Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0D031808.829ON40040018920.0
YMR272C (SCS7)8.829ON38438511861e-162
Smik_13.4858.829ON38438511801e-161
Skud_13.4448.829ON38438511781e-160
Suva_13.4608.829ON38438511701e-159
NCAS0C004708.829ON42639711221e-151
TDEL0B006808.829ON38337911111e-150
Kpol_541.98.829ON37437911041e-149
SAKL0D01760g8.829ON38138310851e-146
NDAI0K004708.829ON38638110761e-145
ZYRO0G13948g8.829ON38438610461e-140
KLLA0D01639g8.829ON38138310431e-140
Kwal_27.103328.829ON37837910371e-139
KLTH0C04114g8.829ON37837910231e-137
CAGL0F03399g8.829ON38038910171e-136
KNAG0J003208.829ON37338510151e-136
AAL183W8.829ON37737910001e-134
TPHA0C047108.829ON3773889811e-131
KAFR0B038508.829ON3773849661e-128
Ecym_27128.829ON3813849401e-124
Kpol_1069.48.829ON2772696694e-85
Skud_14.2212.166ON120551326e-09
Suva_14.2282.166ON120551317e-09
Kpol_505.142.166ON123571311e-08
ZYRO0B09812g2.166ON183581331e-08
TBLA0B013102.166ON123801273e-08
NDAI0F027302.166ON121571273e-08
TDEL0F012102.166ON126561222e-07
Kwal_26.84612.166ON123571212e-07
KLLA0B14795gna 1ON556561302e-07
NCAS0G025702.166ON121551212e-07
YNL111C (CYB5)2.166ON120551202e-07
KNAG0I020402.166ON119551203e-07
SAKL0E10626g2.166ON123571169e-07
Smik_14.2162.166ON120551169e-07
AFL223W2.166ON165571171e-06
KLTH0D09284g2.166ON123571142e-06
CAGL0L03828g2.166ON121551132e-06
KLTH0A04026gna 2ON233561164e-06
KLLA0F27577gna 2ON172561144e-06
ZYRO0C18524gsingletonON554691187e-06
TPHA0F017902.166ON182571127e-06
Ecym_4346na 2ON209551138e-06
ADL085Cna 2ON273911131e-05
NCAS0A02770na 3ON609571151e-05
Ecym_54202.166ON145531082e-05
TDEL0D00190singletonON552881142e-05
KLTH0C11858gsingletonON555531133e-05
Kwal_47.18167na 2ON2271121093e-05
KAFR0I005204.304ON586621123e-05
KLLA0F23672g2.166ON123571043e-05
SAKL0F16610gsingletonON564531124e-05
KLTH0D06930g2.536ON204551075e-05
YML054C (CYB2)4.304ON591591106e-05
Smik_13.924.304ON591591107e-05
Kpol_1014.54.304ON596551097e-05
Kwal_23.2823na 1ON560511098e-05
SAKL0F08316gna 2ON178541049e-05
TPHA0B018204.304ON576511081e-04
NDAI0D04700na 3ON625481081e-04
TDEL0H02180na 2ON203551041e-04
NDAI0D047104.304ON616561071e-04
Suva_13.1054.304ON591591062e-04
KAFR0B045502.166ON12655992e-04
SAKL0G16852g4.304ON580501062e-04
KNAG0E038604.304ON604541053e-04
TDEL0D011404.304ON584571053e-04
Skud_13.924.304ON591591043e-04
Kwal_14.807singletonON578571043e-04
CAGL0K10736g4.304ON593571043e-04
KLLA0D02640g4.304ON589581034e-04
NCAS0A027804.304ON602571035e-04
CAGL0K03069g2.536ON19453995e-04
KLTH0C11770gsingletonON618531026e-04
ZYRO0B13728g4.304ON598581017e-04
ZYRO0D16654gna 2ON19055977e-04
ZYRO0B02090g2.536ON19457960.001
NCAS0F008702.536ON18949930.003
Kwal_26.80462.536ON19855870.016
Kpol_348.122.536ON21761870.020
NDAI0H013702.536ON22454820.087
KLLA0E18459g2.536ON14849800.092
TPHA0G035502.536ON21854800.14
TDEL0A031102.536ON20057760.39
TBLA0I015302.536ON22155760.56
SAKL0A09570g2.536ON21153740.80
AAL078Wna 4ON59275760.80
NCAS0D032506.106ON49767741.4
SAKL0A07326g6.106ON48047731.6
KLTH0G09636g2.253ON1599103731.9
Kpol_478.176.106ON48461722.0
ZYRO0C05016g6.106ON48347703.7
KLTH0H06798g6.106ON48861704.2
KNAG0C057802.536ON18060674.7
Suva_7.2166.106ON47045686.6
TBLA0C06220singletonON49447687.0
Suva_13.2502.536ON20139668.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0D03180
         (400 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0D03180 Chr4 complement(774883..776085) [1203 bp, 400 aa] {O...   733   0.0  
YMR272C Chr13 complement(809623..810777) [1155 bp, 384 aa] {ON} ...   461   e-162
Smik_13.485 Chr13 complement(792640..793794) [1155 bp, 384 aa] {...   459   e-161
Skud_13.444 Chr13 complement(783092..784246) [1155 bp, 384 aa] {...   458   e-160
Suva_13.460 Chr13 complement(792221..793375) [1155 bp, 384 aa] {...   455   e-159
NCAS0C00470 Chr3 (78059..79339) [1281 bp, 426 aa] {ON} Anc_8.829      436   e-151
TDEL0B00680 Chr2 (128650..129801) [1152 bp, 383 aa] {ON} Anc_8.8...   432   e-150
Kpol_541.9 s541 complement(23399..24523) [1125 bp, 374 aa] {ON} ...   429   e-149
SAKL0D01760g Chr4 (140050..141195) [1146 bp, 381 aa] {ON} simila...   422   e-146
NDAI0K00470 Chr11 (107509..108669) [1161 bp, 386 aa] {ON} Anc_8....   419   e-145
ZYRO0G13948g Chr7 complement(1109941..1111095) [1155 bp, 384 aa]...   407   e-140
KLLA0D01639g Chr4 complement(146344..147489) [1146 bp, 381 aa] {...   406   e-140
Kwal_27.10332 s27 (289484..290620) [1137 bp, 378 aa] {ON} YMR272...   404   e-139
KLTH0C04114g Chr3 (357195..358331) [1137 bp, 378 aa] {ON} highly...   398   e-137
CAGL0F03399g Chr6 complement(333955..335097) [1143 bp, 380 aa] {...   396   e-136
KNAG0J00320 Chr10 (50267..51388) [1122 bp, 373 aa] {ON} Anc_8.82...   395   e-136
AAL183W Chr1 (13713..14846) [1134 bp, 377 aa] {ON} Syntenic homo...   389   e-134
TPHA0C04710 Chr3 complement(1015392..1016525) [1134 bp, 377 aa] ...   382   e-131
KAFR0B03850 Chr2 complement(796399..797532) [1134 bp, 377 aa] {O...   376   e-128
Ecym_2712 Chr2 (1378070..1379215) [1146 bp, 381 aa] {ON} similar...   366   e-124
Kpol_1069.4 s1069 (6163..6996) [834 bp, 277 aa] {ON} (6163..6996...   262   4e-85
Skud_14.221 Chr14 complement(407119..407481) [363 bp, 120 aa] {O...    55   6e-09
Suva_14.228 Chr14 complement(413753..414115) [363 bp, 120 aa] {O...    55   7e-09
Kpol_505.14 s505 (37085..37456) [372 bp, 123 aa] {ON} (37085..37...    55   1e-08
ZYRO0B09812g Chr2 (765874..766425) [552 bp, 183 aa] {ON} similar...    56   1e-08
TBLA0B01310 Chr2 (276173..276544) [372 bp, 123 aa] {ON} Anc_2.16...    54   3e-08
NDAI0F02730 Chr6 (669821..670186) [366 bp, 121 aa] {ON} Anc_2.166      54   3e-08
TDEL0F01210 Chr6 complement(216322..216702) [381 bp, 126 aa] {ON...    52   2e-07
Kwal_26.8461 s26 (794482..794853) [372 bp, 123 aa] {ON} YNL111C ...    51   2e-07
KLLA0B14795g Chr2 (1299429..1301099) [1671 bp, 556 aa] {ON} simi...    55   2e-07
NCAS0G02570 Chr7 complement(460218..460583) [366 bp, 121 aa] {ON...    51   2e-07
YNL111C Chr14 complement(416940..417302) [363 bp, 120 aa] {ON}  ...    51   2e-07
KNAG0I02040 Chr9 (397527..397886) [360 bp, 119 aa] {ON} Anc_2.16...    51   3e-07
SAKL0E10626g Chr5 (885272..885643) [372 bp, 123 aa] {ON} similar...    49   9e-07
Smik_14.216 Chr14 complement(396585..396947) [363 bp, 120 aa] {O...    49   9e-07
AFL223W Chr6 (19601..20098) [498 bp, 165 aa] {ON} Syntenic homol...    50   1e-06
KLTH0D09284g Chr4 (770560..770931) [372 bp, 123 aa] {ON} similar...    49   2e-06
CAGL0L03828g Chr12 (442660..443025) [366 bp, 121 aa] {ON} simila...    48   2e-06
KLTH0A04026g Chr1 complement(337200..337901) [702 bp, 233 aa] {O...    49   4e-06
KLLA0F27577g Chr6 (2556662..2557180) [519 bp, 172 aa] {ON} some ...    49   4e-06
ZYRO0C18524g Chr3 (1450641..1452305) [1665 bp, 554 aa] {ON} simi...    50   7e-06
TPHA0F01790 Chr6 (412270..412818) [549 bp, 182 aa] {ON} Anc_2.16...    48   7e-06
Ecym_4346 Chr4 (739106..739735) [630 bp, 209 aa] {ON} similar to...    48   8e-06
ADL085C Chr4 complement(535293..536114) [822 bp, 273 aa] {ON} NO...    48   1e-05
NCAS0A02770 Chr1 (528814..530643) [1830 bp, 609 aa] {ON}               49   1e-05
Ecym_5420 Chr5 (865505..865942) [438 bp, 145 aa] {ON} similar to...    46   2e-05
TDEL0D00190 Chr4 (29971..31629) [1659 bp, 552 aa] {ON}                 49   2e-05
KLTH0C11858g Chr3 (979073..980740) [1668 bp, 555 aa] {ON} simila...    48   3e-05
Kwal_47.18167 s47 complement(716570..717253) [684 bp, 227 aa] {O...    47   3e-05
KAFR0I00520 Chr9 complement(107239..108999) [1761 bp, 586 aa] {O...    48   3e-05
KLLA0F23672g Chr6 (2212223..2212594) [372 bp, 123 aa] {ON} simil...    45   3e-05
SAKL0F16610g Chr6 (1373674..1375368) [1695 bp, 564 aa] {ON} simi...    48   4e-05
KLTH0D06930g Chr4 complement(604805..605419) [615 bp, 204 aa] {O...    46   5e-05
YML054C Chr13 complement(165533..167308) [1776 bp, 591 aa] {ON} ...    47   6e-05
Smik_13.92 Chr13 complement(163135..164910) [1776 bp, 591 aa] {O...    47   7e-05
Kpol_1014.5 s1014 complement(3107..4897) [1791 bp, 596 aa] {ON} ...    47   7e-05
Kwal_23.2823 s23 (29032..30714) [1683 bp, 560 aa] {ON} YML054C (...    47   8e-05
SAKL0F08316g Chr6 complement(634949..635485) [537 bp, 178 aa] {O...    45   9e-05
TPHA0B01820 Chr2 complement(406416..408146) [1731 bp, 576 aa] {O...    46   1e-04
NDAI0D04700 Chr4 (1103670..1105547) [1878 bp, 625 aa] {ON}             46   1e-04
TDEL0H02180 Chr8 (369539..370150) [612 bp, 203 aa] {ON}                45   1e-04
NDAI0D04710 Chr4 (1106280..1108130) [1851 bp, 616 aa] {ON} Anc_4...    46   1e-04
Suva_13.105 Chr13 complement(168279..170054) [1776 bp, 591 aa] {...    45   2e-04
KAFR0B04550 Chr2 (946561..946941) [381 bp, 126 aa] {ON} Anc_2.16...    43   2e-04
SAKL0G16852g Chr7 (1452894..1454636) [1743 bp, 580 aa] {ON} simi...    45   2e-04
KNAG0E03860 Chr5 (763388..765202) [1815 bp, 604 aa] {ON} Anc_4.3...    45   3e-04
TDEL0D01140 Chr4 complement(214858..216612) [1755 bp, 584 aa] {O...    45   3e-04
Skud_13.92 Chr13 complement(163654..165429) [1776 bp, 591 aa] {O...    45   3e-04
Kwal_14.807 s14 complement(57218..58954) [1737 bp, 578 aa] {ON} ...    45   3e-04
CAGL0K10736g Chr11 (1046127..1047908) [1782 bp, 593 aa] {ON} hig...    45   3e-04
KLLA0D02640g Chr4 complement(225482..227251) [1770 bp, 589 aa] {...    44   4e-04
NCAS0A02780 Chr1 (531072..532880) [1809 bp, 602 aa] {ON} Anc_4.304     44   5e-04
CAGL0K03069g Chr11 complement(285190..285774) [585 bp, 194 aa] {...    43   5e-04
KLTH0C11770g Chr3 (970979..972835) [1857 bp, 618 aa] {ON} simila...    44   6e-04
ZYRO0B13728g Chr2 (1110636..1112432) [1797 bp, 598 aa] {ON} simi...    44   7e-04
ZYRO0D16654g Chr4 complement(1380316..1380888) [573 bp, 190 aa] ...    42   7e-04
ZYRO0B02090g Chr2 complement(169589..170173) [585 bp, 194 aa] {O...    42   0.001
NCAS0F00870 Chr6 (177678..178247) [570 bp, 189 aa] {ON} Anc_2.53...    40   0.003
Kwal_26.8046 s26 complement(621715..622311) [597 bp, 198 aa] {ON...    38   0.016
Kpol_348.12 s348 complement(21978..22631) [654 bp, 217 aa] {ON} ...    38   0.020
NDAI0H01370 Chr8 (336807..337481) [675 bp, 224 aa] {ON} Anc_2.536      36   0.087
KLLA0E18459g Chr5 (1641507..1641953) [447 bp, 148 aa] {ON} simil...    35   0.092
TPHA0G03550 Chr7 complement(755688..756344) [657 bp, 218 aa] {ON...    35   0.14 
TDEL0A03110 Chr1 complement(554890..555492) [603 bp, 200 aa] {ON...    34   0.39 
TBLA0I01530 Chr9 (334102..334767) [666 bp, 221 aa] {ON} Anc_2.53...    34   0.56 
SAKL0A09570g Chr1 complement(838406..839041) [636 bp, 211 aa] {O...    33   0.80 
AAL078W Chr1 (209600..211378) [1779 bp, 592 aa] {ON} Non-synteni...    34   0.80 
NCAS0D03250 Chr4 (608476..609969) [1494 bp, 497 aa] {ON} Anc_6.106     33   1.4  
SAKL0A07326g Chr1 (648420..649862) [1443 bp, 480 aa] {ON} unipro...    33   1.6  
KLTH0G09636g Chr7 complement(806164..810963) [4800 bp, 1599 aa] ...    33   1.9  
Kpol_478.17 s478 (61375..62829) [1455 bp, 484 aa] {ON} (61375..6...    32   2.0  
ZYRO0C05016g Chr3 (394581..396032) [1452 bp, 483 aa] {ON} simila...    32   3.7  
KLTH0H06798g Chr8 (596966..598432) [1467 bp, 488 aa] {ON} unipro...    32   4.2  
KNAG0C05780 Chr3 (1124591..1125133) [543 bp, 180 aa] {ON} Anc_2....    30   4.7  
Suva_7.216 Chr7 (391750..393162) [1413 bp, 470 aa] {ON} YGL055W ...    31   6.6  
TBLA0C06220 Chr3 (1507690..1509174) [1485 bp, 494 aa] {ON}             31   7.0  
Suva_13.250 Chr13 complement(393510..394115) [606 bp, 201 aa] {O...    30   8.8  

