Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0D029903.487ON31831816000.0
Suva_7.4153.487ON3133215272e-64
SAKL0F02882g3.487ON2983155156e-63
Skud_7.4383.487ON3133215132e-62
YGR127W3.487ON3123245114e-62
TPHA0D032603.487ON3143245002e-60
AFR305W3.487ON3093114983e-60
Smik_6.2233.487ON3133234967e-60
NCAS0E008403.487ON3363214979e-60
NDAI0G009703.487ON3323404742e-56
KNAG0B008403.487ON3133224705e-56
CAGL0I10582g3.487ON3193284707e-56
Kpol_1017.93.487ON3103154662e-55
Kwal_55.212173.487ON3033114591e-54
KLLA0E04687g3.487ON3063144522e-53
KLTH0F14718g3.487ON3003044494e-53
KAFR0C019303.487ON3133314435e-52
Ecym_12423.487ON3113124392e-51
TDEL0D055503.487ON3103154332e-50
ZYRO0D10098g3.487ON2762553701e-41
Suva_1.317.53ON28875950.002
Smik_1.317.53ON28975920.004
Skud_1.267.53ON28884910.006
YAL034W-A (MTW1)7.53ON28984840.044
Kpol_1065.117.53ON28762731.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0D02990
         (318 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0D02990 Chr4 complement(725170..726126) [957 bp, 318 aa] {ON...   620   0.0  
Suva_7.415 Chr7 (716851..717792) [942 bp, 313 aa] {ON} YGR127W (...   207   2e-64
SAKL0F02882g Chr6 complement(243632..244528) [897 bp, 298 aa] {O...   202   6e-63
Skud_7.438 Chr7 (726003..726944) [942 bp, 313 aa] {ON} YGR127W (...   202   2e-62
YGR127W Chr7 (746798..747736) [939 bp, 312 aa] {ON} Putative pro...   201   4e-62
TPHA0D03260 Chr4 (672002..672946) [945 bp, 314 aa] {ON} Anc_3.48...   197   2e-60
AFR305W Chr6 (995054..995983) [930 bp, 309 aa] {ON} Syntenic hom...   196   3e-60
Smik_6.223 Chr6 (364603..365544) [942 bp, 313 aa] {ON} YGR127W (...   195   7e-60
NCAS0E00840 Chr5 complement(154182..155192) [1011 bp, 336 aa] {O...   196   9e-60
NDAI0G00970 Chr7 complement(202186..203184) [999 bp, 332 aa] {ON...   187   2e-56
KNAG0B00840 Chr2 complement(153939..154880) [942 bp, 313 aa] {ON...   185   5e-56
CAGL0I10582g Chr9 complement(1046028..1046987) [960 bp, 319 aa] ...   185   7e-56
Kpol_1017.9 s1017 complement(28899..29831) [933 bp, 310 aa] {ON}...   184   2e-55
Kwal_55.21217 s55 (733995..734906) [912 bp, 303 aa] {ON} YGR127W...   181   1e-54
KLLA0E04687g Chr5 complement(416178..417098) [921 bp, 306 aa] {O...   178   2e-53
KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} simil...   177   4e-53
KAFR0C01930 Chr3 (386752..387693) [942 bp, 313 aa] {ON} Anc_3.48...   175   5e-52
Ecym_1242 Chr1 complement(495583..496518) [936 bp, 311 aa] {ON} ...   173   2e-51
TDEL0D05550 Chr4 (1003288..1004220) [933 bp, 310 aa] {ON} Anc_3....   171   2e-50
ZYRO0D10098g Chr4 complement(851071..851901) [831 bp, 276 aa] {O...   147   1e-41
Suva_1.31 Chr1 (56284..57150) [867 bp, 288 aa] {ON} YAL034W-A (R...    41   0.002
Smik_1.31 Chr1 (62639..63508) [870 bp, 289 aa] {ON} YAL034W-A (R...    40   0.004
Skud_1.26 Chr1 (55314..56180) [867 bp, 288 aa] {ON} YAL034W-A (R...    40   0.006
YAL034W-A Chr1 (79718..80587) [870 bp, 289 aa] {ON}  MTW1Essenti...    37   0.044
Kpol_1065.11 s1065 (24654..25517) [864 bp, 287 aa] {ON} (24654.....    33   1.0  

>TBLA0D02990 Chr4 complement(725170..726126) [957 bp, 318 aa] {ON}
           Anc_3.487 YGR127W
          Length = 318

