          Length = 153

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 136 NIQKESTLHLV 146

>KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON}
          Anc_8.386 YLR167W
          Length = 152

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON}
          YLR167W (RPS31) - Ribosomal protein S31 (S37) (YS24)
          [contig 251] FULL
          Length = 150

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.16
          YLL039C
          Length = 153

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 136 NIQKESTLHLV 146

>ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar
          to uniprot|P05759 Saccharomyces cerevisiae YLR167W
          RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes interacts genetically
          with translation factor eIF2B
          Length = 152

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON}
          Anc_8.386
          Length = 152

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusion
          protein that is cleaved to yield a ribosomal protein of
          the small (40S) subunit and ubiquitin; ubiquitin may
          facilitate assembly of the ribosomal protein into
          ribosomes; interacts genetically with translation
          factor eIF2B
          Length = 152

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa]
          {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167W RPS31 and similar to uniprot|P04838
          Saccharomyces cerevisiae YIL148W and similar to
          uniprot|P04838 Saccharomyces cerevisiae YKR094C and
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLL039C Fusion proteins that are cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 154

 Score = 50.4 bits (119), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YLR167W (RPS31)
          Length = 152

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly
          similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167w UBI3 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 152

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON}
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLR167W RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin; ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes; interacts genetically
          with translation factor eIF2B
          Length = 150

 Score = 50.1 bits (118), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.386
          YLR167W
          Length = 150

 Score = 50.1 bits (118), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701
          Length = 187

 Score = 50.8 bits (120), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 46/78 (58%), Gaps = 8/78 (10%)

Query: 1   MTISVHIK-------SGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKD 53
           + + +HIK       +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D
Sbjct: 53  LLLHIHIKYSFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLED 111

Query: 54  DQTIESYKIQDGHSIHMV 71
            +T+  Y IQ   ++H+V
Sbjct: 112 GRTLSDYNIQKESTLHLV 129

>Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W
          (REAL)
          Length = 144

 Score = 49.7 bits (117), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 37/60 (61%)

Query: 12 NTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESYKIQDGHSIHMV 71
           T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y IQ   ++H+V
Sbjct: 27 KTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 86

>Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON}
          YALI0E18986g (REAL)
          Length = 151

 Score = 50.1 bits (118), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

 Score = 50.1 bits (118), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 136 NIQKESTLHLV 146

>KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON}
          Anc_8.386 YLR167W
          Length = 150

 Score = 50.1 bits (118), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304)
          [450 bp, 149 aa] {ON} 
          Length = 149

 Score = 49.7 bits (117), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.386
          YLR167W
          Length = 152

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}
          complement(10263..10721) [459 nt, 153 aa]
          Length = 152

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON}
          complement(58683..59141) [459 nt, 153 aa]
          Length = 152

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

>TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16
          YLL039C
          Length = 229

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 136 NIQKESTLHLV 146

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 212 NIQKESTLHLV 222

>NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON} 
          Length = 229

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 136 NIQKESTLHLV 146

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 212 NIQKESTLHLV 222

>KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.701
          YIL148W
          Length = 229

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 136 NIQKESTLHLV 146

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 212 NIQKESTLHLV 222

>Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa]
          {ON} YLL039C (UBI4) - 1:1 [contig 144] FULL
          Length = 231

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 136 NIQKESTLHLV 146

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 212 NIQKESTLHLV 222

>KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {ON}
           highly similar to uniprot|P04838 Saccharomyces
           cerevisiae YLL039c UBI4 ubiquitin
          Length = 409

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 105 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 163

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 164 NIQKESTLHLV 174

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 181 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 239

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 240 NIQKESTLHLV 250

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 257 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 315

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 316 NIQKESTLHLV 326

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 333 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 391

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 392 NIQKESTLHLV 402

>Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON}
          YLL039C (REAL)
          Length = 254

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 136 NIQKESTLHLV 146

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 212 NIQKESTLHLV 222

>SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highly
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLL039c UBI4 ubiquitin
          Length = 305

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 136 NIQKESTLHLV 146

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 212 NIQKESTLHLV 222

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 288 NIQKESTLHLV 298

>TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]
          {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 46.6 bits (109), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+    +E++ S  +   KD +     IP   QRLI+ GK + D+QT+ES 
Sbjct: 1  MQIKVKTLTGKEI-AIEVQGSDKVFHIKDLLEEKEGIPPSQQRLIFQGKQIDDEQTVESA 59