>TBLA0D03180 Chr4 complement(774883..776085) [1203 bp, 400 aa] {ON}
           Anc_8.829 YMR272C
          Length = 400

 Score =  733 bits (1892), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/400 (90%), Positives = 361/400 (90%)

Query: 1   MPASPSTATKTDTVGTSSSPLTKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYP 60
           MPASPSTATKTDTVGTSSSPLTKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYP
Sbjct: 1   MPASPSTATKTDTVGTSSSPLTKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYP 60

Query: 61  KGNSKIIDFAGKDITSSFKNQERYNHDPETYDFMSHNDKYLVGYLANEEEAYKLLSNPSH 120
           KGNSKIIDFAGKDITSSFKNQERYNHDPETYDFMSHNDKYLVGYLANEEEAYKLLSNPSH
Sbjct: 61  KGNSKIIDFAGKDITSSFKNQERYNHDPETYDFMSHNDKYLVGYLANEEEAYKLLSNPSH 120

Query: 121 KVEVKLTEQPSTYDSTTFVKELPSEDHFVIATDYKKDFNEHHFLDLEKPLIPQLWRAKFN 180
           KVEVKLTEQPSTYDSTTFVKELPSEDHFVIATDYKKDFNEHHFLDLEKPLIPQLWRAKFN
Sbjct: 121 KVEVKLTEQPSTYDSTTFVKELPSEDHFVIATDYKKDFNEHHFLDLEKPLIPQLWRAKFN 180

Query: 181 RAFYIDQIHRPRHFGNKSAPLFGNFLEPLTKTAXXXXXXXXXXXXFYHLKVAFHNMNNIF 240
           RAFYIDQIHRPRHFGNKSAPLFGNFLEPLTKTA            FYHLKVAFHNMNNIF
Sbjct: 181 RAFYIDQIHRPRHFGNKSAPLFGNFLEPLTKTAWWVIPVVWLPVVFYHLKVAFHNMNNIF 240

Query: 241 ATFLFCVGVFVWTLIEYSLHRFLFHMDNRIPDHPMFYVLHFTIHGCHHYLPMDPYRLVMP 300
           ATFLFCVGVFVWTLIEYSLHRFLFHMDNRIPDHPMFYVLHFTIHGCHHYLPMDPYRLVMP
Sbjct: 241 ATFLFCVGVFVWTLIEYSLHRFLFHMDNRIPDHPMFYVLHFTIHGCHHYLPMDPYRLVMP 300

Query: 301 PTLFLILCTPFYKLVFSVLPXXXXXXXXXXXXXXXVCYDEVHYWLHHSRVPKFMRXXXXX 360
           PTLFLILCTPFYKLVFSVLP               VCYDEVHYWLHHSRVPKFMR     
Sbjct: 301 PTLFLILCTPFYKLVFSVLPLYWAYAGFAGGLFGYVCYDEVHYWLHHSRVPKFMRLLKKL 360

Query: 361 XXXXXXXNYQLAFGVSNYFWDKVFGTYLYPDSPLSPMKYE 400
                  NYQLAFGVSNYFWDKVFGTYLYPDSPLSPMKYE
Sbjct: 361 HLEHHYKNYQLAFGVSNYFWDKVFGTYLYPDSPLSPMKYE 400

>YMR272C Chr13 complement(809623..810777) [1155 bp, 384 aa] {ON}
           SCS7Sphingolipid alpha-hydroxylase, functions in the
           alpha-hydroxylation of sphingolipid-associated very long
           chain fatty acids, has both cytochrome b5-like and
           hydroxylase/desaturase domains, not essential for growth
          Length = 384

 Score =  461 bits (1186), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 216/385 (56%), Positives = 278/385 (72%), Gaps = 2/385 (0%)

Query: 16  TSSSPLTKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDIT 75
           ++++  T ELFS ++VQ+HNT  DCWV YQNRKIYDV+++L+++P G+  I+D+AGKDIT
Sbjct: 2   STNTSKTLELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDIT 61

Query: 76  SSFKNQERYNHDPETYDFMSHNDKYLVGYLANEEEAYKLLSNPSHKVEVKLTEQPSTYDS 135
              K+ + + H    Y+ +   D+YL+GYLA +EEA +LL+N +HKVEV+L+   + +DS
Sbjct: 62  EIMKDSDVHEHSDSAYEILE--DEYLIGYLATDEEAARLLTNKNHKVEVQLSADGTEFDS 119

Query: 136 TTFVKELPSEDHFVIATDYKKDFNEHHFLDLEKPLIPQLWRAKFNRAFYIDQIHRPRHFG 195
           TTFVKELP+E+   IATDY  D+ +H FLDL +PL+ Q+ R+ F + FY+DQIHRPRH+G
Sbjct: 120 TTFVKELPAEEKLSIATDYSNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYG 179

Query: 196 NKSAPLFGNFLEPLTKTAXXXXXXXXXXXXFYHLKVAFHNMNNIFATFLFCVGVFVWTLI 255
             SAPLFGNFLEPLTKTA             YH+ VA  NMN +FA FLFCVGVFVWTLI
Sbjct: 180 KGSAPLFGNFLEPLTKTAWWVVPVAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLI 239

Query: 256 EYSLHRFLFHMDNRIPDHPMFYVLHFTIHGCHHYLPMDPYRLVMPPTLFLILCTPFYKLV 315
           EY LHRFLFH D+ +P+  + +  HF +HGCHHYLPMD YRLVMPPTLF+ILC PFYKLV
Sbjct: 240 EYGLHRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLV 299

Query: 316 FSVLPXXXXXXXXXXXXXXXVCYDEVHYWLHHSRVPKFMRXXXXXXXXXXXXNYQLAFGV 375
           F++LP               VCYDE H++LHHS++P FMR            NYQL FGV
Sbjct: 300 FALLPLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGV 359

Query: 376 SNYFWDKVFGTYLYPDSPLSPMKYE 400
           +++FWD+VFGTYL PD+PLS MKYE
Sbjct: 360 TSWFWDEVFGTYLGPDAPLSKMKYE 384

>Smik_13.485 Chr13 complement(792640..793794) [1155 bp, 384 aa] {ON}
           YMR272C (REAL)
          Length = 384

 Score =  459 bits (1180), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 215/385 (55%), Positives = 278/385 (72%), Gaps = 2/385 (0%)

Query: 16  TSSSPLTKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDIT 75
           ++++  T ELFS ++V+KHNT KDCWV YQNRKIYDV+++L+++P G+  I+D+AGKDIT
Sbjct: 2   SANTSKTLELFSKKTVEKHNTAKDCWVTYQNRKIYDVTKFLSEHPGGDESILDYAGKDIT 61

Query: 76  SSFKNQERYNHDPETYDFMSHNDKYLVGYLANEEEAYKLLSNPSHKVEVKLTEQPSTYDS 135
              K+ + + H    Y+ +   D+YL+GYLA +EEA +LL+N +HKVEV+L+   + +DS
Sbjct: 62  EVMKDTDVHEHSDSAYEILE--DEYLIGYLATDEEAARLLTNKNHKVEVQLSSDGTEFDS 119

Query: 136 TTFVKELPSEDHFVIATDYKKDFNEHHFLDLEKPLIPQLWRAKFNRAFYIDQIHRPRHFG 195
           TTFVK+LP+E+   IATDY  D+ +H FLDL +PL+ Q+  + F + FY+DQIHRPRH+G
Sbjct: 120 TTFVKDLPAEEKLSIATDYGNDYKKHKFLDLNRPLLMQILCSDFKKDFYVDQIHRPRHYG 179

Query: 196 NKSAPLFGNFLEPLTKTAXXXXXXXXXXXXFYHLKVAFHNMNNIFATFLFCVGVFVWTLI 255
             SAPLFGNFLEPLTKTA             YH+ VA  NMN +FA FLFCVGVFVWTLI
Sbjct: 180 KGSAPLFGNFLEPLTKTAWWVVPTAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLI 239

Query: 256 EYSLHRFLFHMDNRIPDHPMFYVLHFTIHGCHHYLPMDPYRLVMPPTLFLILCTPFYKLV 315
           EY LHRFLFH D+ +P+  + +  HF +HGCHHYLPMD YRLVMPPTLF+ILC PFYKLV
Sbjct: 240 EYGLHRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLV 299

Query: 316 FSVLPXXXXXXXXXXXXXXXVCYDEVHYWLHHSRVPKFMRXXXXXXXXXXXXNYQLAFGV 375
           F++LP               VCYDE H++LHHS++P FMR            NYQL FGV
Sbjct: 300 FALLPLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGV 359

Query: 376 SNYFWDKVFGTYLYPDSPLSPMKYE 400
           +++FWD+VFGTYL PD+PLS MKYE
Sbjct: 360 TSWFWDEVFGTYLGPDAPLSKMKYE 384

>Skud_13.444 Chr13 complement(783092..784246) [1155 bp, 384 aa] {ON}
           YMR272C (REAL)
          Length = 384

 Score =  458 bits (1178), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 215/385 (55%), Positives = 276/385 (71%), Gaps = 2/385 (0%)

Query: 16  TSSSPLTKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDIT 75
           ++++  T ELFS ++V++HNT KDCWV YQNRKIYDV+++L ++P G+  I+D+AGKD+T
Sbjct: 2   STNTSKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDVT 61

Query: 76  SSFKNQERYNHDPETYDFMSHNDKYLVGYLANEEEAYKLLSNPSHKVEVKLTEQPSTYDS 135
              K+ + + H    Y+ +   D+YL+GYLA +EEA +LL+N SHKVEV+L+     +DS
Sbjct: 62  EIMKDSDVHEHSDSAYEIL--EDEYLIGYLATDEEATRLLTNKSHKVEVQLSADGKEFDS 119

Query: 136 TTFVKELPSEDHFVIATDYKKDFNEHHFLDLEKPLIPQLWRAKFNRAFYIDQIHRPRHFG 195
           TTFVK LP+E+   IATDY  D+ +H FLDL +PL+ Q+ R+ F + FY+DQIHRPRH+G
Sbjct: 120 TTFVKNLPTEEKLSIATDYGNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYG 179

Query: 196 NKSAPLFGNFLEPLTKTAXXXXXXXXXXXXFYHLKVAFHNMNNIFATFLFCVGVFVWTLI 255
             SAPLFGNFLEPLTKTA             YH+ VA  NMN +FA FLFCVGVFVWTLI
Sbjct: 180 KGSAPLFGNFLEPLTKTAWWVVPLPWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLI 239

Query: 256 EYSLHRFLFHMDNRIPDHPMFYVLHFTIHGCHHYLPMDPYRLVMPPTLFLILCTPFYKLV 315
           EY LHRFLFH D+ +P+  + +  HF +HGCHHYLPMD YRLVMPPTLF+ILC PFYKLV
Sbjct: 240 EYGLHRFLFHFDDWLPESNVAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLV 299

Query: 316 FSVLPXXXXXXXXXXXXXXXVCYDEVHYWLHHSRVPKFMRXXXXXXXXXXXXNYQLAFGV 375
           F++LP               VCYDE H++LHHS++P FMR            NYQL FGV
Sbjct: 300 FALLPLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGV 359

Query: 376 SNYFWDKVFGTYLYPDSPLSPMKYE 400
           +++FWD+VFGTYL PD+PLS MKYE
Sbjct: 360 TSWFWDEVFGTYLGPDAPLSKMKYE 384

>Suva_13.460 Chr13 complement(792221..793375) [1155 bp, 384 aa] {ON}
           YMR272C (REAL)
          Length = 384

 Score =  455 bits (1170), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 216/385 (56%), Positives = 277/385 (71%), Gaps = 2/385 (0%)

Query: 16  TSSSPLTKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDIT 75
           ++++  T ELFS ++V++HNT KDCWV YQNRKIYDV+++L+++P G   I+D+AGKDIT
Sbjct: 2   STNTSKTLELFSKKTVEEHNTAKDCWVTYQNRKIYDVTKFLSEHPGGEESILDYAGKDIT 61

Query: 76  SSFKNQERYNHDPETYDFMSHNDKYLVGYLANEEEAYKLLSNPSHKVEVKLTEQPSTYDS 135
              K+ + + H    Y+ +   D+YLVGYLA +EEA +LL+N +HKVEV+L+   + +DS
Sbjct: 62  EVMKDSDVHEHSESAYEIL--EDEYLVGYLATDEEATRLLTNKNHKVEVQLSADGTEFDS 119

Query: 136 TTFVKELPSEDHFVIATDYKKDFNEHHFLDLEKPLIPQLWRAKFNRAFYIDQIHRPRHFG 195
           TTFVK+LP+E+   IATDY  D+ +H FLDL KPL+ Q+ R+ F R FY+DQIHRPRH+G
Sbjct: 120 TTFVKDLPTEEKLSIATDYGSDYKKHKFLDLNKPLLMQILRSDFTRDFYVDQIHRPRHYG 179

Query: 196 NKSAPLFGNFLEPLTKTAXXXXXXXXXXXXFYHLKVAFHNMNNIFATFLFCVGVFVWTLI 255
             SAPLFGNFLEPLTKTA             YH+ VA  NMN +FA FLF VG+FVWTLI
Sbjct: 180 KGSAPLFGNFLEPLTKTAWWVVPVAWVPVVVYHMGVALKNMNPLFACFLFGVGMFVWTLI 239

Query: 256 EYSLHRFLFHMDNRIPDHPMFYVLHFTIHGCHHYLPMDPYRLVMPPTLFLILCTPFYKLV 315
           EYSLHRFLFH D+ +P+  + +  HF +HGCHHYLPMD YRLVMPP+LF+ILC PFYKLV
Sbjct: 240 EYSLHRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDGYRLVMPPSLFVILCAPFYKLV 299

Query: 316 FSVLPXXXXXXXXXXXXXXXVCYDEVHYWLHHSRVPKFMRXXXXXXXXXXXXNYQLAFGV 375
           F++LP               VCYDE HY++HHS++P FMR            NYQL FGV
Sbjct: 300 FALLPLYWAYAGFAGGLFGYVCYDECHYFIHHSKLPPFMRKLKKYHLEHHYKNYQLGFGV 359