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/318 (95%), Positives = 305/318 (95%)

Query: 1   MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHNSTILYPYDMSKDICHDGGGDERF 60
           MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHNSTILYPYDMSKDICHDGGGDERF
Sbjct: 1   MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHNSTILYPYDMSKDICHDGGGDERF 60

Query: 61  KSEHGTWCGLNKDGKICTVLNLLKEEEARRDGDCNNSLQSRGLIPIKYLCDFDHGFQDWN 120
           KSEHGTWCGLNKDGKICTVLNLLKEEEARRDGDCNNSLQSRGLIPIKYLCDFDHGFQDWN
Sbjct: 61  KSEHGTWCGLNKDGKICTVLNLLKEEEARRDGDCNNSLQSRGLIPIKYLCDFDHGFQDWN 120

Query: 121 TYDKFIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMGQSQRVLDEENPYMVVSNINWGD 180
           TYDKFIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMGQSQRVLDEENPYMVVSNINWGD
Sbjct: 121 TYDKFIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMGQSQRVLDEENPYMVVSNINWGD 180

Query: 181 PKKMGEWSKIKNGIKLLETLINDKLDNSNKDELEILEDCFQISSTINLSGKKIDGNIERL 240
           PKKMGEWSKIKNGIKLLETLINDKLDNSNKDELEILEDCFQISSTINLSGKKIDGNIERL
Sbjct: 181 PKKMGEWSKIKNGIKLLETLINDKLDNSNKDELEILEDCFQISSTINLSGKKIDGNIERL 240

Query: 241 EQTKDLIFVPPLKRSEGEVRXXXXXXXXXXXXXESVKYYGTRSQIVVLCERKSNKVTFVE 300
           EQTKDLIFVPPLKRSEGEVR             ESVKYYGTRSQIVVLCERKSNKVTFVE
Sbjct: 241 EQTKDLIFVPPLKRSEGEVRGDAGGDAGGDAGGESVKYYGTRSQIVVLCERKSNKVTFVE 300

Query: 301 RILHCKNEDAKDNTKKIQ 318
           RILHCKNEDAKDNTKKIQ
Sbjct: 301 RILHCKNEDAKDNTKKIQ 318

>Suva_7.415 Chr7 (716851..717792) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  207 bits (527), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 124/321 (38%), Positives = 181/321 (56%), Gaps = 37/321 (11%)

Query: 1   MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHNSTILYPYDMSKDICHDGGGDERF 60
           MCIL+ T AHP Y+LILISNRDE  ER+TH+TCW+++  IL PYD++K            
Sbjct: 1   MCILMATRAHPAYELILISNRDEFLERKTHATCWHNDDFILSPYDVAKTSME-------- 52

Query: 61  KSEHGTWCGLNKDGKICTVLNLLKEEEARRDGDCNNSLQSRGLIPIKYLCDFDHGFQDWN 120
           K   GTW G+NK+GK+ T+LN LK ++ R    C  S +SRG++P  +L      FQDW+
Sbjct: 53  KQIFGTWSGINKEGKLATILN-LKMDDQR---SCTKS-KSRGMLPFTFLTSHKARFQDWD 107

Query: 121 TYDKFIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMGQSQRVLD-----EENPYMVVSN 175
            Y+KF +    +    G FN F GD+    Y +I+S+G +  VL      + + YMV+SN
Sbjct: 108 DYNKFEKHYDGL-RTTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISN 166

Query: 176 INWGDPKKMGE--WSKIKNGIKLLETLINDKLDNSNKDELEILEDCFQISSTINLSGKKI 233
             + +   + E  W K+K     LETLI   LDN   DE  ++ +CFQ++S  +L    +
Sbjct: 167 GKYHNSSSISEQAWEKVKIARDSLETLI---LDNIESDEETLISNCFQLASKSSLPDTGL 223

Query: 234 DGNIERL----EQTKDLIFVPPLKRSEGEVRXXXXXXXXXXXXXESVKYYGTRSQIVVLC 289
             ++ ++      T + I+VPPL+R  G+                   YYGTRSQIV+L 
Sbjct: 224 KPDLLQMLVDPNVTMNTIYVPPLRRPPGD---------DLGASIPDGDYYGTRSQIVLLV 274

Query: 290 ERKSNKVTFVERILHCKNEDA 310
            + S+KVTF+ER+L+  +ED 
Sbjct: 275 SKDSSKVTFIERVLYSSDEDV 295

>SAKL0F02882g Chr6 complement(243632..244528) [897 bp, 298 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 298