Query: 61 KIQDGHSIHMV 71
           + DG  +H+V
Sbjct: 60 NLIDGMQLHLV 70

>Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,
          381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 136 NIQKESTLHLV 146

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 212 NIQKESTLHLV 222

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 288 NIQKESTLHLV 298

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 305 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 364 NIQKESTLHLV 374

>YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}
          UBI4Ubiquitin, becomes conjugated to proteins, marking
          them for selective degradation via the ubiquitin-26S
          proteasome system; essential for the cellular stress
          response; encoded as a polyubiquitin precursor
          comprised of 5 head-to-tail repeats
          Length = 381

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 136 NIQKESTLHLV 146

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 212 NIQKESTLHLV 222

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 288 NIQKESTLHLV 298

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 305 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 364 NIQKESTLHLV 374

>Suva_10.30 Chr10
          complement(67747..67841,68061..68288,68558..69013,
          69256..69622) [1146 bp, 381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 136 NIQKESTLHLV 146

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 212 NIQKESTLHLV 222

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 288 NIQKESTLHLV 298

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++ K L+D +T+  Y
Sbjct: 305 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAEKQLEDGRTLSDY 363

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 364 NIQKESTLHLV 374

>ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YLL039C
          (UBI4)
          Length = 382

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 136 NIQKESTLHLV 146

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 212 NIQKESTLHLV 222

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 288 NIQKESTLHLV 298

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 305 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 364 NIQKESTLHLV 374

>KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON}
          highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YLL039c UBI4 ubiquitin
          Length = 381

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 136 NIQKESTLHLV 146

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 212 NIQKESTLHLV 222

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 288 NIQKESTLHLV 298

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 305 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 364 NIQKESTLHLV 374

>ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa]
          {ON} highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YLL039c UBI4 ubiquitin
          Length = 460

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 136 NIQKESTLHLV 146

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 212 NIQKESTLHLV 222

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 288 NIQKESTLHLV 298

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 305 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 364 NIQKESTLHLV 374

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 381 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 439

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 440 NIQKESTLHLV 450

>Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON}
          complement(16980..18581) [1602 nt, 534 aa]
          Length = 533

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 136 NIQKESTLHLV 146

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 212 NIQKESTLHLV 222

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 288 NIQKESTLHLV 298

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 305 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 364 NIQKESTLHLV 374

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 381 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 439

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 440 NIQKESTLHLV 450

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 457 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 515

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 516 NIQKESTLHLV 526

>Smik_12.18 Chr12
          complement(49088..49552,49091..49552,49091..49546)
          [1383 bp, 460 aa] {ON} YLL039C (REAL)
          Length = 460

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 136 NIQKESTLHLV 146

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 155 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 213

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 214 NIQKESTLHLV 224

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 231 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 289

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 290 NIQKESTLHLV 300

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 309 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 367

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 368 NIQKESTLHLV 378

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 385 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 443

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 444 NIQKESTLHLV 454

>NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON} 
          Length = 388

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 136 NIQKESTLHLV 146

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 212 NIQKESTLHLV 222

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 288 NIQKESTLHLV 298

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 305 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 364 NIQKESTLHLV 374

>CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} similar
          to uniprot|P04838 Saccharomyces cerevisiae YLL039c UBI4
          ubiquitin
          Length = 533

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 59

Query: 61 KIQDGHSIHMV 71
           IQ   ++H+V
Sbjct: 60 NIQKESTLHLV 70

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 77  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 135

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 136 NIQKESTLHLV 146

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 153 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 211

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 212 NIQKESTLHLV 222

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 229 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 287

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 288 NIQKESTLHLV 298

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 305 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 363

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 364 NIQKESTLHLV 374

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 381 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 439

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 440 NIQKESTLHLV 450

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 1/71 (1%)

Query: 1   MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
           M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L+D +T+  Y
Sbjct: 457 MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY 515