Query: 376 SNYFWDKVFGTYLYPDSPLSPMKYE 400
           +++FWD VFGTYL PD+PLS MKYE
Sbjct: 360 TSWFWDDVFGTYLGPDAPLSKMKYE 384

>NCAS0C00470 Chr3 (78059..79339) [1281 bp, 426 aa] {ON} Anc_8.829
          Length = 426

 Score =  436 bits (1122), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 210/397 (52%), Positives = 271/397 (68%), Gaps = 6/397 (1%)

Query: 4   SPSTATKTDTVGTSSSPLTKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGN 63
           +P+  T      +S+   T ELFS + V KHNT++DCWV   +RKIYDVS++L D+P G+
Sbjct: 36  TPAKLTTRRNQMSSNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGD 95

Query: 64  SKIIDFAGKDITSSFKNQERYNHDPETYDFMSHNDKYLVGYLANEEEAYKLLSNPSHKVE 123
             I+  AGKDIT   K+ E+ +   +  D     D+YL+GY+A + E  KLL+N  HKVE
Sbjct: 96  KSILKHAGKDITELLKD-EKIDQQTDLLD-----DQYLIGYMATDAEEEKLLTNKDHKVE 149

Query: 124 VKLTEQPSTYDSTTFVKELPSEDHFVIATDYKKDFNEHHFLDLEKPLIPQLWRAKFNRAF 183
           VKL E  +T+DSTTFVK+LP+ED   IATDY+KD  +H+FLDL KPL+ Q+    F + F
Sbjct: 150 VKLNESTNTFDSTTFVKDLPTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDF 209

Query: 184 YIDQIHRPRHFGNKSAPLFGNFLEPLTKTAXXXXXXXXXXXXFYHLKVAFHNMNNIFATF 243
           Y+DQIHRPRH+G +SAPLFGNFLEP TKTA            FYH+ +AF N+N +FA  
Sbjct: 210 YLDQIHRPRHYGQESAPLFGNFLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIM 269

Query: 244 LFCVGVFVWTLIEYSLHRFLFHMDNRIPDHPMFYVLHFTIHGCHHYLPMDPYRLVMPPTL 303
           LFC+GV+VWT IEY +HRFLFH D R+P+H   Y++HF +HGCHHYLPMD YRLV+PP L
Sbjct: 270 LFCIGVYVWTFIEYCMHRFLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVL 329

Query: 304 FLILCTPFYKLVFSVLPXXXXXXXXXXXXXXXVCYDEVHYWLHHSRVPKFMRXXXXXXXX 363
           F+ LC PFYKLVF++LP               +CYD  HY+LHHS++P FMR        
Sbjct: 330 FIFLCAPFYKLVFALLPYYWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRKLKKYHLE 389

Query: 364 XXXXNYQLAFGVSNYFWDKVFGTYLYPDSPLSPMKYE 400
               NYQL +GV++++WDK FGTYL PDSPLS MKY+
Sbjct: 390 HHYKNYQLGYGVTSWYWDKKFGTYLSPDSPLSKMKYQ 426

>TDEL0B00680 Chr2 (128650..129801) [1152 bp, 383 aa] {ON} Anc_8.829
           YMR272C
          Length = 383

 Score =  432 bits (1111), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 210/379 (55%), Positives = 259/379 (68%), Gaps = 3/379 (0%)

Query: 22  TKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSFKNQ 81
           T ELFS + V +HN   DCWV   NRKIYDV+++L ++P G   I+D+AGKDIT   K+ 
Sbjct: 8   TLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVLKDS 67

Query: 82  ERYNHDPETYDFMSHNDKYLVGYLANEEEAYKLLSNPSHKVEVKLTEQPSTYDSTTFVKE 141
             + H    Y+ +  +  YLVGY+A E E  +LL+N SHKVEVKL      +DSTTFVK+
Sbjct: 68  TIHEHSESAYEILE-DSSYLVGYMATELEEKELLTNSSHKVEVKLATL--DFDSTTFVKD 124

Query: 142 LPSEDHFVIATDYKKDFNEHHFLDLEKPLIPQLWRAKFNRAFYIDQIHRPRHFGNKSAPL 201
           LP+E+   IATDY +D+  HHFLDL+KPL+PQ+   KF + FY+DQIHRPRH+G  SAPL
Sbjct: 125 LPTEEKLSIATDYSRDYKRHHFLDLQKPLLPQVMFGKFTKDFYVDQIHRPRHYGKGSAPL 184

Query: 202 FGNFLEPLTKTAXXXXXXXXXXXXFYHLKVAFHNMNNIFATFLFCVGVFVWTLIEYSLHR 261
           FGNFLEPL+KT+             YH+ VAF NMN IF  F FC+G FVWTLIEY LHR
Sbjct: 185 FGNFLEPLSKTSWYVIPMVWLPVVLYHVGVAFKNMNPIFTIFFFCLGTFVWTLIEYGLHR 244

Query: 262 FLFHMDNRIPDHPMFYVLHFTIHGCHHYLPMDPYRLVMPPTLFLILCTPFYKLVFSVLPX 321
           FLFH D+ +P+  + + LHF +HG HHYLPMD YRLVMPPTLF+ILCTPFYKLVF +LP 
Sbjct: 245 FLFHFDDWLPESNVCFTLHFLLHGVHHYLPMDKYRLVMPPTLFVILCTPFYKLVFGLLPL 304

Query: 322 XXXXXXXXXXXXXXVCYDEVHYWLHHSRVPKFMRXXXXXXXXXXXXNYQLAFGVSNYFWD 381
                         VCYD  HY+LHHS++P FMR            NYQL FGV+++FWD
Sbjct: 305 YVAYAGFAGGLFGYVCYDLTHYFLHHSKLPSFMRKLKKYHLEHHYKNYQLGFGVTSWFWD 364

Query: 382 KVFGTYLYPDSPLSPMKYE 400
           KVFGTYL P SP+S MKY+
Sbjct: 365 KVFGTYLSPTSPISQMKYD 383

>Kpol_541.9 s541 complement(23399..24523) [1125 bp, 374 aa] {ON}
           complement(23399..24523) [1125 nt, 375 aa]
          Length = 374

 Score =  429 bits (1104), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 214/379 (56%), Positives = 257/379 (67%), Gaps = 12/379 (3%)

Query: 22  TKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSFKNQ 81
           T ELF+    ++HNT+ DCWV  + R IYDVS YL D    +S I++ AGKDIT   K +
Sbjct: 8   TLELFAKSRFEEHNTEADCWVSVKERLIYDVSSYLKDNADADSSILEHAGKDITKLTKTR 67

Query: 82  ERYNHDPETYDFMSHNDKYLVGYLANEEEAYKLLSNPSHKVEVKLTEQPSTYDSTTFVKE 141
           E        + F+S  D+YLVGYLA EEE  +LL+N  HKVEV L  Q  TYDST FVKE
Sbjct: 68  E--------FKFIS--DEYLVGYLATEEEEVRLLTNKDHKVEVNL--QDGTYDSTVFVKE 115

Query: 142 LPSEDHFVIATDYKKDFNEHHFLDLEKPLIPQLWRAKFNRAFYIDQIHRPRHFGNKSAPL 201
           LP+E+ F +ATD  KDF +HHFLDL KP++ Q+    F R FYIDQ+HRPRH+G  SAPL
Sbjct: 116 LPAEEKFTVATDLGKDFQDHHFLDLNKPMLWQVLFGNFTRDFYIDQVHRPRHYGKGSAPL 175

Query: 202 FGNFLEPLTKTAXXXXXXXXXXXXFYHLKVAFHNMNNIFATFLFCVGVFVWTLIEYSLHR 261
           FGNFLEP++ T              YHL VA +NMNNIFA FLFC+G+FVWTLIEY LHR
Sbjct: 176 FGNFLEPISLTPWWLIPIIWGPVVVYHLSVALNNMNNIFAGFLFCLGIFVWTLIEYCLHR 235

Query: 262 FLFHMDNRIPDHPMFYVLHFTIHGCHHYLPMDPYRLVMPPTLFLILCTPFYKLVFSVLPX 321
           FLFH+D+ +P H +FY LHF +HG HHYLPMD YRLV+PP LFL+LCTP YKLVF +LP 
Sbjct: 236 FLFHLDDWVPQHNIFYTLHFLLHGVHHYLPMDQYRLVVPPALFLVLCTPIYKLVFGLLPL 295

Query: 322 XXXXXXXXXXXXXXVCYDEVHYWLHHSRVPKFMRXXXXXXXXXXXXNYQLAFGVSNYFWD 381
                         +CYD  HY++HH ++PKFMR            NYQL FGVSNYFWD
Sbjct: 296 YWAYAGFAGGLLGYICYDLTHYFIHHVKLPKFMRKVKKHHLEHHYKNYQLGFGVSNYFWD 355

Query: 382 KVFGTYLYPDSPLSPMKYE 400
           KVFGTYL PDSP S M+Y+
Sbjct: 356 KVFGTYLGPDSPASIMRYK 374

>SAKL0D01760g Chr4 (140050..141195) [1146 bp, 381 aa] {ON} similar
           to uniprot|Q03529 Saccharomyces cerevisiae YMR272C SCS7
           Required for the hydroxylation of the very long chain
           fatty acid (VLCFA) located in the endoplasmic reticulum
           desaturase/hydroxylase enzyme
          Length = 381

 Score =  422 bits (1085), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 210/383 (54%), Positives = 260/383 (67%), Gaps = 3/383 (0%)

Query: 18  SSPLTKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSS 77
           S   T  L S   + +HNTK+DCWV   NRK+Y+V+ +L ++P G+  I+D AG+DIT  
Sbjct: 2   SESKTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEI 61

Query: 78  FKNQERYNHDPETYDFMSHNDKYLVGYLANEEEAYKLLSNPSHKVEVKLTEQPSTYDSTT 137
            K++  + H    Y+ M  ND YLVGYLANEEE  KLL+N  H VEVKL E  + +DSTT
Sbjct: 62  MKDKLVHEHSESAYEIM--NDMYLVGYLANEEEEKKLLTNEDHTVEVKLNES-TQFDSTT 118

Query: 138 FVKELPSEDHFVIATDYKKDFNEHHFLDLEKPLIPQLWRAKFNRAFYIDQIHRPRHFGNK 197
           FVKELP+ED   IATDY  D+ +H FLDL+KPL+ Q+    F + FY+DQ+HRPRH+G  
Sbjct: 119 FVKELPTEDKLSIATDYSSDYKKHKFLDLDKPLLWQVVFGNFTKDFYLDQVHRPRHYGKG 178

Query: 198 SAPLFGNFLEPLTKTAXXXXXXXXXXXXFYHLKVAFHNMNNIFATFLFCVGVFVWTLIEY 257
           SAPLFGNFLEPL+KT             FYHL VA  NMN  FA FLF +GVFVWTLIEY
Sbjct: 179 SAPLFGNFLEPLSKTPWYAIPIAWLPVVFYHLYVALTNMNKPFALFLFSLGVFVWTLIEY 238

Query: 258 SLHRFLFHMDNRIPDHPMFYVLHFTIHGCHHYLPMDPYRLVMPPTLFLILCTPFYKLVFS 317
            LHRFLFH+D  +P+  + + LHF +HG HHYLPMD YRLVMPPTLF++LCTPFYKLVFS
Sbjct: 239 CLHRFLFHLDQYLPERQLAFALHFLLHGVHHYLPMDRYRLVMPPTLFVLLCTPFYKLVFS 298

Query: 318 VLPXXXXXXXXXXXXXXXVCYDEVHYWLHHSRVPKFMRXXXXXXXXXXXXNYQLAFGVSN 377
           +LP                CYD  HY+LHH+++P +MR            NY+L FGV++
Sbjct: 299 LLPYYWACAGFAGGMLGYTCYDLTHYFLHHAKLPPYMRKLKKYHLEHHYKNYELGFGVTS 358

Query: 378 YFWDKVFGTYLYPDSPLSPMKYE 400
           +FWDKVFGTYL  D+PLS MKYE
Sbjct: 359 WFWDKVFGTYLGSDAPLSKMKYE 381

>NDAI0K00470 Chr11 (107509..108669) [1161 bp, 386 aa] {ON} Anc_8.829
          Length = 386

 Score =  419 bits (1076), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 204/381 (53%), Positives = 262/381 (68%), Gaps = 4/381 (1%)

Query: 22  TKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSK--IIDFAGKDITSSFK 79
           T ELFS + V  HNT  DCW+ +Q+RKIYDV+++L D P   +K  +++FAGKDIT   K
Sbjct: 8   TLELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGKDITDELK 67

Query: 80  NQERYNHDPETYDFMSHNDKYLVGYLANEEEAYKLLSNPSHKVEVKLTEQPSTYDSTTFV 139
           ++     +P     +   D+YL+GYLA + E   LL+N  HKVEV+L E  + +DSTTFV
Sbjct: 68  DKIDSIKNPSFP--ILQTDQYLIGYLATDHEEKTLLTNKDHKVEVQLNEATNGFDSTTFV 125

Query: 140 KELPSEDHFVIATDYKKDFNEHHFLDLEKPLIPQLWRAKFNRAFYIDQIHRPRHFGNKSA 199
           K+LP+ED   IATD KKD  +H FLDL+KPL+ Q+    F + FY+DQIHRPRH+G+KSA
Sbjct: 126 KDLPTEDKLSIATDTKKDLEKHKFLDLDKPLLKQILFGNFTKDFYLDQIHRPRHYGDKSA 185

Query: 200 PLFGNFLEPLTKTAXXXXXXXXXXXXFYHLKVAFHNMNNIFATFLFCVGVFVWTLIEYSL 259
           PLFGN LEPLTKT+            FYH+ VA  NMN IFA  LF +G++VWTLIEY +
Sbjct: 186 PLFGNILEPLTKTSWYLVPIFWLPVVFYHIAVALTNMNPIFAIVLFAIGIYVWTLIEYCM 245

Query: 260 HRFLFHMDNRIPDHPMFYVLHFTIHGCHHYLPMDPYRLVMPPTLFLILCTPFYKLVFSVL 319
           HRFLFH D R+P+H +FYV+HF +HGCHHYLPMD YRLV+PPTLF+ LC PFYK+VF +L
Sbjct: 246 HRFLFHFDERLPEHNIFYVIHFLLHGCHHYLPMDKYRLVVPPTLFIFLCFPFYKVVFKLL 305

Query: 320 PXXXXXXXXXXXXXXXVCYDEVHYWLHHSRVPKFMRXXXXXXXXXXXXNYQLAFGVSNYF 379
           P               VCYD  HY+LHHS++P  +R            NYQL +GV++++
Sbjct: 306 PLYWAYAGFAGGLFGYVCYDLCHYFLHHSKMPPPLRKLKKYHLEHHYKNYQLGYGVTSWY 365

Query: 380 WDKVFGTYLYPDSPLSPMKYE 400
           WDK+FGTYL PDSP+S MKYE
Sbjct: 366 WDKIFGTYLSPDSPMSKMKYE 386

>ZYRO0G13948g Chr7 complement(1109941..1111095) [1155 bp, 384 aa]
           {ON} similar to uniprot|Q03529 Saccharomyces cerevisiae
           YMR272C SCS7 Required for the hydroxylation of the very
           long chain fatty acid (VLCFA) located in the endoplasmic
           reticulum desaturase/hydroxylase enzyme
          Length = 384