 Score =  202 bits (515), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 130/315 (41%), Positives = 174/315 (55%), Gaps = 40/315 (12%)

Query: 1   MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHNSTILYPYDMSKDICHDGGGDERF 60
           MCILLGTTAHP Y LILISNRDE FERETH TC + +  I+ P+DMS  I   G      
Sbjct: 1   MCILLGTTAHPRYSLILISNRDEFFERETHPTCVHSDDFIVSPFDMS--ITTKG------ 52

Query: 61  KSEHGTWCGLNKDGKICTVLNLLKEEEARRDGDCNNS-----LQSRGLIPIKYLCDFDHG 115
               GTWCG+NKDGK+  +LNL       R   C N       QSRG++P+K+L   D  
Sbjct: 53  -RNFGTWCGVNKDGKVAVILNL-------RIASCGNPKNVECPQSRGIVPMKFLAGKDVD 104

Query: 116 FQDWNTYDKFIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMGQSQRVLDEENPYMVVSN 175
           F +W++Y+KF      I+ K G FNLF GD    EY +I+S+ ++      ++ YMVVSN
Sbjct: 105 FNNWDSYEKFSHHYPGIE-KTGNFNLFYGDCSKGEYKLISSLSETTDGFQNDDGYMVVSN 163

Query: 176 INWGDPKKMGEWSKIKNGIKLLETLINDKLDNSNKDELEILEDCFQISSTINLSGKKIDG 235
                 KK G+ S  KN   LL  L+   +D++ KD   IL+ CF+++S    S K +  
Sbjct: 164 DLISSKKKWGKISLAKN---LLRNLVESSVDDT-KD--SILDKCFKLASHSTCSEKIV-- 215

Query: 236 NIERLEQTKDLIFVPPLKRSEGEVRXXXXXXXXXXXXXESVKYYGTRSQIVVLCERKSNK 295
            ++    T + I+VPPL    G+                  KYYGTRSQIV+L  +   K
Sbjct: 216 -VKHESVTNETIYVPPLLVENGQ---------DLDVSMPCGKYYGTRSQIVILVSKDQKK 265

Query: 296 VTFVERILHCKNEDA 310
           +TFVER+L+  +ED 
Sbjct: 266 MTFVERVLYTCDEDV 280

>Skud_7.438 Chr7 (726003..726944) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  202 bits (513), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 123/321 (38%), Positives = 179/321 (55%), Gaps = 37/321 (11%)

Query: 1   MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHNSTILYPYDMSKDICHDGGGDERF 60
           MCIL+ T AHP Y+LILISNRDE   R+TH+TCW+++  IL PYD++K          + 
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLAK--------TSKE 52

Query: 61  KSEHGTWCGLNKDGKICTVLNLLKEEEARRDGDCNNSLQSRGLIPIKYLCDFDHGFQDWN 120
           K   GTW G+N++GK+ T+LNL  + + +RD   +   +SRGL+P  +L      FQ+W+
Sbjct: 53  KQIFGTWSGINREGKLATILNL--KLDGQRDTIKS---KSRGLLPFTFLSTHKADFQNWD 107

Query: 121 TYDKFIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMGQSQRVLDEE-----NPYMVVSN 175
            YDKF E N       G FN F GD+   +Y +I+S+G++  VLD       N YM VSN
Sbjct: 108 NYDKF-EMNYDGLNTTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCKSNLNSYMAVSN 166

Query: 176 INWGDPKKMGE--WSKIKNGIKLLETLINDKLDNSNKDELEILEDCFQISSTINLSGKKI 233
             + +   + E  W K+K     LE L+   L N + DE  I+ +CFQ++S  ++ G   
Sbjct: 167 GEFYNSPSISEQAWKKVKVARDGLEKLV---LGNIDSDEETIISNCFQLASKSSVPGTAS 223

Query: 234 DGNIERLEQTKDL----IFVPPLKRSEGEVRXXXXXXXXXXXXXESVKYYGTRSQIVVLC 289
             N  ++    ++    I+VPPL+R   +                   YYGTRSQIV+L 
Sbjct: 224 KPNALQMLADPNVIMNTIYVPPLRRPPDD---------DLGASIPDGDYYGTRSQIVLLV 274

Query: 290 ERKSNKVTFVERILHCKNEDA 310
            + S+KVTF+ERIL+  +ED 
Sbjct: 275 SKNSSKVTFIERILYSSDEDV 295

>YGR127W Chr7 (746798..747736) [939 bp, 312 aa] {ON} Putative
           protein of unknown function; expression is regulated by
           Msn2p/Msn4p, indicating a possible role in stress
           response
          Length = 312