Query: 61  KIQDGHSIHMV 71
            IQ   ++H+V
Sbjct: 516 NIQKESTLHLV 526

>TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234
          bp, 77 aa] {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+    VE+++ + I   K  +     IP   QRLI+ GK + D QT+E+ 
Sbjct: 1  MIIKVKTLTGKEI-AVELKSDAPIYRIKQLLEEKEGIPPSQQRLIFQGKQIDDRQTLEAA 59

Query: 61 KIQDGHSIHMV 71
          K+ DG  +H+V
Sbjct: 60 KLVDGMVLHLV 70

>KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037C RAD23
          Length = 391

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 35/53 (66%)

Query: 16 VEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESYKIQDGHSI 68
          +E+++ STI + K ++A   +      +LIYSGKIL+DD+TI  YK+ DG  +
Sbjct: 16 LELDSGSTISEAKQRLAENKDCDESQIKLIYSGKILQDDRTIADYKLNDGDQV 68

>CAGL0B01589g Chr2 (145132..145280,145404..145488) [234 bp, 77 aa]
          {ON} highly similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139c RUB1
          Length = 77

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+    VE+     +   K+ +     IPA  QRLI+ GK + +D TI + 
Sbjct: 1  MIIKVKTLTGKEI-PVEVSGEDKVYHIKELLEEKEGIPASQQRLIFHGKQINNDDTISTA 59

Query: 61 KIQDGHSIHMV 71
          K+ DG  +H+V
Sbjct: 60 KLSDGMQLHLV 70

>KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 43.5 bits (101), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 23/71 (32%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M + V   +G+    V++++S T+   K+ +     IP   Q+LI+ GK + D+ TI S 
Sbjct: 1  MQLKVKTLTGKEI-SVDVQSSETVYHIKELLEEKEGIPPSQQKLIFQGKQIDDNATIGSA 59

Query: 61 KIQDGHSIHMV 71
           +QDG  +H+V
Sbjct: 60 DLQDGSLLHLV 70

>ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa]
          {ON} similar to uniprot|Q03919 Saccharomyces cerevisiae
          YDR139C RUB1 Ubiquitin-like protein with similarity to
          mammalian NEDD8
          Length = 77

 Score = 43.1 bits (100), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+    VE+     I   K+ +     IP   QRLI+ GK + D QT+ S 
Sbjct: 1  MIIKVKTLTGKEI-AVELNGEDPIYRIKELLEEKEGIPPSQQRLIFQGKQIDDQQTVSSA 59

Query: 61 KIQDGHSIHMV 71
          K+ DG  +H+V
Sbjct: 60 KLVDGMQLHLV 70

>KAFR0C03000 Chr3 (597127..598320) [1194 bp, 397 aa] {ON} Anc_8.142
           YGL181W
          Length = 397

 Score = 46.2 bits (108), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 34/53 (64%)

Query: 323 QEPEDNRPPEERYEHQLRQLNDMGFFDFDKNVAALRRSGGSVQGAVNALLSEQ 375
           QE  D+   E  Y  Q+RQL +MGF D +KN+ AL++S G++  A++ L  E+
Sbjct: 178 QEVSDDDRYESDYRRQVRQLKEMGFSDSEKNLKALKKSNGNMNRAIDVLGKEE 230

>NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa]
          {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 41.6 bits (96), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+    VEI  +  +   K+ +     IP   QRLI+ GK + D+Q++ S 
Sbjct: 1  MIIKVKTLTGKEI-PVEISGNEPVYRIKELLEEKEGIPPSQQRLIFQGKQIDDEQSVSSA 59

Query: 61 KIQDGHSIHMV 71
           + DG  +H+V
Sbjct: 60 NLVDGMQLHLV 70

>SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 32/56 (57%)

Query: 16 VEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESYKIQDGHSIHMV 71
          + +E+   +   K+ +     IP   QRLI+ GK ++DDQT++S  +  G  +H+V
Sbjct: 15 ISLESHEKVYRIKELLEEKEGIPPSQQRLIFQGKQIEDDQTVDSANLSSGMQLHLV 70

>NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}
          Anc_1.480 YEL037C
          Length = 427

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 34/53 (64%)

Query: 16 VEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESYKIQDGHSI 68
          +++E S+TI D K ++A          ++IYSGK+L+D QT+E  ++++G  I
Sbjct: 16 LDLEPSNTILDVKSQLAQAKACEESQIKIIYSGKVLQDGQTVEECQLKEGDQI 68

>NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234
          bp, 77 aa] {ON}
          Length = 77

 Score = 40.4 bits (93), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 41/78 (52%), Gaps = 3/78 (3%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M I V   +G+    V+I+ +  +   K+ +     IP   QRLI+ GK + D+QT+ S 
Sbjct: 1  MIIKVKTLTGKEI-PVDIQGTDPVYRIKEMLEEKEGIPPSQQRLIFQGKQIDDEQTVSSA 59

Query: 61 KIQDGHSIHMVKS--GAH 76
           + DG  +H+V +  G H
Sbjct: 60 NLIDGMQLHLVLTLRGGH 77

>NCAS0B04590 Chr2 complement(835478..836821) [1344 bp, 447 aa] {ON}
           Anc_8.142 YGL181W
          Length = 447

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 24/42 (57%)

Query: 334 RYEHQLRQLNDMGFFDFDKNVAALRRSGGSVQGAVNALLSEQ 375
           +Y  QLR L DMGF D D NV AL    G++   +N L S +
Sbjct: 155 KYSRQLRSLKDMGFNDVDNNVEALNICNGNINKTINILTSNE 196

>AFR358W Chr6 (1087725..1088966) [1242 bp, 413 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YEL037C (RAD23)
          Length = 413

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 39/69 (56%), Gaps = 1/69 (1%)

Query: 1  MTISVHIKS-GQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIES 59
          M I++H K   +    +++  S+TI + K  +A   +      ++I+SGK+L+D  T+E 
Sbjct: 1  MNITIHFKDFKKERLPLQLSPSATIAEAKQMLARAKQCDESQLKMIFSGKVLQDGNTLEG 60

Query: 60 YKIQDGHSI 68
           K++DG  +
Sbjct: 61 CKLKDGDQV 69

>Kpol_370.6 s370 (10094..11308) [1215 bp, 404 aa] {ON}
          (10094..11308) [1215 nt, 405 aa]
          Length = 404

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 33/53 (62%)

Query: 16 VEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESYKIQDGHSI 68
          +++E S T+ D K +IA+  +      +LIYSGK+L++D TI    ++DG  +
Sbjct: 16 LDLEGSVTVLDAKKQIAVKKDCEDSQIKLIYSGKVLQNDSTIGDCGLKDGDQV 68

>KNAG0G00510 Chr7 complement(85742..86869) [1128 bp, 375 aa] {ON}
          Anc_1.480 YEL037C
          Length = 375

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 38/65 (58%), Gaps = 2/65 (3%)

Query: 8  KSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESYKIQDG-H 66
          K  + T DV++E  S +KD K+K+A   +  A   +LI+SGK+L+D +      +++  H
Sbjct: 10 KKNKETLDVDLEHES-VKDVKEKLAAARDCDAEQIKLIFSGKVLQDAKPFAETGLKENDH 68

Query: 67 SIHMV 71
           I MV
Sbjct: 69 VIMMV 73

>TBLA0B02160 Chr2 complement(496901..498115) [1215 bp, 404 aa]
          {ON} Anc_1.480 YEL037C
          Length = 404

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 1/57 (1%)

Query: 16 VEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESYKIQDG-HSIHMV 71
          +E++A STI+  K +IA          +LIYSGKILK+D TI +  ++D  H I M+
Sbjct: 16 LELDADSTIESAKGQIASEKNCDIDQIKLIYSGKILKNDATILNSGLKDNDHIIFMI 72

>Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON}
          YEL037C (REAL)
          Length = 409

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 33/53 (62%)

Query: 16 VEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESYKIQDGHSI 68
          +++E S+TI + K K+A  S       +LIYSGK+L+D +T+    ++DG  +
Sbjct: 16 LDLEPSNTIFEAKTKLAQSSSCEESQIKLIYSGKVLQDSKTVSECGLKDGDQV 68

>SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} similar
          to uniprot|P32628 Saccharomyces cerevisiae YEL037C
          RAD23
          Length = 400

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 33/53 (62%)

Query: 16 VEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESYKIQDGHSI 68
          +E++ +ST+   K ++A          +LI+SGK+L+D +T+E  K++DG  +
Sbjct: 16 LELDPTSTVLQAKQQLASTKSCDEDQIKLIFSGKVLQDGKTLEECKLKDGDQV 68

>Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON}
          YEL037C (REAL)
          Length = 397

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 33/53 (62%)

Query: 16 VEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESYKIQDGHSI 68
          +++E S+TI + K K+A  +       +LIYSGK+L+D +T+    ++DG  +
Sbjct: 16 LDLEPSNTIFEAKTKLAQSTSCEESQIKLIYSGKVLQDSKTVSECGLKDGDQV 68

>ZYRO0F05192g Chr6 (434982..436136) [1155 bp, 384 aa] {ON} similar
          to uniprot|P32628 Saccharomyces cerevisiae YEL037C
          RAD23
          Length = 384

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 33/53 (62%)

Query: 16 VEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESYKIQDGHSI 68
          +E++ SS++KD K ++A          +LIYSGK+L+D + ++   ++DG  +
Sbjct: 16 LELDPSSSVKDAKVRLATEKSCEESQIKLIYSGKVLQDAKNLQESGLKDGDQV 68

>NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON}
          Anc_1.480 YEL037C
          Length = 392

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 32/51 (62%)

Query: 18 IEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESYKIQDGHSI 68
          +E+++T+ D K ++A          +LIYSGK+L+D +T+E   ++DG  +
Sbjct: 18 LESTNTVLDAKTQLAQNKSCEESQIKLIYSGKVLQDAKTLEDCGLKDGDQV 68

>YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp,
          77 aa] {ON}  RUB1Ubiquitin-like protein with similarity
          to mammalian NEDD8; conjugation (neddylation)
          substrates include the cullins Cdc53p, Rtt101p, and
          Cul3p; activated by Ula1p and Uba3p (E1 enzyme pair);
          conjugation mediated by Ubc12p (E2 enzyme)
          Length = 77

 Score = 36.6 bits (83), Expect = 0.009,   Method: Composition-based stats.
 Identities = 20/71 (28%), Positives = 35/71 (49%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M + V   +G+    VE++ S  +   K+ +     IP   QRLI+ GK + D  T+   
Sbjct: 1  MIVKVKTLTGKEI-SVELKESDLVYHIKELLEEKEGIPPSQQRLIFQGKQIDDKLTVTDA 59

Query: 61 KIQDGHSIHMV 71
           + +G  +H+V
Sbjct: 60 HLVEGMQLHLV 70

>Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON}
          YEL037C (REAL)
          Length = 397

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 32/53 (60%)

Query: 16 VEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESYKIQDGHSI 68
          +++E S+TI + K K+A          +LIYSGK+L+D +T+    ++DG  +
Sbjct: 16 LDLEPSNTIFEVKSKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQV 68

>TPHA0O00440 Chr15 (78697..79806) [1110 bp, 369 aa] {ON} Anc_1.480
          YEL037C
          Length = 369

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 32/53 (60%)

Query: 16 VEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESYKIQDGHSI 68
          +++ ASST+   K ++A   E      +LIYSGK+L+D  +IE   ++DG  +
Sbjct: 16 LDLPASSTVLHAKKQLAEQKECDDSQIKLIYSGKVLQDSNSIEGCGLKDGDQV 68

>YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}
          RAD23Protein with ubiquitin-like N terminus, subunit of
          Nuclear Excision Repair Factor 2 (NEF2) with Rad4p that
          binds damaged DNA; enhances protein deglycosylation
          activity of Png1p; also involved, with Rad4p, in
          ubiquitylated protein turnover
          Length = 398

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 32/53 (60%)

Query: 16 VEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESYKIQDGHSI 68
          +++E S+TI + K K+A          +LIYSGK+L+D +T+    ++DG  +
Sbjct: 16 LDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQV 68

>KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 35.8 bits (81), Expect = 0.017,   Method: Composition-based stats.
 Identities = 19/71 (26%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESY 60
          M ++V   +G+    V ++    +   K+ +     IP   QRLI+ GK + DD+++ S 
Sbjct: 1  MKLTVKTLTGKEI-PVVVDPDDKVYRIKEYLEEKEGIPPTQQRLIFQGKQIDDDKSVSSA 59