 Score =  407 bits (1046), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 198/386 (51%), Positives = 262/386 (67%), Gaps = 4/386 (1%)

Query: 16  TSSSPLTKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDIT 75
           ++ SP T +LFS E + KHN +KDCWV    RKIY+V+++L ++P G   I+ +AG+DIT
Sbjct: 2   STKSP-TLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDIT 60

Query: 76  SSFKNQERYNHDPETYDFMSHNDKYLVGYLANEEEAYKLLSNPSHKVEVKLTEQP-STYD 134
              K+++ + H    Y+ +  +D YLVGYLA +EEA KLL+N  H+VEV LT+Q  S +D
Sbjct: 61  EVLKDRDVHEHSESAYEIL--DDNYLVGYLATKEEATKLLTNKKHQVEVHLTDQNNSDFD 118

Query: 135 STTFVKELPSEDHFVIATDYKKDFNEHHFLDLEKPLIPQLWRAKFNRAFYIDQIHRPRHF 194
           STTFV ELP+E+   IATDY +D+ +H FLDL + L+PQ+    F++ FY+DQ+HRPRH+
Sbjct: 119 STTFVPELPAEEKLNIATDYGRDYKKHKFLDLNRALLPQVMFGNFSKDFYLDQVHRPRHY 178

Query: 195 GNKSAPLFGNFLEPLTKTAXXXXXXXXXXXXFYHLKVAFHNMNNIFATFLFCVGVFVWTL 254
           G  SAPLFGNFLEP++KT              +H  V F NMN +F+TFLFC+G+FVWTL
Sbjct: 179 GKGSAPLFGNFLEPISKTPWWAIPIIWIPVVSFHFYVGFTNMNKLFSTFLFCLGIFVWTL 238

Query: 255 IEYSLHRFLFHMDNRIPDHPMFYVLHFTIHGCHHYLPMDPYRLVMPPTLFLILCTPFYKL 314
           IEY LHRFLFH+D  +PD+     LHF +HG HHYLPMD YRLVMPPTL ++L  P YK 
Sbjct: 239 IEYCLHRFLFHLDEWLPDNNAALTLHFLLHGVHHYLPMDRYRLVMPPTLGIVLMAPIYKT 298

Query: 315 VFSVLPXXXXXXXXXXXXXXXVCYDEVHYWLHHSRVPKFMRXXXXXXXXXXXXNYQLAFG 374
           VF +LP               VCYD  HY+LHH+++P +MR            NYQL FG
Sbjct: 299 VFGLLPTYWAYSGFAGGLFGYVCYDLTHYFLHHAKLPSYMRKLKKYHLEHHYKNYQLGFG 358

Query: 375 VSNYFWDKVFGTYLYPDSPLSPMKYE 400
           V+++FWD VFGTYL PD+PL+ MKY+
Sbjct: 359 VTSWFWDNVFGTYLGPDAPLAHMKYD 384

>KLLA0D01639g Chr4 complement(146344..147489) [1146 bp, 381 aa] {ON}
           similar to uniprot|Q03529 Saccharomyces cerevisiae
           YMR272C SCS7 Required for the hydroxylation of the very
           long chain fatty acid (VLCFA) located in the endoplasmic
           reticulum desaturase/hydroxylase enzyme
          Length = 381

 Score =  406 bits (1043), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 202/383 (52%), Positives = 255/383 (66%), Gaps = 3/383 (0%)

Query: 18  SSPLTKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSS 77
           SS     L+S   ++KHN K DCWV    RKIY+V+++L ++P G   I+D+AG DIT  
Sbjct: 2   SSSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDV 61

Query: 78  FKNQERYNHDPETYDFMSHNDKYLVGYLANEEEAYKLLSNPSHKVEVKLTEQPSTYDSTT 137
            K+   + H    Y+ M  ++ YLVGYLA EEE  KLL+N  H VEV L    + +DST 
Sbjct: 62  MKDVLTHEHSESAYEIM--DESYLVGYLATEEEEKKLLTNKDHVVEVNLKGN-NEFDSTV 118

Query: 138 FVKELPSEDHFVIATDYKKDFNEHHFLDLEKPLIPQLWRAKFNRAFYIDQIHRPRHFGNK 197
           FVKELP+ED   IATDY+ D+ +H FLDL KPL+ Q+   KF + FY+DQ+HRPRH+G  
Sbjct: 119 FVKELPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKG 178

Query: 198 SAPLFGNFLEPLTKTAXXXXXXXXXXXXFYHLKVAFHNMNNIFATFLFCVGVFVWTLIEY 257
           SAPLFGNFLEPL+KT              YH+  A  NMN  FA FLF VGVFVWTLIEY
Sbjct: 179 SAPLFGNFLEPLSKTPWWMVPVVWLPVVTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEY 238

Query: 258 SLHRFLFHMDNRIPDHPMFYVLHFTIHGCHHYLPMDPYRLVMPPTLFLILCTPFYKLVFS 317
            LHRFLFH+D+R+P+    + LHF +HG HHYLPMD +RLVMPPTLF++LCTPFYKLVF+
Sbjct: 239 GLHRFLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFA 298

Query: 318 VLPXXXXXXXXXXXXXXXVCYDEVHYWLHHSRVPKFMRXXXXXXXXXXXXNYQLAFGVSN 377
           +LP               VCYD  HY+LHHS++P +MR            NY+L FGV++
Sbjct: 299 LLPYYWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRKLKKYHLEHHYKNYELGFGVTS 358

Query: 378 YFWDKVFGTYLYPDSPLSPMKYE 400
           +FWDKVFGTYL  ++PLS MKY+
Sbjct: 359 WFWDKVFGTYLGENAPLSNMKYD 381

>Kwal_27.10332 s27 (289484..290620) [1137 bp, 378 aa] {ON} YMR272C
           (SCS7) - desaturase/hydroxylase enzyme [contig 36] FULL
          Length = 378

 Score =  404 bits (1037), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 194/379 (51%), Positives = 255/379 (67%), Gaps = 5/379 (1%)

Query: 22  TKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSFKNQ 81
           T  L+S   VQ+HN+  DCWV  QNRKIYDV+++L D+P G   I+++AGKDIT   K+ 
Sbjct: 5   TLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVMKDG 64

Query: 82  ERYNHDPETYDFMSHNDKYLVGYLANEEEAYKLLSNPSHKVEVKLTEQPSTYDSTTFVKE 141
             ++H    Y+ +  +++Y VGYLA  EE  KLL N  HKVEVKL ++   YDST FV E
Sbjct: 65  PLHSHSFVAYEVL--DEEYHVGYLATAEEEQKLLGNSKHKVEVKLEDE---YDSTVFVPE 119

Query: 142 LPSEDHFVIATDYKKDFNEHHFLDLEKPLIPQLWRAKFNRAFYIDQIHRPRHFGNKSAPL 201
           +P+E+   I TDY +D+  H FLDL +PL+ Q+  A F + FY+DQ+HRPRH+G  SAPL
Sbjct: 120 VPAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPL 179

Query: 202 FGNFLEPLTKTAXXXXXXXXXXXXFYHLKVAFHNMNNIFATFLFCVGVFVWTLIEYSLHR 261
           FGNFLEPL+KT+             YH+  A  NMN +FA FLF VG+FVWTLIEY +HR
Sbjct: 180 FGNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHR 239

Query: 262 FLFHMDNRIPDHPMFYVLHFTIHGCHHYLPMDPYRLVMPPTLFLILCTPFYKLVFSVLPX 321
           FLFH+D  +P + + Y +HF +HG HHYLPMD YRLVMPPTLFL+LCTPFYKLVF++LP 
Sbjct: 240 FLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMPPTLFLLLCTPFYKLVFALLPY 299

Query: 322 XXXXXXXXXXXXXXVCYDEVHYWLHHSRVPKFMRXXXXXXXXXXXXNYQLAFGVSNYFWD 381
                         VCYD  HY+LHH+++P  ++            NY+L FGV+++ WD
Sbjct: 300 YWACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWD 359

Query: 382 KVFGTYLYPDSPLSPMKYE 400
           KVFGTYL  ++PLS MK++
Sbjct: 360 KVFGTYLAENAPLSQMKFD 378

>KLTH0C04114g Chr3 (357195..358331) [1137 bp, 378 aa] {ON} highly
           similar to uniprot|Q03529 Saccharomyces cerevisiae
           YMR272C SCS7 Required for the hydroxylation of the very
           long chain fatty acid (VLCFA) located in the endoplasmic
           reticulum desaturase/hydroxylase enzyme
          Length = 378

 Score =  398 bits (1023), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 193/379 (50%), Positives = 254/379 (67%), Gaps = 5/379 (1%)

Query: 22  TKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSFKNQ 81
           T  L+S   +++HNT+ DCWV   +RKIY+V+ +L ++P G   I ++AGKD+T   K+ 
Sbjct: 5   TLPLYSQSQLEQHNTRDDCWVSLHHRKIYNVTSFLDEHPGGAELIEEYAGKDVTEIMKDG 64

Query: 82  ERYNHDPETYDFMSHNDKYLVGYLANEEEAYKLLSNPSHKVEVKLTEQPSTYDSTTFVKE 141
             + H    Y+ +  +++Y VGYLA  EE  KLL NP H VEVKL E    YDST FV E
Sbjct: 65  PTHEHSYVAYEVL--DEEYHVGYLATPEEEKKLLGNPEHPVEVKLEED---YDSTVFVPE 119

Query: 142 LPSEDHFVIATDYKKDFNEHHFLDLEKPLIPQLWRAKFNRAFYIDQIHRPRHFGNKSAPL 201
           +P E+   I TDY KD+  H FLDL +PL+ Q+  + F++ FY+DQ+HRPRH+G  SAPL
Sbjct: 120 VPPEEKLSIVTDYTKDYGRHKFLDLNRPLLMQMLTSDFSKEFYLDQVHRPRHYGRGSAPL 179

Query: 202 FGNFLEPLTKTAXXXXXXXXXXXXFYHLKVAFHNMNNIFATFLFCVGVFVWTLIEYSLHR 261
           FGNFLEPL+KTA             YH+  A  NMNN+ A FLFC+GVFVWTLIEY LHR
Sbjct: 180 FGNFLEPLSKTAWYVIPLVWFPVVVYHMYTALQNMNNVLAVFLFCLGVFVWTLIEYGLHR 239

Query: 262 FLFHMDNRIPDHPMFYVLHFTIHGCHHYLPMDPYRLVMPPTLFLILCTPFYKLVFSVLPX 321
           FLFH+D  +P + + Y +HF +HG HHYLPMD YRLVMPPTLF++LCTPFYKLVF++LP 
Sbjct: 240 FLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMPPTLFVVLCTPFYKLVFALLPK 299

Query: 322 XXXXXXXXXXXXXXVCYDEVHYWLHHSRVPKFMRXXXXXXXXXXXXNYQLAFGVSNYFWD 381
                         +CYD  HY+LHH+++P +MR            NY+L FGV+++FWD
Sbjct: 300 YWACAGFAGGMFGYMCYDLTHYFLHHAKLPSYMRKLKKYHMEHHYKNYELGFGVTSWFWD 359

Query: 382 KVFGTYLYPDSPLSPMKYE 400
           KVFGTYL  ++PLS MK++
Sbjct: 360 KVFGTYLGDNAPLSQMKFD 378

>CAGL0F03399g Chr6 complement(333955..335097) [1143 bp, 380 aa] {ON}
           highly similar to uniprot|Q03529 Saccharomyces
           cerevisiae YMR272c SCS7 required for hydroxylation of
           ceramide
          Length = 380

 Score =  396 bits (1017), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 204/389 (52%), Positives = 251/389 (64%), Gaps = 16/389 (4%)

Query: 16  TSSSPLTKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNS---KIIDFA-G 71
            + S  T ELF    + KHN+K DCWV    RKIYDVS+YL D+P+      K +D   G
Sbjct: 4   AADSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHG 63

Query: 72  KDITSSFKNQERYNHDPETYDFMSHNDKYLVGYLANEEEAYKLLSNPSHKVEVKLTEQPS 131
            DI+           +  T  F++  D YLVGYLA  +E  KLL+N SHKVEVKL    +
Sbjct: 64  TDISQM---------ELTTLKFVT--DDYLVGYLATSDEEKKLLTNKSHKVEVKLNAD-N 111

Query: 132 TYDSTTFVKELPSEDHFVIATDYKKDFNEHHFLDLEKPLIPQLWRAKFNRAFYIDQIHRP 191
           T+DSTTFVK+LP+ED   I TDY++D+ +H FLDL KPL+ Q+    F + FY+DQIHRP
Sbjct: 112 TFDSTTFVKDLPTEDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRP 171

Query: 192 RHFGNKSAPLFGNFLEPLTKTAXXXXXXXXXXXXFYHLKVAFHNMNNIFATFLFCVGVFV 251
           RH+G  SAPLFGNFLE  TKTA             Y +  A  NMNN  A FLF +G+FV
Sbjct: 172 RHYGKGSAPLFGNFLEAFTKTAWWVVPTVWGPVVLYFITTALMNMNNPLALFLFGLGIFV 231

Query: 252 WTLIEYSLHRFLFHMDNRIPDHPMFYVLHFTIHGCHHYLPMDPYRLVMPPTLFLILCTPF 311
           WTLIEY LHRFLFH D  +P+H MF+++HF +HGCHHYLPMD YRLV+PP LF++LC P 
Sbjct: 232 WTLIEYCLHRFLFHFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPI 291

Query: 312 YKLVFSVLPXXXXXXXXXXXXXXXVCYDEVHYWLHHSRVPKFMRXXXXXXXXXXXXNYQL 371
           YKLVF+ LP               +CYD  HY+LHHS++P FMR            NYQL
Sbjct: 292 YKLVFAALPYYWACAGFAGGMLGYICYDLCHYFLHHSKMPPFMRKLKKYHLEHHYKNYQL 351

Query: 372 AFGVSNYFWDKVFGTYLYPDSPLSPMKYE 400
            FGV+++FWDKVFGTYL PD+PLS MKYE
Sbjct: 352 GFGVTSWFWDKVFGTYLGPDAPLSKMKYE 380

>KNAG0J00320 Chr10 (50267..51388) [1122 bp, 373 aa] {ON} Anc_8.829
           YMR272C
          Length = 373

 Score =  395 bits (1015), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 198/385 (51%), Positives = 254/385 (65%), Gaps = 14/385 (3%)

Query: 17  SSSPLTKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITS 76
           SS+  T EL S ++V  HN K D WV+ Q RK+ D+S Y+ + P+    ++  AGKDIT 
Sbjct: 2   SSNSRTLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITD 61

Query: 77  SFKNQERYNHDPETYDFMSHN-DKYLVGYLANEEEAYKLLSNPSHKVEVKLTEQPSTYDS 135
                        +++F   N D +LVGYLA + E  +LLSN  HKVEVKL E   T+DS
Sbjct: 62  ------------RSHEFPGLNADDHLVGYLATDLEEKELLSNKDHKVEVKL-EGGETFDS 108