 Score =  201 bits (511), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 123/324 (37%), Positives = 178/324 (54%), Gaps = 42/324 (12%)

Query: 1   MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHNSTILYPYDMSKDICHDGGGDERF 60
           MCIL+ T AHP Y+LILISNRDE   R+TH+TCW++N  IL PYD++K            
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNNDFILSPYDLAKTSAE-------- 52

Query: 61  KSEHGTWCGLNKDGKICTVLNLLKEEEARRDGDCNNS-LQSRGLIPIKYLCDFDHGFQDW 119
           K   GTW G+NK+GK+ T+LNL      + D + NN+  +SRGL+P  +L      F+DW
Sbjct: 53  KQIFGTWSGINKEGKLATILNL------KLDNEQNNTKSRSRGLLPFIFLSIHKADFEDW 106

Query: 120 NTYDKFIEQNGSIDG--KVGLFNLFLGDLKSNEYSIINSMGQSQRVLDEE-----NPYMV 172
           + Y KF    G  DG    G FN F GD+   +Y +I+S+G++  VL        + YMV
Sbjct: 107 DNYKKF---EGHYDGLKSTGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMV 163

Query: 173 VSNINWGDPKKMG--EWSKIKNGIKLLETLINDKLDNSNKDELEILEDCFQISSTINLSG 230
           VSN  + D   +    W K+K     LE L+   L+N   DE +I+  CFQ++S  +L  
Sbjct: 164 VSNGKFYDSSSIPGQAWEKVKVARDSLENLV---LENIESDEEKIISSCFQLASKSSLPS 220

Query: 231 KKIDGNIERL---EQTKDLIFVPPLKRSEGEVRXXXXXXXXXXXXXESVKYYGTRSQIVV 287
              + ++ ++     T + I+VPPL+R   +                   YYGTRSQIV+
Sbjct: 221 TISNPDVLQMVDPNVTMNTIYVPPLRRPPRD---------DLGASIPDGDYYGTRSQIVL 271

Query: 288 LCERKSNKVTFVERILHCKNEDAK 311
           L  + S +VTF+ER+L+  +ED +
Sbjct: 272 LVSKDSTRVTFIERVLYSSDEDVR 295

>TPHA0D03260 Chr4 (672002..672946) [945 bp, 314 aa] {ON} Anc_3.487
           YGR127W
          Length = 314

 Score =  197 bits (500), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 122/324 (37%), Positives = 194/324 (59%), Gaps = 30/324 (9%)

Query: 1   MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHNST--ILYPYDMSKDICHDGGGDE 58
           MCIL  T +HP Y+LILISNRDE  +R+T  +CWN  S   +L PYD+S+        +E
Sbjct: 1   MCILFLTRSHPDYELILISNRDEFLQRKTAFSCWNERSNCEVLCPYDLSR--------NE 52

Query: 59  RFKSEHGTWCGLNKDGKICTVLNLLKEEEARRDGDCNNSLQSRGLIPIKYLCDF-DHGFQ 117
              S+ GTWCG+N+ G++ +VLNL  +E    D +     +SRG +P+K+L +  ++ F 
Sbjct: 53  TDPSKFGTWCGINEFGRVSSVLNLKMDENKVEDKNVRK--KSRGYLPVKFLDNRKENSFN 110

Query: 118 DWNTYDKFIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMGQSQRVLD--EEN--PYMVV 173
           DWN+Y KF++Q   ++ K G FNLF+GD+K  EY++I+S GQ++R+LD  +EN    +V+
Sbjct: 111 DWNSYSKFLKQYPDLE-KTGSFNLFIGDVKKQEYALIDSFGQTKRILDGKDENGKSSVVI 169

Query: 174 SNINWGDPKKMGEWSKIKNGIKLLETLINDKLDNSNKDELEILEDCFQISSTINLSGKKI 233
           SN  +    K   W KI NG KL++  ++  +    +DE  ++E CF+I+ST  L+ + +
Sbjct: 170 SNSEFISNDK-ERWHKISNGEKLMDEFLSKDI----RDENSVIESCFKIASTSELTNEYL 224