Query: 61 KIQDGHSIHMV 71
           +  G  +H+V
Sbjct: 60 NLSSGMQLHLV 70

>CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037c RAD23 nucleotide excision repair protein
          Length = 392

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 39/67 (58%), Gaps = 1/67 (1%)

Query: 3  ISVHIKS-GQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESYK 61
          +SV  K+  +  + +++E+S +I   K+ ++          +LI+SGK+LKD  ++ES  
Sbjct: 2  VSVTFKNFKKEKYPLDLESSQSIVAVKEALSEKLSCDPSQIKLIFSGKVLKDGDSVESCN 61

Query: 62 IQDGHSI 68
           +DG+ +
Sbjct: 62 FKDGNEV 68

>Suva_10.31 Chr10 complement(68008..68199) [192 bp, 64 aa] {ON}
          YLR167W (REAL)
          Length = 64

 Score = 35.0 bits (79), Expect = 0.025,   Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 1  MTISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKIL 51
          M I V   +G+ T  +E+E+S TI + K KI     IP   QRLI++GK L
Sbjct: 1  MQIFVKTLTGK-TITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQL 50

>TDEL0C02590 Chr3 complement(448900..450006) [1107 bp, 368 aa]
          {ON} Anc_1.480 YEL037C
          Length = 368

 Score = 37.7 bits (86), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 34/53 (64%)

Query: 16 VEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESYKIQDGHSI 68
          ++++ SS++ D K ++A   E      +LIYSGK+L+D ++++   ++DG  +
Sbjct: 16 LDLDLSSSVLDAKVQLAQKKECEEGQIKLIYSGKVLQDSKSLQESGLKDGDQV 68

>TBLA0D02210 Chr4 (555236..556927) [1692 bp, 563 aa] {ON} Anc_8.142
           YGL181W
          Length = 563

 Score = 37.7 bits (86), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 25/41 (60%)

Query: 334 RYEHQLRQLNDMGFFDFDKNVAALRRSGGSVQGAVNALLSE 374
           +Y  QL++LNDMGF + D N  AL  S G +  A++ L  E
Sbjct: 219 KYSRQLKELNDMGFTNTDNNAEALSISRGDINRALDLLDRE 259

>NDAI0B01850 Chr2 complement(440321..441532) [1212 bp, 403 aa] {ON} 
          Length = 403

 Score = 37.4 bits (85), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%)

Query: 334 RYEHQLRQLNDMGFFDFDKNVAALRRSGGSVQGAVNAL 371
           +Y  +LR+L +MGF D D N  AL  + G + GA++ L
Sbjct: 166 KYSRELRRLQNMGFRDIDINTEALVLARGDLNGAIDIL 203

>SAKL0H24772g Chr8 complement(2155837..2157081) [1245 bp, 414 aa]
           {ON} weakly similar to uniprot|P40956 Saccharomyces
           cerevisiae YGL181W GTS1 Contains a zinc-finger in the N-
           terminus and a long Gln-rich region in the C-terminus
           regulates ultradian rhythm cell size cell cycle lifespan
           sporulation heat tolerance and multidrug transport
          Length = 414

 Score = 37.4 bits (85), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 24/38 (63%)

Query: 334 RYEHQLRQLNDMGFFDFDKNVAALRRSGGSVQGAVNAL 371
           R+ HQLR L ++G+ D D NV AL  + G +  A++ L
Sbjct: 184 RHSHQLRNLKELGYLDTDSNVEALVLARGDINLALDIL 221

>KLLA0E22133g Chr5 complement(1974635..1975786) [1152 bp, 383 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037C RAD23
          Length = 383

 Score = 37.0 bits (84), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 31/53 (58%)

Query: 16 VEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESYKIQDGHSI 68
          +E+   +TI   K+ IA   +  A   +LIY+GKIL+D +T+    +++G  +
Sbjct: 15 IELADDATISHAKELIAEQKQCDASQIKLIYAGKILQDPKTVSGCNLKEGDQV 67

>Ecym_3572 Chr3 complement(1083184..1084515) [1332 bp, 443 aa]
          {ON} similar to Ashbya gossypii AFR358W
          Length = 443

 Score = 36.6 bits (83), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 40/69 (57%), Gaps = 1/69 (1%)