Query: 136 TTFVKELPSEDHFVIATDYKKDFNEHHFLDLEKPLIPQLWRAKFNRAFYIDQIHRPRHFG 195
           +TFVK+LP+ED   IATD K+D+ +HHFLDLEKPLIPQ+    F + FY+DQIHRPRH+G
Sbjct: 109 STFVKDLPTEDKLSIATDTKRDYQKHHFLDLEKPLIPQVLFGSFTKDFYVDQIHRPRHYG 168

Query: 196 NKSAPLFGNFLEPLTKTAXXXXXXXXXXXXFYHLKVAFHNMNNIFATFLFCVGVFVWTLI 255
             SAPLFGNFLEP++KTA             Y L  +   ++ IFA  LF +G FVWTLI
Sbjct: 169 KGSAPLFGNFLEPISKTAWYVVPIVWGPVVLYFLGRSLKGIHPIFALMLFALGGFVWTLI 228

Query: 256 EYSLHRFLFHMDNRIPDHPMFYVLHFTIHGCHHYLPMDPYRLVMPPTLFLILCTPFYKLV 315
           EY +HRFLFH D+ +P++ + + +HF +HG HHYLPMD YRLV+PP LF++LCTPFYKLV
Sbjct: 229 EYCMHRFLFHFDDWLPENNVAFTIHFLLHGVHHYLPMDGYRLVVPPALFVVLCTPFYKLV 288

Query: 316 FSVLPXXXXXXXXXXXXXXXVCYDEVHYWLHHSRVPKFMRXXXXXXXXXXXXNYQLAFGV 375
           F +LP               +CYD +HY+LHHS++PKFMR            NYQL FGV
Sbjct: 289 FKLLPHYVACAGFAGGMFGYICYDLIHYFLHHSKMPKFMRKLKQYHLEHHYKNYQLGFGV 348

Query: 376 SNYFWDKVFGTYLYPDSPLSPMKYE 400
           SN+FWDKVF TYL  D+P+SPMKY+
Sbjct: 349 SNWFWDKVFDTYLGKDAPISPMKYD 373

>AAL183W Chr1 (13713..14846) [1134 bp, 377 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR272C (SCS7)
          Length = 377

 Score =  389 bits (1000), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 193/379 (50%), Positives = 246/379 (64%), Gaps = 6/379 (1%)

Query: 22  TKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSFKNQ 81
           T  L+S  ++QKH  +  CWV   NRKIYDVSQ+L ++P G+  I+D+AGKDIT+  K++
Sbjct: 5   TLPLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAVLKDK 64

Query: 82  ERYNHDPETYDFMSHNDKYLVGYLANEEEAYKLLSNPSHKVEVKLTEQPSTYDSTTFVKE 141
             + H    Y+ +  ++ YLVGYLA EEE  KLL+N  H +EV     P   D+TTFVKE
Sbjct: 65  LIHEHTEAAYEIL--DESYLVGYLATEEEEIKLLTNEKHVMEV----TPENLDTTTFVKE 118

Query: 142 LPSEDHFVIATDYKKDFNEHHFLDLEKPLIPQLWRAKFNRAFYIDQIHRPRHFGNKSAPL 201
           LP+E+   +ATD+  D+ +HHFLDL KPL+ Q+ R  F R FYIDQIHRPRH+G  SAPL
Sbjct: 119 LPAEEVLSVATDFGTDYTKHHFLDLNKPLLMQVLRGNFTRDFYIDQIHRPRHYGKGSAPL 178

Query: 202 FGNFLEPLTKTAXXXXXXXXXXXXFYHLKVAFHNMNNIFATFLFCVGVFVWTLIEYSLHR 261
           FGNFLEPL+KT              Y+L  A  NM    A   F  GVFVWTLIEYSLHR
Sbjct: 179 FGNFLEPLSKTVWWVVPMVWYPVVLYYLTRALQNMPAHLALTCFAAGVFVWTLIEYSLHR 238

Query: 262 FLFHMDNRIPDHPMFYVLHFTIHGCHHYLPMDPYRLVMPPTLFLILCTPFYKLVFSVLPX 321
           FLFH D+ +P+  + + +HF +HG HHYLPMD YRLVMPP LF++LC PFY+LVFS+ P 
Sbjct: 239 FLFHFDDNMPESNIAFTVHFLLHGVHHYLPMDKYRLVMPPALFVVLCAPFYRLVFSIFPE 298

Query: 322 XXXXXXXXXXXXXXVCYDEVHYWLHHSRVPKFMRXXXXXXXXXXXXNYQLAFGVSNYFWD 381
                         VCYD  HY+LHH ++P FMR            NY+L FGV++++WD
Sbjct: 299 YCACGCFAGGLFGYVCYDVTHYFLHHHKLPPFMRKLKKYHLEHHYKNYELGFGVTSWYWD 358

Query: 382 KVFGTYLYPDSPLSPMKYE 400
           KVFGTYL  +SP+S  K E
Sbjct: 359 KVFGTYLASNSPVSRPKCE 377

>TPHA0C04710 Chr3 complement(1015392..1016525) [1134 bp, 377 aa]
           {ON} Anc_8.829 YMR272C
          Length = 377

 Score =  382 bits (981), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 198/388 (51%), Positives = 247/388 (63%), Gaps = 16/388 (4%)

Query: 14  VGTSSSPLTKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLA---DYPKGNSKIIDFA 70
           +  S+   T ELFS E  Q HNT+ DCWV  ++R IYDVS+++    D P  ++ ++  A
Sbjct: 1   MAESNPSKTLELFSSEKFQSHNTEDDCWVSVKDRLIYDVSKFVQENKDVPVEDA-VLKRA 59

Query: 71  GKDITSSFKNQERYNHDPETYDFMSHNDKYLVGYLANEEEAYKLLSNPSHKVEVKLTEQP 130
           GKDI+             ET  F   +DKYLVGYLAN  E  +LL+N  HKVEV L +  
Sbjct: 60  GKDISDLL----------ETKSFKFVDDKYLVGYLANSTEEARLLTNKDHKVEVNLKD-- 107

Query: 131 STYDSTTFVKELPSEDHFVIATDYKKDFNEHHFLDLEKPLIPQLWRAKFNRAFYIDQIHR 190
            TYDST FVKELPSE+HF I+TDYKKDF +HHFLDLEKPL+ Q+    F R FYIDQIHR
Sbjct: 108 GTYDSTVFVKELPSEEHFTISTDYKKDFVDHHFLDLEKPLLMQMLTGNFTREFYIDQIHR 167

Query: 191 PRHFGNKSAPLFGNFLEPLTKTAXXXXXXXXXXXXFYHLKVAFHNMNNIFATFLFCVGVF 250
           PRH+G  SA LFGN+LEP++ T              YH  V   +M+ + A F + +G+F
Sbjct: 168 PRHYGKGSAKLFGNWLEPISLTPWWLIPIIWGPVVVYHFYVGAQHMHPLSAVFFYFLGIF 227

Query: 251 VWTLIEYSLHRFLFHMDNRIPDHPMFYVLHFTIHGCHHYLPMDPYRLVMPPTLFLILCTP 310
           VWT IEY LHRFLFH+D+ +P H  FY +HF +HG HHYLPMD YRLV+PP LF++LCTP
Sbjct: 228 VWTFIEYCLHRFLFHLDDWVPQHNFFYTIHFLLHGVHHYLPMDQYRLVVPPALFVVLCTP 287

Query: 311 FYKLVFSVLPXXXXXXXXXXXXXXXVCYDEVHYWLHHSRVPKFMRXXXXXXXXXXXXNYQ 370
           FYK VF++LP               + YD  HY++HH ++P+  R            NYQ
Sbjct: 288 FYKAVFALLPLYVAYVGFAGGLTGYIIYDLTHYFIHHVKLPRVFRKIKKHHLEHHYKNYQ 347

Query: 371 LAFGVSNYFWDKVFGTYLYPDSPLSPMK 398
           L FGVSNYFWD VFGTYL PDSP S M+
Sbjct: 348 LGFGVSNYFWDLVFGTYLGPDSPASIMR 375

>KAFR0B03850 Chr2 complement(796399..797532) [1134 bp, 377 aa] {ON}
           Anc_8.829 YMR272C
          Length = 377

 Score =  376 bits (966), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 193/384 (50%), Positives = 248/384 (64%), Gaps = 9/384 (2%)

Query: 18  SSPLTKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSS 77
           ++  T ELFS + V  H  ++DCWV   +RKIYDV+++L +    +S ++D+AG DIT  
Sbjct: 2   TTAKTLELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDE 61

Query: 78  FKNQERYNHDPETYDFMSHNDKYLVGYLANEEEAYKLLSNPSHKVEVKLTEQPSTYDSTT 137
             N +      E Y  +  ND YLVGY+A  +E  KLL+N  HKVEV L +    +D  T
Sbjct: 62  LVNGKL----DEKYKALD-NDNYLVGYVATADEEQKLLTNKDHKVEVTLEQD---FDLAT 113

Query: 138 FVKELPSEDHFVIATDYKKDFNEHHFLDLEKPLIPQLWRAKFNRAFYIDQIHRPRHFGNK 197
            V ELP E+   IAT+Y +DF +H FLDL KPL+PQ+ + KF R FY+DQI+RPRH+G K
Sbjct: 114 LVVELPPEEKLTIATNYDRDFKKHKFLDLNKPLLPQILKGKFTREFYVDQINRPRHYGQK 173

Query: 198 SAPLFGN-FLEPLTKTAXXXXXXXXXXXXFYHLKVAFHNMNNIFATFLFCVGVFVWTLIE 256
           SAPLFGN FLEP +KTA            F+  +VA  NMNN  A FLFCVGVFVWTL+E
Sbjct: 174 SAPLFGNAFLEPFSKTAWWVVPTFWLPVVFHFFRVALKNMNNPLALFLFCVGVFVWTLLE 233

Query: 257 YSLHRFLFHMDNRIPDHPMFYVLHFTIHGCHHYLPMDPYRLVMPPTLFLILCTPFYKLVF 316
           Y LHRFLFH DN +P++ + + LHF +HG HHYLPMDPYRLV+PP LF+ILC P YK VF
Sbjct: 234 YCLHRFLFHFDNYLPENNIAFALHFLLHGFHHYLPMDPYRLVVPPALFIILCAPIYKTVF 293

Query: 317 SVLPXXXXXXXXXXXXXXXVCYDEVHYWLHHSRVPKFMRXXXXXXXXXXXXNYQLAFGVS 376
            +LP               V YD  HY LHHS++P FMR            NY+L +G++
Sbjct: 294 LLLPYYWACAGFAGGLFGYVYYDMCHYALHHSKLPPFMRRLKQYHLEHHYKNYELGYGIT 353

Query: 377 NYFWDKVFGTYLYPDSPLSPMKYE 400
           ++FWDKVFGTYL  D+P S MK++
Sbjct: 354 SWFWDKVFGTYLSKDAPASVMKFD 377

>Ecym_2712 Chr2 (1378070..1379215) [1146 bp, 381 aa] {ON} similar to
           Ashbya gossypii AAL183W
          Length = 381

 Score =  366 bits (940), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 187/384 (48%), Positives = 242/384 (63%), Gaps = 4/384 (1%)

Query: 17  SSSPLTKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITS 76
           SSS  T  L+S    +KH     CWV    RKIY+VS++L + P+G   ++D AG+D+T 
Sbjct: 2   SSSCKTLPLYSKSEFEKHVKPNQCWVSIDQRKIYNVSKFLDENPEGYQYVLDHAGQDVTQ 61

Query: 77  SFKNQERYNHDPETYDFMSHNDKYLVGYLANEEEAYKLLSNPSHKVEVKLTEQPSTYDST 136
             K+ +    +P        +D YL+GYLA  EE  KLL+N +H VEVK          +
Sbjct: 62  LLKDMQ--TDEPTDLAHQLLSDAYLIGYLATSEEERKLLTNANHVVEVKPANGNRV--DS 117

Query: 137 TFVKELPSEDHFVIATDYKKDFNEHHFLDLEKPLIPQLWRAKFNRAFYIDQIHRPRHFGN 196
            FVK+LP+E+   IATD+K D+ +HHFLDL+KPL  Q+    F + FYIDQ+HRPRH+G 
Sbjct: 118 GFVKKLPTEEKLAIATDFKTDYEKHHFLDLDKPLFMQVLFGNFTKEFYIDQVHRPRHYGK 177

Query: 197 KSAPLFGNFLEPLTKTAXXXXXXXXXXXXFYHLKVAFHNMNNIFATFLFCVGVFVWTLIE 256
           +SAPLFGNFLEPL+KT+             Y+++ A  N++   A FLF VGVFVWTLIE
Sbjct: 178 ESAPLFGNFLEPLSKTSWWVIPIVWYPCVIYYIRTALLNISTPLALFLFGVGVFVWTLIE 237

Query: 257 YSLHRFLFHMDNRIPDHPMFYVLHFTIHGCHHYLPMDPYRLVMPPTLFLILCTPFYKLVF 316
           Y LHRFLFH D+R+P+  + + LHF +HG HHYLPMD YRLVMPP LFL LC PFYKLVF
Sbjct: 238 YGLHRFLFHFDDRMPESNIVFTLHFLLHGIHHYLPMDKYRLVMPPALFLALCYPFYKLVF 297

Query: 317 SVLPXXXXXXXXXXXXXXXVCYDEVHYWLHHSRVPKFMRXXXXXXXXXXXXNYQLAFGVS 376
           S+LP               V YD  HY+LHH ++P FMR            NY+L FGV+
Sbjct: 298 SILPYYCACAGFAGGLFGYVGYDVTHYFLHHRKLPPFMRKLKKYHLEHHYKNYELGFGVT 357

Query: 377 NYFWDKVFGTYLYPDSPLSPMKYE 400
           +++WDKVF TYL P +PLS  KY+
Sbjct: 358 SWYWDKVFNTYLSPTAPLSRAKYD 381

>Kpol_1069.4 s1069 (6163..6996) [834 bp, 277 aa] {ON} (6163..6996)
           [834 nt, 278 aa]
          Length = 277

 Score =  262 bits (669), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 130/269 (48%), Positives = 168/269 (62%), Gaps = 2/269 (0%)

Query: 124 VKLTEQPSTYDSTTFVKELPSEDHFVIATDYKKDFNEHHFLDLEKPLIPQLWRAKFNRAF 183
           +K+ E   TY      K   +E+   + TDY KDFNE+ FL L++PL  QL  + F R F
Sbjct: 1   MKIEESIETYIHIR--KTTLTEEKLKVTTDYNKDFNENGFLKLDEPLFWQLLSSNFTRDF 58

Query: 184 YIDQIHRPRHFGNKSAPLFGNFLEPLTKTAXXXXXXXXXXXXFYHLKVAFHNMNNIFATF 243
           YIDQ+H+PRH+G +SAP+FGNFLEP TKT              Y+  V+   ++ I A  
Sbjct: 59  YIDQVHKPRHYGIESAPIFGNFLEPFTKTHWFMVPLIWGPVVLYNFIVSLREISIILAIT 118