Query: 234 DGNIERLEQTKDLIFVPPLKRSEGEVRXXXXXXXXXXXXXESVKYYGTRSQIVVLCERKS 293
             + + L+   + +FVPP+K  E  V                 K+YGTRSQIV+L  ++ 
Sbjct: 225 HSHDDILDLMTETVFVPPIKL-ENPVEKDNIGASLPVG-----KFYGTRSQIVILVNKER 278

Query: 294 NKVTFVERILH-CKNEDAKDNTKK 316
             V ++ER+L+ C ++ +K   +K
Sbjct: 279 TTVRYMERVLYECDDDVSKAGIEK 302

>AFR305W Chr6 (995054..995983) [930 bp, 309 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR127W
          Length = 309

 Score =  196 bits (498), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 122/311 (39%), Positives = 172/311 (55%), Gaps = 26/311 (8%)

Query: 1   MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHNSTILYPYDMSKDICHDGGGDERF 60
           MCIL  TTAHP YKL+LISNRDE F R+TH+TCW+HN +IL PYDM+     D  G +  
Sbjct: 1   MCILFATTAHPKYKLVLISNRDEYFARKTHTTCWSHNDSILAPYDMA---LQDADGLDH- 56

Query: 61  KSEHGTWCGLNKDGKICTVLNLLKEEEARRDGDCNNS-LQSRGLIPIKYLCDFDH-GFQD 118
            S  GTW G+N+ G +  +LNL  ++    DGD   S   SRG + ++YL DFDH  +  
Sbjct: 57  GSPCGTWIGINRAGHVSVLLNLAPKDA---DGDHGYSHRHSRGAVTMEYLKDFDHNNWDS 113

Query: 119 WNTYDKFIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMGQSQRVLDEENPYMVVSNINW 178
           WNTY+KF     ++  K  LF  F GD+ ++++S+INS+GQ+      ++PY VVSN   
Sbjct: 114 WNTYEKFGAHFPTL-YKTKLFTHFYGDVVNSQFSVINSLGQTLDPF-SQSPYYVVSNGPS 171

Query: 179 GDPKKMGEWSKIKNGIKLLETLINDKLDNSNKDELEILEDCFQISSTINLSGKKIDGNIE 238
              K +G+W K+  G +L + +I + LD S   E E+L+ CF ++S       +  G + 
Sbjct: 172 DGAKALGQWPKVVEGNQLFKKMIQESLDVS---EEELLQRCFNLASYSQYVSNQPIG-VH 227

Query: 239 RLEQTKDLIFVPPLKRSEGEVRXXXXXXXXXXXXXESVKYYGTRSQIVVLCERKSNKVTF 298
                K  IFVP L    G+                +  YYGTRS IV+L     N VT 
Sbjct: 228 DDSIPKRTIFVPALYNLSGQAN----------LSFAAGMYYGTRSTIVMLVSEDGNVVT- 276

Query: 299 VERILHCKNED 309
            E ++H  ++D
Sbjct: 277 REHVIHDSDQD 287

>Smik_6.223 Chr6 (364603..365544) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  195 bits (496), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 118/323 (36%), Positives = 177/323 (54%), Gaps = 39/323 (12%)

Query: 1   MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHNSTILYPYDMSKDICHDGGGDERF 60
           MCIL+ T AHP Y+LILISNRDE   R+TH+TCW+++  IL PYD+++    +G      
Sbjct: 1   MCILMATRAHPDYELILISNRDEFLARKTHATCWHNDDFILSPYDLAR-TSKEG------ 53

Query: 61  KSEHGTWCGLNKDGKICTVLNL-LKEEEARRDGDCNNSLQSRGLIPIKYLCDFDHGFQDW 119
             E GTW G+NK+GK+ T+LNL L  E +          +SRGL+P  +L + +  F+DW
Sbjct: 54  -QEFGTWSGINKEGKLATILNLKLGSERSTIKS------KSRGLLPYIFLSNHEANFKDW 106

Query: 120 NTYDKFIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMGQSQRVLDEE-----NPYMVVS 174
           ++Y KF      +    G FN F GD+   +Y +I+S+G++  VL        + YMV+S
Sbjct: 107 DSYSKFGNHYDGLKA-TGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVIS 165

Query: 175 NINWGDPKKMGE--WSKIKNGIKLLETLINDKLDNSNKDELEILEDCFQISSTINLSGKK 232
           N  + +   + E  W K+K     LE L++   DN   DE  I+  CFQ++S  +L G  
Sbjct: 166 NGRFYNTSSIPEKAWEKVKLARDSLEDLVS---DNIGLDEETIISSCFQLASKSSLPGTV 222