Query: 1  MTISVHIKS-GQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIES 59
          M I+++ K   +    +++  ++TI + K  +A   +      ++I+SGK+L+D  T+++
Sbjct: 1  MHITINFKDFKKEKLPLQLSPTATIAEAKQLLAKEKQCDESQLKMIFSGKVLQDGHTLDA 60

Query: 60 YKIQDGHSI 68
           K++DG  +
Sbjct: 61 CKLKDGDQV 69

>YGL181W Chr7 (157906..159096) [1191 bp, 396 aa] {ON}  GTS1Protein
           involved in Arf3p regulation and in transcription
           regulation; localizes to the nucleus and to endocytic
           patches; contains an N-terminal Zn-finger and ArfGAP
           homology domain, a C-terminal glutamine-rich region, and
           a UBA (ubiquitin associated) domain; gts1 mutations
           affect budding, cell size, heat tolerance, sporulation,
           life span, ultradian rhythms, endocytosis; expression
           oscillates in a pattern similar to metabolic
           oscillations
          Length = 396

 Score = 36.6 bits (83), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%)

Query: 334 RYEHQLRQLNDMGFFDFDKNVAALRRSGGSVQGAVNAL 371
           RY  QL +L DMGF D +KN+ AL  + G++  A++ L
Sbjct: 194 RYSRQLAELKDMGFGDTNKNLDALSSAHGNINRAIDYL 231

>Smik_7.91 Chr7 (152642..153637,153905..154108) [1200 bp, 399 aa]
           {ON} YGL181W (REAL)
          Length = 399

 Score = 36.6 bits (83), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%)

Query: 334 RYEHQLRQLNDMGFFDFDKNVAALRRSGGSVQGAVNAL 371
           RY  QL +L DMGF D +KN+ AL  + G++  A++ L
Sbjct: 196 RYSRQLLELRDMGFSDANKNLDALSSAHGNINRAIDYL 233

>CAGL0L06028g Chr12 complement(677581..679098) [1518 bp, 505 aa]
           {ON} weakly similar to uniprot|P40956 Saccharomyces
           cerevisiae YGL181w GTS1
          Length = 505

 Score = 36.6 bits (83), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 25/38 (65%)

Query: 334 RYEHQLRQLNDMGFFDFDKNVAALRRSGGSVQGAVNAL 371
           +Y  +LRQL ++GF +  KN+ A+  S G V GA++ L
Sbjct: 211 KYGRELRQLRELGFTNEQKNIDAITYSHGDVNGALDYL 248

>Suva_7.81 Chr7 (153418..154434,154933..155121) [1206 bp, 401 aa]
           {ON} YGL181W (REAL)
          Length = 401

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 25/38 (65%)

Query: 334 RYEHQLRQLNDMGFFDFDKNVAALRRSGGSVQGAVNAL 371
           RY  QL +L DMGF D +KN+ AL  + G++  A++ L
Sbjct: 194 RYSRQLAELRDMGFNDKNKNLDALSSAHGNLSRAIDYL 231

>ZYRO0D08140g Chr4 (705216..705437) [222 bp, 73 aa] {ON} similar
          to uniprot|Q6Q546 Saccharomyces cerevisiae YNR032C-A
          HUB1
          Length = 73

 Score = 32.3 bits (72), Expect = 0.27,   Method: Composition-based stats.
 Identities = 14/41 (34%), Positives = 24/41 (58%)

Query: 24 IKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESYKIQD 64
          + DFK  +++    PA   +L+  G ILKD  +++ Y+I D
Sbjct: 24 VGDFKKILSVQIGTPASKIQLVKGGSILKDHISLDDYEIHD 64

>TDEL0B04690 Chr2 (832571..833899) [1329 bp, 442 aa] {ON} Anc_8.142
           YGL181W
          Length = 442

 Score = 34.7 bits (78), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%)

Query: 334 RYEHQLRQLNDMGFFDFDKNVAALRRSGGSVQGAVNAL 371
           RY  +LR L +MG+ D D N  AL  + G +  A++ L
Sbjct: 193 RYSRELRTLKEMGYDDIDHNAEALSHAHGDLNRAIDIL 230

>KAFR0I02780 Chr9 (560687..561331) [645 bp, 214 aa] {ON} Anc_1.480
          YEL037C
          Length = 214