Query: 244 LFCVGVFVWTLIEYSLHRFLFHMDNRIPDHPMFYVLHFTIHGCHHYLPMDPYRLVMPPTL 303
           LF +GVFVWTLIEY +HR+LFH+D+ +P+  +F+VLHF +HG HHYLPMD YRLVMPP L
Sbjct: 119 LFSIGVFVWTLIEYCMHRYLFHLDDSVPETRLFFVLHFLLHGIHHYLPMDKYRLVMPPAL 178

Query: 304 FLILCTPFYKLVFSVLPXXXXXXXXXXXXXXXVCYDEVHYWLHHSRVPKFMRXXXXXXXX 363
           F ILC PFY L F++ P               VCYD  HY+LHH ++P FMR        
Sbjct: 179 FSILCYPFYLLTFAIFPRYWAHAGFAGGLFGYVCYDVTHYFLHHKKMPSFMRKVKKYHLE 238

Query: 364 XXXXNYQLAFGVSNYFWDKVFGTYLYPDS 392
               N+QL FGV++ FWD+VFGTYL P +
Sbjct: 239 HHYKNFQLGFGVTSSFWDRVFGTYLDPKT 267

>Skud_14.221 Chr14 complement(407119..407481) [363 bp, 120 aa]
          {ON} YNL111C (REAL)
          Length = 120

 Score = 55.5 bits (132), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 38/55 (69%), Gaps = 1/55 (1%)

Query: 24 ELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSF 78
          +++S + V +HN  ++CW+I  + K+YDVSQ+  ++P G+  I+D  G+D T SF
Sbjct: 3  KVYSYQEVAEHNGPENCWIIIDD-KVYDVSQFKDEHPGGDEIIMDLGGQDATESF 56

>Suva_14.228 Chr14 complement(413753..414115) [363 bp, 120 aa]
          {ON} YNL111C (REAL)
          Length = 120

 Score = 55.1 bits (131), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 38/55 (69%), Gaps = 1/55 (1%)

Query: 24 ELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSF 78
          +++S + V +HN  ++CW+I  + K+YDVSQ+  ++P G+  I+D  G+D T SF
Sbjct: 3  KVYSYQEVAEHNGPENCWIIIDD-KVYDVSQFKDEHPGGDEIIMDLGGQDATDSF 56

>Kpol_505.14 s505 (37085..37456) [372 bp, 123 aa] {ON}
          (37085..37456) [372 nt, 124 aa]
          Length = 123

 Score = 55.1 bits (131), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 40/57 (70%), Gaps = 1/57 (1%)

Query: 24 ELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSFKN 80
          ++++ + + +HNT + CW++    K+YD +++L ++P G+  I+D AG+D T SF++
Sbjct: 3  KVYTYQEIAEHNTTESCWIVIDG-KVYDTTKFLDEHPGGDEIILDLAGQDATESFED 58

>ZYRO0B09812g Chr2 (765874..766425) [552 bp, 183 aa] {ON} similar to
           uniprot|P40312 Saccharomyces cerevisiae YNL111C CYB5
           Cytochrome b5 involved in the sterol and lipid
           biosynthesis pathways required for sterol C5-6 and fatty
           acid desaturation
          Length = 183

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 41/58 (70%), Gaps = 1/58 (1%)

Query: 23  KELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSFKN 80
            ++++ E V +HNT +D W+I  + K+YDV++++ D+P G+  I+D AG+D T +F +
Sbjct: 58  SKVYTFEQVAEHNTPEDAWLIV-DGKVYDVTKFVEDHPGGDEIILDLAGQDGTEAFND 114

>TBLA0B01310 Chr2 (276173..276544) [372 bp, 123 aa] {ON} Anc_2.166
           YNL111C
          Length = 123

 Score = 53.5 bits (127), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 27/80 (33%), Positives = 47/80 (58%), Gaps = 7/80 (8%)

Query: 24  ELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSFKNQER 83
           +L+S E +  HNT +  W+I ++ K+YDV+++L  +P G+  I++ AG+D T  F   E 
Sbjct: 3   KLYSYEEIAAHNTTESAWIIIKD-KVYDVTKFLDSHPGGDEIILELAGQDATQDF---ED 58

Query: 84  YNHDPETYDFMSHNDKYLVG 103
             H  +  +F+   D  L+G
Sbjct: 59  IGHSNDALEFL---DALLLG 75

>NDAI0F02730 Chr6 (669821..670186) [366 bp, 121 aa] {ON} Anc_2.166
          Length = 121

 Score = 53.5 bits (127), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 38/57 (66%), Gaps = 1/57 (1%)

Query: 24 ELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSFKN 80
          ++++ E + KHN+  D W++ +  K+YDVS++L ++P G   I + AG D T +F++
Sbjct: 3  QIYTYEEIAKHNSPDDTWIVIEG-KVYDVSKFLDEHPGGEEIIFELAGTDATENFED 58

>TDEL0F01210 Chr6 complement(216322..216702) [381 bp, 126 aa] {ON}
          Anc_2.166 YNL111C
          Length = 126

 Score = 51.6 bits (122), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 39/56 (69%), Gaps = 1/56 (1%)

Query: 25 LFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSFKN 80
          ++S + + +HN+ +D W++    K+YDV++++ ++P G+  I+D AG+D +  F++
Sbjct: 4  VYSYQQIAEHNSAEDIWIVVDG-KVYDVTKFMDEHPGGDEIILDLAGQDASEPFRD 58

>Kwal_26.8461 s26 (794482..794853) [372 bp, 123 aa] {ON} YNL111C
          (CYB5) - 1:1 [contig 61] FULL
          Length = 123

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 37/57 (64%), Gaps = 1/57 (1%)

Query: 24 ELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSFKN 80
          +L+S + + +HNT+KD W+I    K+YD ++++ ++P G   ++D  G+D T  F +
Sbjct: 3  KLYSYKEIAEHNTEKDLWMIIDG-KVYDCTKFMDEHPGGEEVLVDLGGQDATGPFAD 58

>KLLA0B14795g Chr2 (1299429..1301099) [1671 bp, 556 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 556

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 40/56 (71%), Gaps = 1/56 (1%)

Query: 23  KELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSF 78
           K+  S++ V+ HN   DCW++  N ++YD++++L+ +P G +++++FAG+D T  F
Sbjct: 78  KDGVSVKEVKMHNRIDDCWIVIDN-EVYDITKFLSQHPGGVARLMEFAGRDATERF 132

>NCAS0G02570 Chr7 complement(460218..460583) [366 bp, 121 aa] {ON}
          Anc_2.536 YMR073C
          Length = 121

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 20/55 (36%), Positives = 36/55 (65%), Gaps = 1/55 (1%)

Query: 24 ELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSF 78
          +++S + + +HN   D W+I +  K+YDVS++L ++P G+  I + AG+D T  F
Sbjct: 3  QVYSYQQIAEHNKPDDAWIIIEG-KVYDVSKFLDEHPGGDEIIFELAGQDATEHF 56

>YNL111C Chr14 complement(416940..417302) [363 bp, 120 aa] {ON}
          CYB5Cytochrome b5, involved in the sterol and lipid
          biosynthesis pathways; acts as an electron donor to
          support sterol C5-6 desaturation
          Length = 120

 Score = 50.8 bits (120), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 37/55 (67%), Gaps = 1/55 (1%)

Query: 24 ELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSF 78
          +++S + V +HN  ++ W+I  + K+YDVSQ+  ++P G+  I+D  G+D T SF
Sbjct: 3  KVYSYQEVAEHNGPENFWIIIDD-KVYDVSQFKDEHPGGDEIIMDLGGQDATESF 56

>KNAG0I02040 Chr9 (397527..397886) [360 bp, 119 aa] {ON} Anc_2.166
          YNL111C
          Length = 119

 Score = 50.8 bits (120), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 39/55 (70%), Gaps = 1/55 (1%)

Query: 24 ELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSF 78
          ++++ E V +H+T +D W++  NR +Y+V+++L ++P G   +++ AG D T++F
Sbjct: 3  KIYTYEDVAQHSTSEDAWIVIDNR-VYEVTKFLDEHPGGEEILLEMAGADATTNF 56

>SAKL0E10626g Chr5 (885272..885643) [372 bp, 123 aa] {ON} similar
          to uniprot|P40312 Saccharomyces cerevisiae YNL111C CYB5
          Cytochrome b5 involved in the sterol and lipid
          biosynthesis pathways required for sterol C5-6 and
          fatty acid desaturation
          Length = 123

 Score = 49.3 bits (116), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 36/57 (63%), Gaps = 1/57 (1%)

Query: 24 ELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSFKN 80
          +LF+ + + +HNT+ D W+I    K+YD ++++ ++P G   ++D  G+D T  F +
Sbjct: 3  KLFTYQEIAEHNTEGDLWMIIDG-KVYDCTKFIDEHPGGEEVLVDLGGQDATGPFAD 58

>Smik_14.216 Chr14 complement(396585..396947) [363 bp, 120 aa]
          {ON} YNL111C (REAL)
          Length = 120

 Score = 49.3 bits (116), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 20/55 (36%), Positives = 37/55 (67%), Gaps = 1/55 (1%)

Query: 24 ELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSF 78
          +++S + V +HN  ++ W+I  + K+YDVS++  ++P G+  I+D  G+D T SF
Sbjct: 3  KVYSYQEVAEHNGPENFWIIIDD-KVYDVSKFKDEHPGGDEIIMDLGGQDATESF 56

>AFL223W Chr6 (19601..20098) [498 bp, 165 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL111C (CYB5)
          Length = 165

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 38/57 (66%), Gaps = 1/57 (1%)

Query: 24 ELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSFKN 80
          +L++ + + +HN++ D W+I  N K+YD +++  ++P G+  +ID AG+D T  F +
Sbjct: 42 KLYTYQEIAEHNSENDLWLII-NGKVYDCTKFAEEHPGGDEVLIDLAGQDATEPFAD 97

>KLTH0D09284g Chr4 (770560..770931) [372 bp, 123 aa] {ON} similar
          to uniprot|P40312 Saccharomyces cerevisiae YNL111C CYB5
          Cytochrome b5 involved in the sterol and lipid
          biosynthesis pathways required for sterol C5-6 and
          fatty acid desaturation
          Length = 123

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 36/57 (63%), Gaps = 1/57 (1%)

Query: 24 ELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSFKN 80
          +L+S + + +HNT+ D W+I    K+YD ++++ ++P G   ++D  G+D T  F +
Sbjct: 3  KLYSYKEIAEHNTENDLWMIIDG-KVYDCTKFMDEHPGGEEVLLDLGGQDATGPFAD 58

>CAGL0L03828g Chr12 (442660..443025) [366 bp, 121 aa] {ON} similar
          to uniprot|P40312 Saccharomyces cerevisiae YNL111c CYB5
          Length = 121

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 34/55 (61%), Gaps = 1/55 (1%)

Query: 24 ELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSF 78
          ++++ + V +HN + DCW+I     +YDVS++L ++P G+  I +  G D T  F
Sbjct: 3  KVYTYKQVSEHNKEGDCWIIIDG-SVYDVSKFLDEHPGGDEIIFEHRGTDATGDF 56

>KLTH0A04026g Chr1 complement(337200..337901) [702 bp, 233 aa]
          {ON} weakly similar to uniprot|P40312 Saccharomyces
          cerevisiae YNL111C CYB5 Cytochrome b5, involved in the
          sterol and lipid biosynthesis pathways
          Length = 233

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 1/56 (1%)

Query: 25 LFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSFKN 80
          + S E +  H + +DCW+      +YDVS+YL  +P G   ++  AGKD T+ F +
Sbjct: 33 VISREELATHTSAEDCWLAIHG-AVYDVSRYLTQHPGGAQVMLKLAGKDATAQFDD 87

>KLLA0F27577g Chr6 (2556662..2557180) [519 bp, 172 aa] {ON} some
          similarities with uniprot|P40312 Saccharomyces
          cerevisiae YNL111C CYB5 Cytochrome b5
          Length = 172

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 35/56 (62%), Gaps = 1/56 (1%)

Query: 25 LFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSFKN 80
          L +++ V +H+++ DCW +    K+YD++ +L  +P G   ++ +AGKD T  F +
Sbjct: 5  LITMDEVARHSSRSDCWTVIHG-KVYDITSFLHKHPGGAQVLLKYAGKDSTLQFDD 59

>ZYRO0C18524g Chr3 (1450641..1452305) [1665 bp, 554 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 554

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 39/69 (56%), Gaps = 5/69 (7%)

Query: 28  LESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSFKNQERYNHD 87
           ++ V  HN   DCW++  N +IYDV+ ++  +P G +++++ AG+D T+ F       H 
Sbjct: 78  VKEVMLHNNVNDCWIVL-NGEIYDVTSFIGKHPGGAARLLEVAGRDATAKFLQV----HS 132

Query: 88  PETYDFMSH 96
            E  D M +
Sbjct: 133 QEVLDRMKN 141

>TPHA0F01790 Chr6 (412270..412818) [549 bp, 182 aa] {ON} Anc_2.166
           YNL111C
          Length = 182

 Score = 47.8 bits (112), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 39/57 (68%), Gaps = 1/57 (1%)

Query: 24  ELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSFKN 80
           ++++ E + +HNT +  W++ +  K+Y+V+++L ++P G+  I D AG D T +F++
Sbjct: 61  KIYTYEEIAEHNTTESSWIVIEG-KVYNVTKFLDEHPGGDEIIFDLAGTDATENFED 116

>Ecym_4346 Chr4 (739106..739735) [630 bp, 209 aa] {ON} similar to
          Ashbya gossypii ADL085C
          Length = 209

 Score = 48.1 bits (113), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 33/55 (60%), Gaps = 1/55 (1%)

Query: 26 FSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSFKN 80
           SL  V++H +  DCW I  N K+YD++  L+ +P G   ++ +AG+D T  F +
Sbjct: 6  ISLSEVRRHTSADDCWFIIHN-KVYDITNLLSTHPGGAKTLLKYAGRDATLPFDD 59

>ADL085C Chr4 complement(535293..536114) [822 bp, 273 aa] {ON}
           NOHBY406; No homolog in Saccharomyces cerevisiae
          Length = 273

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 44/91 (48%), Gaps = 14/91 (15%)

Query: 3   ASPSTATKTDTVGTSSSPLTK-------------ELFSLESVQKHNTKKDCWVIYQNRKI 49
           +S  T+ +TD +G  +  L                  S+E V +H ++ DCW I   R +
Sbjct: 57  SSGHTSKRTDAIGIVNGSLLNSKAGGYNRGMGLLRKISIEEVSQHTSRDDCWFIIHGR-V 115

Query: 50  YDVSQYLADYPKGNSKIIDFAGKDITSSFKN 80
           YD++  L ++P G   ++ +AG+D T  F +
Sbjct: 116 YDITGLLENHPGGTKILLKYAGRDATLPFDD 146

>NCAS0A02770 Chr1 (528814..530643) [1830 bp, 609 aa] {ON} 
          Length = 609

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 38/57 (66%), Gaps = 1/57 (1%)