Query: 233 IDGNIERL----EQTKDLIFVPPLKRSEGEVRXXXXXXXXXXXXXESVKYYGTRSQIVVL 288
              ++ ++      T   I+VPPL+R  G+                   +YGTRSQIV+L
Sbjct: 223 SKPDVLQMLVDPNVTMSTIYVPPLRRPPGD---------DLGASIPDGDFYGTRSQIVLL 273

Query: 289 CERKSNKVTFVERILHCKNEDAK 311
             + S K TF+ERI++  +ED +
Sbjct: 274 ISKDSTKATFIERIIYSSDEDVR 296

>NCAS0E00840 Chr5 complement(154182..155192) [1011 bp, 336 aa] {ON}
           Anc_3.487 YGR127W
          Length = 336

 Score =  196 bits (497), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 126/321 (39%), Positives = 179/321 (55%), Gaps = 33/321 (10%)

Query: 1   MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHNSTILYPYDMSKDI-CHDGGGDER 59
           MCILL TTAHP Y+LILISNRDE FER+TH +CW+++  IL P+DM+K    H+      
Sbjct: 17  MCILLATTAHPQYELILISNRDEFFERKTHVSCWHNDDFILSPFDMAKSCELHE------ 70

Query: 60  FKSEHGTWCGLNKDGKICTVLNLLKEEEARRDGDCNNSLQSRGLIPIKYLCDFDHGFQDW 119
            K   GTW G+N+D KI T+LNL  + E++ D       QSRG+IP  +L + D  F  W
Sbjct: 71  -KKIFGTWIGINRDAKIATILNL--KLESQLDLKQLVKPQSRGMIPFVFLSEHDSDFNKW 127

Query: 120 NTYDKFIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMGQSQRVLDEENPYMVVSN---- 175
           +TY+KF  +   +  K G FN F GD  ++EY II+S G + +VL  + PY+ VSN    
Sbjct: 128 DTYEKFDGKYNYL-RKTGDFNFFYGDPLNDEYRIIDSKGNTFKVLSGD-PYLTVSNDMFA 185

Query: 176 -----INWGDPKKMGEWSKIKNGIKLLETLINDKLDNSNKDELEILEDCFQISSTINLSG 230
                +      ++ EW KIK G  LL+ L+    ++ + DE  ++E CF+++ST ++  
Sbjct: 186 TGGITVERASNNRIAEWRKIKFGKILLQDLVE---ESKSLDEDMLIEKCFKLASTCSVQP 242

Query: 231 KKIDGNIERLEQTKDLIFVPPLKRSEGEVRXXXXXXXXXXXXXESVKYYGTRSQIVVLCE 290
           K+     +      + IFVPPL   E EV                 KYYGTRSQIV+L  
Sbjct: 243 KENTKFNQNSTLPMETIFVPPL---ECEVNDDIGTSLSVG------KYYGTRSQIVILIS 293

Query: 291 RKSNKVTFVERILHCKNEDAK 311
           +   +V  VE IL+  + D +
Sbjct: 294 KNHERVKLVEHILYTSDNDIQ 314

>NDAI0G00970 Chr7 complement(202186..203184) [999 bp, 332 aa] {ON}
           Anc_3.487 YGR127W
          Length = 332

 Score =  187 bits (474), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 121/340 (35%), Positives = 183/340 (53%), Gaps = 56/340 (16%)

Query: 1   MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHNSTILYPYDMSKDICHDGGGDERF 60
           MCILL TTAHP Y+LILISNRDE  +R+TH++CW+++  IL PYDM+K+  ++       
Sbjct: 1   MCILLATTAHPDYELILISNRDEFLQRKTHTSCWHNDDFILSPYDMAKECKYND------ 54

Query: 61  KSEHGTWCGLNKDGKICTVLNL-------LKEEEARRDGDCNNSLQSRGLIPIKYLCDF- 112
           K   GTW G+NKDGKI TVLNL       LK+  A +         SRG++P  YL D  
Sbjct: 55  KKVFGTWLGINKDGKIATVLNLKLNKSLSLKQLVAPK---------SRGMLPFVYLSDMT 105

Query: 113 DHGFQDWNTYDKFIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMGQSQRVLDEENPYMV 172
           +  F +W+ YD F ++   +    G FNLF GD+K  +Y I++S+G +   L+    Y+V
Sbjct: 106 EDSFAEWDGYDNFTKKYPGLQS-TGDFNLFYGDVKRKQYRIMDSIGNTVSTLNSNCQYLV 164