 Score = 33.9 bits (76), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 20 ASSTIKDFKDKIAIVSEIPAPNQR--LIYSGKILKDDQTIESYKIQDGHSIHMV 71
           + T++D K  I    ++        LIYSGK+L+DD T+ S  ++D   I M+
Sbjct: 20 VNDTVRDLKHHIVKSHKLVCHTDEISLIYSGKLLQDDATLNSLHLKDNAQIVML 73

>KLLA0C08470g Chr3 (742530..742754) [225 bp, 74 aa] {ON} highly
          similar to uniprot|Q6Q546 Saccharomyces cerevisiae
          YNR032C-A HUB1 Ubiquitin-like protein modifier
          Length = 74

 Score = 30.8 bits (68), Expect = 0.86,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 15 DVEIEASSTIKDFKDKIAI-VSEIPAPNQRLIYSGKILKDDQTIESYKIQDGHSIHM 70
          +V+  +  T+ DFK  +++ +    A    L   G +LKD  T+E Y++ DG ++ +
Sbjct: 15 NVKCLSEDTVGDFKKVLSVQLGTASASKIVLQKGGSVLKDHITLEDYEVHDGTNLEL 71

>KLTH0A06820g Chr1 complement(569895..570116) [222 bp, 73 aa] {ON}
          similar to uniprot|Q6Q546 Saccharomyces cerevisiae
          YNR032C-A HUB1
          Length = 73

 Score = 30.4 bits (67), Expect = 1.3,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 25/49 (51%)

Query: 16 VEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESYKIQD 64
          V+ E   T+ DFK  +A+   I      L   G +LKD  T++ Y++ D
Sbjct: 16 VKCEGEDTVGDFKKVLALQLGISWTKIVLQKGGAVLKDHITLDDYEVHD 64

>Kpol_541.50 s541 complement(162130..163665) [1536 bp, 511 aa] {ON}
           complement(162130..163665) [1536 nt, 512 aa]
          Length = 511

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 21/38 (55%)

Query: 334 RYEHQLRQLNDMGFFDFDKNVAALRRSGGSVQGAVNAL 371
           RY  +L +L +MGF D D N  A+  + G +  A+  L
Sbjct: 233 RYSRELNRLREMGFNDIDNNAEAMSLANGDISRAITIL 270

>CAGL0G07645g Chr7 complement(725259..725540) [282 bp, 93 aa] {ON}
          no similarity
          Length = 93

 Score = 30.0 bits (66), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 8  KSGQNTWDVEIEASSTIKDFKDKIAIVSE-IPAPNQRLIYS 47
          + G N    +I+A  T+KD  D +AI  +  PAP Q L+ S
Sbjct: 52 RHGNNELGSQIQAIGTLKDIHDLVAITGQHAPAPPQPLLAS 92

>Kwal_23.6338 s23 complement(1539443..1539664) [222 bp, 73 aa]
          {ON} YNR032C-A (HUB1) - ubiquitin-like modifier [contig
          17] FULL
          Length = 73

 Score = 29.6 bits (65), Expect = 2.4,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 25/49 (51%)

Query: 16 VEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESYKIQD 64
          V+ EA  T+ DFK  +A+   I      L   G  LKD  +++ Y++ D
Sbjct: 16 VKCEAEDTVGDFKKVLALQMGISWTKIILQKGGSTLKDHISLDDYEVHD 64

>Skud_7.90 Chr7 (163529..164719) [1191 bp, 396 aa] {ON} YGL181W
           (REAL)
          Length = 396

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%)

Query: 334 RYEHQLRQLNDMGFFDFDKNVAALRRSGGSVQGAVNAL 371
           RY  QL +L DMG+ D  KN+ AL  + G++  +++ L
Sbjct: 194 RYSRQLIELRDMGYNDTAKNLDALSFAHGNINRSIDYL 231

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.129    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,157,640
Number of extensions: 1013198
Number of successful extensions: 2633
Number of sequences better than 10.0: 156
Number of HSP's gapped: 2640
Number of HSP's successfully gapped: 254
Length of query: 375
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 264
Effective length of database: 40,753,473
Effective search space: 10758916872
Effective search space used: 10758916872
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 66 (30.0 bits)