Query: 22  TKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSF 78
           TK   S + V KHN++ DCW++  N ++YD++ +++ +P G+  I   AGKD+++ F
Sbjct: 91  TKSPISTDEVTKHNSENDCWIVI-NGQVYDLTSFMSIHPGGSDIIKLNAGKDVSAIF 146

>Ecym_5420 Chr5 (865505..865942) [438 bp, 145 aa] {ON} similar to
          Ashbya gossypii AFL223W
          Length = 145

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 34/53 (64%), Gaps = 1/53 (1%)

Query: 26 FSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSF 78
          F+ + +  HN+++D W+I  N K+YD S++  ++P G+  ++D  G+D T  F
Sbjct: 5  FTYQEIADHNSEQDLWLII-NGKVYDCSKFADEHPGGDEVLLDLGGQDATIPF 56

>TDEL0D00190 Chr4 (29971..31629) [1659 bp, 552 aa] {ON} 
          Length = 552

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 43/88 (48%), Gaps = 12/88 (13%)

Query: 2   PASPSTATKTDTVGTSSSPLTKEL-----------FSLESVQKHNTKKDCWVIYQNRKIY 50
           P S     K  +V T ++  T  L            S   ++KHNT  DCW+   N ++Y
Sbjct: 40  PKSRRYDIKKASVATGATAFTALLSYFLFDQSEGDISASELRKHNTVHDCWIAL-NGEVY 98

Query: 51  DVSQYLADYPKGNSKIIDFAGKDITSSF 78
           DV+ +L  +P G +++++ AG D T  F
Sbjct: 99  DVTAFLQMHPGGVARLMEVAGGDATEKF 126

>KLTH0C11858g Chr3 (979073..980740) [1668 bp, 555 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 555

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 26  FSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSF 78
             +  V +HN   DCW++  N ++YDV+ +L  +P G ++I++ AG D T  F
Sbjct: 76  IEVSEVMQHNKPDDCWIVL-NGEVYDVTSFLQMHPGGAARIMEVAGNDATRKF 127

>Kwal_47.18167 s47 complement(716570..717253) [684 bp, 227 aa] {ON}
           YNL111C (CYB5) - cytochrome b5 [contig 197] FULL
          Length = 227

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 47/112 (41%), Gaps = 7/112 (6%)

Query: 7   TATKTDTVGTSSSPLTKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKI 66
           T    D+   +SS L     S + V  H    DCW+     K+YDVS YL  +P G   +
Sbjct: 17  TPGPDDSTSQTSSQLP--FISSDEVATHTDADDCWISIHG-KVYDVSSYLPQHPGGAQVM 73

Query: 67  IDFAGKDITSSFKNQERYNHDPETYDFMSHNDKYLVGYLANEEEAYKLLSNP 118
           +  AGKD T  F   +   H  E+  +     +  VG L +   A  +   P
Sbjct: 74  LKLAGKDATVPF---DEVGHSIESLIY-GLGPRACVGILKSRPRAPPVKQQP 121

>KAFR0I00520 Chr9 complement(107239..108999) [1761 bp, 586 aa] {ON}
           Anc_4.304 YML054C
          Length = 586

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 35/62 (56%), Gaps = 1/62 (1%)

Query: 17  SSSPLTKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITS 76
           S+  +T  L   E V KH T  DCWV+  N  +YD++ ++  +P G   +   AGKD+T+
Sbjct: 74  SNEAITTRLILPEEVAKHKTPDDCWVVI-NGYVYDITSFIMSHPGGPDVLETNAGKDVTA 132

Query: 77  SF 78
            F
Sbjct: 133 IF 134

>KLLA0F23672g Chr6 (2212223..2212594) [372 bp, 123 aa] {ON}
          similar to uniprot|P40312 Saccharomyces cerevisiae
          YNL111C CYB5 Cytochrome b5 involved in the sterol and
          lipid biosynthesis pathways required for sterol C5-6
          and fatty acid desaturation
          Length = 123

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 35/57 (61%), Gaps = 1/57 (1%)

Query: 24 ELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSFKN 80
          +L + + V +H T  D W+I    K+YD ++++ ++P G+  ++D  G+D T  F++
Sbjct: 3  KLLTYKEVSEHKTVDDLWMIIDG-KVYDCTKFVDEHPGGDEILVDLGGQDATGPFED 58

>SAKL0F16610g Chr6 (1373674..1375368) [1695 bp, 564 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 564

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 35/53 (66%), Gaps = 1/53 (1%)

Query: 26  FSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSF 78
            +++ V+ HN   DCW++  N  +YD+++++  +P G +++++ AG+D T  F
Sbjct: 88  ITVDEVKLHNNIDDCWIVL-NGDVYDITEFIKIHPGGAARLMEVAGRDATEKF 139

>KLTH0D06930g Chr4 complement(604805..605419) [615 bp, 204 aa] {ON}
           weakly similar to uniprot|Q04772 Saccharomyces
           cerevisiae YMR073C Hypothetical ORF
          Length = 204

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 34/55 (61%), Gaps = 2/55 (3%)

Query: 31  VQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKII-DFAGKDITSSFKNQERY 84
           +QKHNT +DCW +  N+++Y VS YL  +P G   ++   AGKD T+ F    R+
Sbjct: 134 LQKHNTAEDCWCVL-NQRVYCVSSYLDFHPGGAEILLRTAAGKDATALFNKYHRW 187

>YML054C Chr13 complement(165533..167308) [1776 bp, 591 aa] {ON}
           CYB2Cytochrome b2 (L-lactate cytochrome-c
           oxidoreductase), component of the mitochondrial
           intermembrane space, required for lactate utilization;
           expression is repressed by glucose and anaerobic
           conditions
          Length = 591

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 36/59 (61%), Gaps = 1/59 (1%)

Query: 21  LTKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSFK 79
           + K+  S   V KHN   DCWV+  N  +YD++++L ++P G   I   AGKD+T+ F+
Sbjct: 86  MNKQKISPAEVAKHNKPDDCWVVI-NGYVYDLTRFLPNHPGGQDVIKFNAGKDVTAIFE 143

>Smik_13.92 Chr13 complement(163135..164910) [1776 bp, 591 aa] {ON}
           YML054C (REAL)
          Length = 591

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 36/59 (61%), Gaps = 1/59 (1%)

Query: 21  LTKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSFK 79
           + K+  S   V KHN   DCWV+  N  +YD++++L ++P G   I   AGKD+T+ F+
Sbjct: 86  MNKQKISPAEVAKHNKPDDCWVVI-NGYVYDLTRFLPNHPGGQDVIKFNAGKDVTAIFE 143

>Kpol_1014.5 s1014 complement(3107..4897) [1791 bp, 596 aa] {ON}
           complement(3107..4897) [1791 nt, 597 aa]
          Length = 596

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 36/55 (65%), Gaps = 1/55 (1%)

Query: 24  ELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSF 78
           ++ + + V KHN+K DCWV+  N  +YD++ ++  +P G   I+  AGKD+++ F
Sbjct: 89  KIITPQEVIKHNSKDDCWVVI-NDIVYDLTFFIKKHPGGQDVIVGNAGKDVSNIF 142

>Kwal_23.2823 s23 (29032..30714) [1683 bp, 560 aa] {ON} YML054C
           (CYB2) - Cytochrome b2 [L--lactate cytochrome-c
           oxidoreductase] [contig 246] FULL
          Length = 560

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 31/51 (60%), Gaps = 1/51 (1%)

Query: 28  LESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSF 78
           +  V  HN   DCW++  N ++YDV+ ++A +P G  +I++ AG D T  F
Sbjct: 83  VSEVMLHNKLNDCWIVL-NDEVYDVTSFIAAHPGGVQRILEVAGSDATEKF 132

>SAKL0F08316g Chr6 complement(634949..635485) [537 bp, 178 aa]
          {ON} some similarities with uniprot|P00175
          Saccharomyces cerevisiae YML054C CYB2 Cytochrome b2
          (L-lactate cytochrome-c oxidoreductase), component of
          the mitochondrial intermembrane space, required for
          lactate utilization; expression is repressed by glucose
          and anaerobic conditions
          Length = 178

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 25 LFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSF 78
          + S   V KHN   DCW+I    K+Y+++ +L+ +P G   I+ + G+D T  F
Sbjct: 3  VISPSEVVKHNRPDDCWMIIHG-KVYNLTSFLSQHPGGAHVILQYGGRDATKQF 55

>TPHA0B01820 Chr2 complement(406416..408146) [1731 bp, 576 aa] {ON}
           Anc_4.304 YML054C
          Length = 576

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 33/51 (64%), Gaps = 1/51 (1%)

Query: 29  ESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSFK 79
           E V +HN + DCWV+  N  +Y+++ ++  +P G + I+  +GKD+T  F+
Sbjct: 76  EEVARHNKRDDCWVVI-NDSVYNLTDFIDSHPGGKNVIVANSGKDVTKLFE 125

>NDAI0D04700 Chr4 (1103670..1105547) [1878 bp, 625 aa] {ON} 
          Length = 625

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 33/48 (68%), Gaps = 1/48 (2%)

Query: 31  VQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSF 78
           + KHNT +DCWV+  N+ +YD++ ++  +P G + I   AGKD+T+ F
Sbjct: 110 LMKHNTPEDCWVVINNQ-VYDLTTFIQVHPGGPNIIRSNAGKDVTAIF 156

>TDEL0H02180 Chr8 (369539..370150) [612 bp, 203 aa] {ON} 
          Length = 203

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 26 FSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSFKN 80
            L  V++HNT  DCW+    R +YDV+  L+ +P G   ++ +AG D T  F +
Sbjct: 25 IRLAEVREHNTAHDCWMAIHGR-VYDVTPILSKHPGGCQILLKYAGMDATFPFDD 78

>NDAI0D04710 Chr4 (1106280..1108130) [1851 bp, 616 aa] {ON}
           Anc_4.304
          Length = 616

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 35/56 (62%), Gaps = 1/56 (1%)

Query: 23  KELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSF 78
           K L S + V KH+T  DCWV+  + K+YD++ ++  +P G   I   AGKD+T+ F
Sbjct: 93  KPLISPDEVAKHHTPADCWVVIHD-KVYDLTSFIPIHPGGPDIIKSNAGKDVTNIF 147

>Suva_13.105 Chr13 complement(168279..170054) [1776 bp, 591 aa] {ON}
           YML054C (REAL)
          Length = 591

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 37/59 (62%), Gaps = 1/59 (1%)

Query: 21  LTKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSFK 79
           + K+  S   V KHN+  DCWV+  N  +YD+++++ ++P G   I   AG+D+T+ F+
Sbjct: 86  MNKQKISPAEVAKHNSADDCWVVI-NGYVYDLTRFVPNHPGGPDVIKYNAGRDVTAIFE 143

>KAFR0B04550 Chr2 (946561..946941) [381 bp, 126 aa] {ON} Anc_2.166
          YNL111C
          Length = 126

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 24 ELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSF 78
          ++++   V +H    DCW+     K+Y+VS++L ++P G+  I + AG D T  F
Sbjct: 3  QVYTYADVAEHVLPDDCWIAIDG-KVYNVSKFLDEHPGGDEIIYELAGSDATEYF 56

>SAKL0G16852g Chr7 (1452894..1454636) [1743 bp, 580 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 580

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 33/50 (66%), Gaps = 1/50 (2%)

Query: 29  ESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSF 78
           + V KHN  KDCWV+     +YD+++++  +P G + I + AGKD+T+ F
Sbjct: 84  QDVAKHNDPKDCWVVIDGY-VYDLTEFIHSHPGGPTIIENNAGKDVTAIF 132

>KNAG0E03860 Chr5 (763388..765202) [1815 bp, 604 aa] {ON} Anc_4.304
           YML054C
          Length = 604

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 33/54 (61%), Gaps = 1/54 (1%)

Query: 26  FSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSFK 79
            S   V KHNT  DCWV+ +   +Y++++++  +P G   I   AGKD+T+ FK
Sbjct: 92  ISPSEVAKHNTPDDCWVVIEGY-VYNLTEFIPTHPGGPMVIKSNAGKDVTAIFK 144

>TDEL0D01140 Chr4 complement(214858..216612) [1755 bp, 584 aa] {ON}
           Anc_4.304 YML054C
          Length = 584

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 22  TKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSF 78
           TK+    + V+KHN   DCWV+     +YD+S ++  +P G + I   AGKD+++ F
Sbjct: 74  TKKSIDPKEVEKHNAPDDCWVVIDGY-VYDLSDFIPSHPGGPAVIRANAGKDVSAIF 129

>Skud_13.92 Chr13 complement(163654..165429) [1776 bp, 591 aa] {ON}
           YML054C (REAL)
          Length = 591

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 36/59 (61%), Gaps = 1/59 (1%)

Query: 21  LTKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSFK 79
           + K+  S   V KHN   DCWV+  N  +YD+++++ ++P G   I   AG+D+T+ F+
Sbjct: 86  MNKQKISPAEVAKHNKADDCWVVI-NGYVYDLTRFMPNHPGGPDVIKFNAGRDVTAIFE 143

>Kwal_14.807 s14 complement(57218..58954) [1737 bp, 578 aa] {ON}
           YML054C (CYB2) - Cytochrome b2 [L--lactate cytochrome-c
           oxidoreductase] [contig 245] FULL
          Length = 578

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 22  TKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSF 78
            KE    + V KH+   DCWV+  N  +YD+S ++A +P G + I   AGKD+++ F
Sbjct: 75  AKESIRPQEVAKHSKPDDCWVVI-NGYVYDLSDFIAVHPGGPAIIKANAGKDVSAIF 130

>CAGL0K10736g Chr11 (1046127..1047908) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P00175 Saccharomyces cerevisiae
           YML054c CYB2 lactate dehydrogenase cytochrome b2
          Length = 593

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 22  TKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSF 78
           +K   S   V KHNT +DCWV+     +YD++ ++A +P G   I   AGKD+T+ F
Sbjct: 86  SKPKISPSEVIKHNTPEDCWVVIDGY-VYDLTNFIALHPGGPDIIKTNAGKDVTAIF 141

>KLLA0D02640g Chr4 complement(225482..227251) [1770 bp, 589 aa] {ON}
           similar to uniprot|P00175 Saccharomyces cerevisiae
           YML054C CYB2 Cytochrome b2 (L-lactate cytochrome-c
           oxidoreductase) component of the mitochondrial
           intermembrane space required for lactate utilization
           expression is repressed by glucose and anaerobic
           conditions
          Length = 589

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 37/58 (63%), Gaps = 1/58 (1%)

Query: 21  LTKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSF 78
           +TK   S   V KH++ KDCWV+ +   +Y+++ +++ +P G + I + AGKD+T  F
Sbjct: 85  MTKPKVSPTEVAKHSSPKDCWVVIEGY-VYNLTDFISAHPGGPAIIENNAGKDVTKIF 141

>NCAS0A02780 Chr1 (531072..532880) [1809 bp, 602 aa] {ON} Anc_4.304
          Length = 602

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 23  KELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSFK 79
           K +     V +HNT  DCW++  N  +YD++ ++  +P G   I   AGKD+T+ F+
Sbjct: 86  KRVIDPSEVARHNTPADCWIVI-NGVVYDLTSFIPVHPGGADIIKSNAGKDVTAIFE 141