Query: 173 VSNINWGDPKKMGE--------------------WSKIKNGIKLLETLINDKLDNSNKDE 212
           VSN  +    ++GE                    W K+K G  LL++L+N  +    +DE
Sbjct: 165 VSNDVFTCNGQLGELQSNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSI-VEKQDE 223

Query: 213 LEILEDCFQISSTINLSGKKIDGNIERLEQTKDLIFVPPLK-RSEGEVRXXXXXXXXXXX 271
             I+ +CF++SST +++ +      +      + I VPPL+ +   +V            
Sbjct: 224 DTIISECFKLSSTCSVTVEDHCKFHQNSTLPNETILVPPLRCKITDDVGTSLPIG----- 278

Query: 272 XXESVKYYGTRSQIVVLCERKSNKVTFVERILHCKNEDAK 311
                +YYGTRSQIV+L +R + +V F E +++  + D K
Sbjct: 279 -----EYYGTRSQIVILIKRGTYEVKFAEHVIYTSDSDIK 313

>KNAG0B00840 Chr2 complement(153939..154880) [942 bp, 313 aa] {ON}
           Anc_3.487 YGR127W
          Length = 313

 Score =  185 bits (470), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 127/322 (39%), Positives = 177/322 (54%), Gaps = 33/322 (10%)

Query: 1   MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHNSTILYPYDMSKDICHDGGGDERF 60
           MCILLGT  HP Y L+LISNRDE FER+TH T W+    IL PYDM+K +   G      
Sbjct: 1   MCILLGTREHPDYDLVLISNRDEFFERDTHITEWHSGDYILSPYDMTKGLYDPG------ 54

Query: 61  KSEHGTWCGLNKDGKICTVLNLLKEEEARRDGDCNN-SLQSRGLIPIKYLCDFDHGFQD- 118
           K   GTW GLN+ G++ TVLNL  E EA R    N    +SRGLIP  +L   D GF D 
Sbjct: 55  KCVRGTWMGLNRAGRVSTVLNLKLEGEALRKHSKNPVKRRSRGLIPFMFLS--DRGFIDQ 112

Query: 119 WNTYDKFIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMGQSQRVLDEENPY-MVVSNIN 177
           W++++KF ++   ++ K G FNLF+GD++  +Y +++S G +  VL+E     MVVSN  
Sbjct: 113 WDSFEKFRDRYPDLE-KSGDFNLFIGDIRQQDYKVLDSSGNTFSVLNETTGMNMVVSNDT 171

Query: 178 WGD--PKKMGEWSKIKNGIKLLETLINDKLDNSNKDELEILEDCFQISS--TINLSGKKI 233
           + +     + EW+K+K G   L  L+N  +   N D+   ++ CF  +S  +I  S + I
Sbjct: 172 YKEFNENDISEWNKVKLGKLKLHELVNTAV---NLDKSSFIDKCFHAASFCSIEKSHEDI 228

Query: 234 DGNIERLEQTKDLIFVPPLK-RSEGEVRXXXXXXXXXXXXXESVKYYGTRSQIVVLCERK 292
               E +  T   IFVPPLK + + +V                  Y+GTRSQ+V L  + 
Sbjct: 229 SKTPEVISNT---IFVPPLKCQPQQDVGLTKSGGL----------YFGTRSQLVTLVSKD 275

Query: 293 SNKVTFVERILHCKNEDAKDNT 314
             +VT  ERILH  + D   N+
Sbjct: 276 RRQVTVAERILHTSDLDRDFNS 297

>CAGL0I10582g Chr9 complement(1046028..1046987) [960 bp, 319 aa]
           {ON} similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127w
          Length = 319

 Score =  185 bits (470), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 122/328 (37%), Positives = 183/328 (55%), Gaps = 48/328 (14%)

Query: 1   MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHNSTILYPYDMSKDICHDGGGDERF 60
           MCIL  T  HP Y+LI+ISNRDE  ER+THSTCW+++  IL PYD+++     G  ++ F
Sbjct: 1   MCILFATREHPDYELIMISNRDEFLERKTHSTCWHNDDFILSPYDLAR--IGAGQSNDTF 58

Query: 61  KSEHGTWCGLNKDGKICTVLNLLKEEE---ARRDGDCNNSLQSRGLIPIKYLCDFDHGFQ 117
               GTW G+N+ G++ TVLNL   +E    R  G+     +SRG +P  +L D    F+
Sbjct: 59  ----GTWTGVNRKGRVATVLNLRICDELDMKRMIGE-----RSRGALPFVFLNDRQGNFE 109