>CAGL0K03069g Chr11 complement(285190..285774) [585 bp, 194 aa] {ON}
           weakly similar to uniprot|Q04772 Saccharomyces
           cerevisiae YMR073c
          Length = 194

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 33  KHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIID-FAGKDITSSFKNQERY 84
           +HNT +DCW +  N K+Y +S YL+ +P G   +ID  +G+D T  F    R+
Sbjct: 126 RHNTAEDCWTVI-NGKVYSISSYLSFHPGGAKILIDKSSGQDSTVLFNRYHRW 177

>KLTH0C11770g Chr3 (970979..972835) [1857 bp, 618 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 618

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 26  FSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSF 78
            S   V +HN + DCWV+     +YDV+ ++  +P G++ I   AGKD+++ F
Sbjct: 119 VSATEVIRHNKEDDCWVVIDG-YVYDVTAFIDQHPGGSAVIRGNAGKDVSALF 170

>ZYRO0B13728g Chr2 (1110636..1112432) [1797 bp, 598 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 598

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 35/58 (60%), Gaps = 1/58 (1%)

Query: 21  LTKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSF 78
           ++K   S + V KHN+  DCWV+     +YD++++   +P G + I   AGKD+++ F
Sbjct: 79  MSKPAISPDEVAKHNSPDDCWVVIDGY-VYDLTEFAPVHPGGPTVIKSNAGKDVSAIF 135

>ZYRO0D16654g Chr4 complement(1380316..1380888) [573 bp, 190 aa]
          {ON} conserved hypothetical protein
          Length = 190

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 33/55 (60%), Gaps = 1/55 (1%)

Query: 26 FSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSFKN 80
           S + ++KH T  DCW++   R +Y+V+  LA +P G+  ++ + G+D T  F +
Sbjct: 30 LSWDEIRKHMTPPDCWMVIHGR-VYNVAPVLASHPGGSQILLHYVGRDATYPFDD 83

>ZYRO0B02090g Chr2 complement(169589..170173) [585 bp, 194 aa] {ON}
           similar to gnl|GLV|KLLA0E18535g Kluyveromyces lactis
           KLLA0E18535g and weakly similar to YMR073C
           uniprot|Q04772 Saccharomyces cerevisiae YMR073C
           Hypothetical ORF
          Length = 194

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 33/57 (57%), Gaps = 2/57 (3%)

Query: 29  ESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDF-AGKDITSSFKNQERY 84
           E +++HNTK DCW + Q  K+Y ++ Y   +P G   ++ + AGKD T  F    R+
Sbjct: 122 ELLRRHNTKDDCWCVIQG-KVYCLTNYFDFHPGGVDILLRYCAGKDATKMFNEYHRW 177

>NCAS0F00870 Chr6 (177678..178247) [570 bp, 189 aa] {ON} Anc_2.536
           YMR073C
          Length = 189

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 30/49 (61%), Gaps = 2/49 (4%)

Query: 31  VQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKII-DFAGKDITSSF 78
           +Q+H ++ DCW IY+  K+Y VS YL  +P G   I  + AGKD T  F
Sbjct: 118 LQRHTSRTDCWTIYKG-KVYCVSDYLEYHPGGPDIIFQNCAGKDSTVLF 165

>Kwal_26.8046 s26 complement(621715..622311) [597 bp, 198 aa] {ON}
           YMR073C - Hypothetical ORF [contig 55] FULL
          Length = 198

 Score = 38.1 bits (87), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 31  VQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKII-DFAGKDITSSFKNQERY 84
           + +H   +DCW +  N+K+Y +S YL  +P G   ++   AGKD TS F    R+
Sbjct: 128 LAQHKAPEDCWCVI-NQKVYCISSYLDFHPGGVDILMKGAAGKDCTSMFNKYHRW 181

>Kpol_348.12 s348 complement(21978..22631) [654 bp, 217 aa] {ON}
           complement(21978..22631) [654 nt, 218 aa]
          Length = 217

 Score = 38.1 bits (87), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 33/61 (54%), Gaps = 2/61 (3%)

Query: 25  LFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIID-FAGKDITSSFKNQER 83
           + + + V KH    DCW I +  K+Y +S Y   +P G+  +I+  +G+D T +F    R
Sbjct: 142 MITKKMVAKHKDIDDCWCIIRG-KVYSISNYFKFHPGGDKILINQCSGRDCTKAFDQYHR 200

Query: 84  Y 84
           +
Sbjct: 201 W 201

>NDAI0H01370 Chr8 (336807..337481) [675 bp, 224 aa] {ON} Anc_2.536
          Length = 224

 Score = 36.2 bits (82), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 34/54 (62%), Gaps = 2/54 (3%)

Query: 26  FSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKII-DFAGKDITSSF 78
           F+ + +QKH ++ DCW ++ N K+Y ++ YL  +P G   ++ + AGKD T  F
Sbjct: 147 FNHKILQKHVSEDDCWTVH-NGKVYCMTYYLHFHPGGADILLEEAAGKDCTRLF 199

>KLLA0E18459g Chr5 (1641507..1641953) [447 bp, 148 aa] {ON} similar
           to uniprot|Q59TA9 Candida albicans CaO19 Potential
           heme/steroid binding protein and some similarites with
           YMR073C uniprot|Q04772 Saccharomyces cerevisiae YMR073C
           Hypothetical ORF
          Length = 148

 Score = 35.4 bits (80), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 27/49 (55%), Gaps = 1/49 (2%)

Query: 36  TKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSFKNQERY 84
            K + W +  NRK+Y +  YL+ +P G   +   AGKD+TS F    R+
Sbjct: 80  NKDNFWCVI-NRKVYCIKAYLSYHPGGEVILKQCAGKDVTSLFNKYHRW 127

>TPHA0G03550 Chr7 complement(755688..756344) [657 bp, 218 aa] {ON}
           Anc_2.536 YMR073C
          Length = 218

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 26  FSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDF-AGKDITSSF 78
            S + V +HNT  DCW I +  K+Y ++ Y   +P G+  + +F +G D T  F
Sbjct: 143 ISEKMVAEHNTVDDCWCIIKG-KVYCITNYFEYHPGGDKILKNFCSGVDATEQF 195

>TDEL0A03110 Chr1 complement(554890..555492) [603 bp, 200 aa] {ON}
           Anc_2.536 YMR073C
          Length = 200

 Score = 33.9 bits (76), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 29  ESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIID-FAGKDITSSFKNQERY 84
           E +QKH T  DCW + + R +Y ++ Y   +P G   +    AGKD T  F    R+
Sbjct: 128 ELLQKHKTLDDCWCVIKGR-VYCLTYYFDFHPGGVDILFKTCAGKDGTEMFNKYHRW 183

>TBLA0I01530 Chr9 (334102..334767) [666 bp, 221 aa] {ON} Anc_2.536
           YMR073C
          Length = 221

 Score = 33.9 bits (76), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 31  VQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFA-GKDITSSFKNQERY 84
           + +H    DCW + + R +Y +S+Y+  +P G   +I+   GKD+++ F    R+
Sbjct: 149 LSEHQEVDDCWCVIKGR-VYSISRYMDYHPGGKQILINTCLGKDVSNLFDKYHRW 202

>SAKL0A09570g Chr1 complement(838406..839041) [636 bp, 211 aa] {ON}
           similar to gnl|GLV|CAGL0K03069g Candida glabrata
           CAGL0K03069g and weakly similar to YMR073C
           uniprot|Q04772 Saccharomyces cerevisiae YMR073C
           Hypothetical ORF
          Length = 211

 Score = 33.1 bits (74), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 33  KHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIID-FAGKDITSSFKNQERY 84
           KH T  DCW + +  K+Y +S Y   +P G   +++  AG+D T  F    R+
Sbjct: 143 KHKTVDDCWCVLKG-KVYCLSAYFDFHPGGVEILLNKCAGRDATMMFNKYHRW 194

>AAL078W Chr1 (209600..211378) [1779 bp, 592 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGL055W
          Length = 592

 Score = 33.9 bits (76), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 38/75 (50%), Gaps = 2/75 (2%)

Query: 21  LTKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSFKN 80
           +T E F+  + + +  K+   V  +   I+DV+ ++ D+P G + ++   GKD T +F N
Sbjct: 469 ITPEQFATVARKDYEEKEKALVAIEG-IIHDVTPFMHDHPGGMALVVASVGKDATPAF-N 526

Query: 81  QERYNHDPETYDFMS 95
              Y H     + ++
Sbjct: 527 GAVYAHSTAARNLLA 541

>NCAS0D03250 Chr4 (608476..609969) [1494 bp, 497 aa] {ON} Anc_6.106
          Length = 497

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 3/67 (4%)

Query: 29  ESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSFKNQERYNHDP 88
           E V++    K+  VI  +  I+D+S Y+ ++P G S I    GKD T +F+    Y H  
Sbjct: 403 EFVEQAQLNKNLVVI--SGIIHDISNYIPEHPGGESLIKQALGKDATRAFQGGV-YRHST 459

Query: 89  ETYDFMS 95
              + +S
Sbjct: 460 AAQNVLS 466

>SAKL0A07326g Chr1 (648420..649862) [1443 bp, 480 aa] {ON}
           uniprot|Q9HFB2 Saccharomyces kluyveri Sk Delta 9- fatty
           acid desaturase
          Length = 480

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 27/47 (57%), Gaps = 1/47 (2%)

Query: 49  IYDVSQYLADYPKGNSKIIDFAGKDITSSFKNQERYNHDPETYDFMS 95
           ++DVS Y+ ++P G + I   AGKD T +F N   Y H    ++ ++
Sbjct: 404 VHDVSGYITEHPGGETLIQAAAGKDATKAF-NGGVYLHSNAAHNVLA 449

>KLTH0G09636g Chr7 complement(806164..810963) [4800 bp, 1599 aa] {ON}
            weakly similar to uniprot|P40477 Saccharomyces cerevisiae
            YIL115C NUP159 Subunit of the nuclear pore complex that
            is found exclusively on the cytoplasmic side forms a
            subcomplex with Nup82p and Nsp1p required for mRNA export
          Length = 1599

 Score = 32.7 bits (73), Expect = 1.9,   Method: Composition-based stats.
 Identities = 25/103 (24%), Positives = 45/103 (43%), Gaps = 4/103 (3%)

Query: 56   LADYPKGNSKIIDFAGKDITSSFKNQERYN----HDPETYDFMSHNDKYLVGYLANEEEA 111
            +A++ +  S    F  + + S+  N+E  N    H  E  D  S  +       ++ E +
Sbjct: 923  IAEHKQSQSPFSQFQNQPVPSATNNEESTNDDESHQAEDSDSNSDKETSTGDDASSTESS 982

Query: 112  YKLLSNPSHKVEVKLTEQPSTYDSTTFVKELPSEDHFVIATDY 154
                S P H  ++KLT++  + +S  F KE  S +     TD+
Sbjct: 983  EDAQSQPEHDEQLKLTKEGDSGNSDQFSKEQHSLEPGSNKTDF 1025

>Kpol_478.17 s478 (61375..62829) [1455 bp, 484 aa] {ON}
           (61375..62829) [1455 nt, 485 aa]
          Length = 484

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 1/61 (1%)

Query: 35  NTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSFKNQERYNHDPETYDFM 94
           N K D  ++  +  +++V  Y+ D+P G + I    GKD TS+F N   Y H     + +
Sbjct: 393 NLKSDPELVVISGVVHNVKNYINDHPGGKTLIKSALGKDATSAF-NGGVYRHSNAAQNVL 451

Query: 95  S 95
           +
Sbjct: 452 A 452

>ZYRO0C05016g Chr3 (394581..396032) [1452 bp, 483 aa] {ON} similar
           to uniprot|P21147 Saccharomyces cerevisiae YGL055W OLE1
           Fatty acid desaturase required for monounsaturated fatty
           acid synthesis and for normal distribution of
           mitochondria
          Length = 483

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query: 49  IYDVSQYLADYPKGNSKIIDFAGKDITSSFKNQERYNHDPETYDFMS 95
           ++DVS YL ++P G + +    GKD T +F N   Y H    ++ ++
Sbjct: 407 VHDVSGYLTEHPGGETLLKAALGKDATKAF-NGGVYRHSNAAHNVLA 452

>KLTH0H06798g Chr8 (596966..598432) [1467 bp, 488 aa] {ON}
           uniprot|P79047 Delta 9-fatty acid desaturase
          Length = 488

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 32/61 (52%), Gaps = 1/61 (1%)

Query: 35  NTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSFKNQERYNHDPETYDFM 94
           N K +  ++  +  ++DVS Y+ ++P G + I    GKD T +F N   Y H    ++ +
Sbjct: 398 NIKTNPGLVIISGIVHDVSNYITEHPGGETLIQAALGKDATKAF-NGGVYLHSNAAHNVL 456

Query: 95  S 95
           +
Sbjct: 457 A 457

>KNAG0C05780 Chr3 (1124591..1125133) [543 bp, 180 aa] {ON} Anc_2.536
           YMR073C
          Length = 180

 Score = 30.4 bits (67), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 4/60 (6%)

Query: 28  LESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGK---DITSSFKNQERY 84
           L++ Q + +K D W +Y+  K+Y +S YL  +P G   IID A +   DI  +F    R+
Sbjct: 104 LKNHQDYLSKHDFWAVYKG-KVYCLSYYLDFHPGGIEIIIDHATRDPPDIRGAFDRYHRW 162

>Suva_7.216 Chr7 (391750..393162) [1413 bp, 470 aa] {ON} YGL055W
           (REAL)
          Length = 470

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 26/45 (57%)

Query: 36  TKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITSSFKN 80
           TK +  ++  +  ++DVS Y++++P G + I    GKD T +F  
Sbjct: 417 TKDNKGLVIISGIVHDVSGYISEHPGGETLIKTALGKDATKAFSG 461

>TBLA0C06220 Chr3 (1507690..1509174) [1485 bp, 494 aa] {ON} 
          Length = 494

 Score = 30.8 bits (68), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 1/47 (2%)

Query: 49  IYDVSQYLADYPKGNSKIIDFAGKDITSSFKNQERYNHDPETYDFMS 95
           ++D++ Y+  +P G   I +  GKD TS F N   YNH     + ++
Sbjct: 415 VHDITNYIDRHPGGQKLIKEARGKDATSVF-NGGVYNHSNAANNVLA 460

>Suva_13.250 Chr13 complement(393510..394115) [606 bp, 201 aa] {ON}
           YMR073C (REAL)
          Length = 201

 Score = 30.0 bits (66), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 29  ESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKII 67
           E V+KH   +D +    N K+YD+S YL  +P G SKI+
Sbjct: 128 EIVKKHCKGEDEFWCVINGKVYDISGYLKFHP-GGSKIV 165

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.139    0.447 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,456,324
Number of extensions: 1984971
Number of successful extensions: 7213
Number of sequences better than 10.0: 110
Number of HSP's gapped: 7325
Number of HSP's successfully gapped: 110
Length of query: 400
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 288
Effective length of database: 40,638,807
Effective search space: 11703976416
Effective search space used: 11703976416
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 67 (30.4 bits)