Query: 118 DWNTYDKFIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMGQSQRVLDEENP-YMVVSN- 175
           DW+TY KF +    I  + G FNLF GD K   Y++I+S+G +  +  +    Y+V+SN 
Sbjct: 110 DWDTYAKFCKCYPDIK-RTGDFNLFYGDFKEGRYALIDSLGNTHPLFSKPGKGYLVISNN 168

Query: 176 -----------INWGDPKKMGEWSKIKNGIKLLETLINDKLDNSNKDELEILEDCFQISS 224
                      IN G P+   EW KIK G +++E  +     N+N  + +++E+CF+++S
Sbjct: 169 IHDKLHLQSQDINSG-PE---EWGKIKKGKQIMEEFVK---TNTNLGKEDVIENCFKLAS 221

Query: 225 TINLSGKKIDGN---IERLEQTKDLIFVPPLKRSEGEVRXXXXXXXXXXXXXESVKYYGT 281
           T NL   KI      ++ L  TK+ I+V PL     E                + +YYGT
Sbjct: 222 T-NLILDKITEEFDLVKSLGVTKETIYVQPLLTPPHE---------EIGSPLTAGQYYGT 271

Query: 282 RSQIVVLCERKSNKVTFVERILHCKNED 309
           RSQIV+L ++   K TF+ERI++  ++D
Sbjct: 272 RSQIVLLVDKSKTKATFIERIIYSSDQD 299

>Kpol_1017.9 s1017 complement(28899..29831) [933 bp, 310 aa] {ON}
           complement(28899..29831) [933 nt, 311 aa]
          Length = 310

 Score =  184 bits (466), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 114/315 (36%), Positives = 178/315 (56%), Gaps = 28/315 (8%)

Query: 1   MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHN--STILYPYDMSKDICHDGGGDE 58
           MCILL +  HP Y LILISNRDE  +R TH TCWN    + IL PYDMSK        +E
Sbjct: 1   MCILLASRDHPNYDLILISNRDEFLQRRTHETCWNQGEYARILCPYDMSK-------SNE 53

Query: 59  RFKSEHGTWCGLNKDGKICTVLNLLKEEEARRDGDCNNSLQSRGLIPIKYLCDFD-HGFQ 117
           +  ++ GTWCG+N+ G++ T+LNL  ++  +      ++ +SRG +PIK+L + +     
Sbjct: 54  KNVNKIGTWCGINEFGRVSTILNLKNDDSFQ--SSVPSTKKSRGALPIKFLDNKETDSLL 111

Query: 118 DWNTYDKFIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMGQSQRVLDEENPYMVVSNIN 177
           +W++Y+KF+++   +  + G FN F GD++  +Y++I+S+G +  VL  +NPY+V+SN  
Sbjct: 112 NWDSYEKFVKEYPFV-KETGDFNFFYGDVRIGKYNVIDSIGSTNEVLTVDNPYLVISNDK 170

Query: 178 WG--DPKKMGEWSKIKNGIKLLETLINDKLDNSNKDELEILEDCFQISSTINLSGKKIDG 235
           +G  + K   EW KI     LL+ L         + E +++  CF I+ST N   + +  
Sbjct: 171 FGKSNGKSTKEWEKITLAKNLLKHL------PLCETEDDLIHKCFDIAST-NTLNEDLIK 223

Query: 236 NIERLEQTKDLIFVPPLKRSEGEVRXXXXXXXXXXXXXESVKYYGTRSQIVVLCERKSNK 295
           +++  E   + I VPPL     E +                +YYGTRSQIV+L  +   K
Sbjct: 224 DVDVRELMTETILVPPLNVMTKEEKEKIGASLPIG------QYYGTRSQIVILVNKNRTK 277

Query: 296 VTFVERILHCKNEDA 310
           V F+ERIL+  ++D 
Sbjct: 278 VKFIERILYNSDDDV 292

>Kwal_55.21217 s55 (733995..734906) [912 bp, 303 aa] {ON} YGR127W -
           Hypothetical ORF [contig 131] FULL
          Length = 303

 Score =  181 bits (459), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 115/311 (36%), Positives = 167/311 (53%), Gaps = 46/311 (14%)

Query: 1   MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHNSTILYPYDMSKDICHDGGGDERF 60
           MCILL ++AHP Y LILISNRDE  ER+T  TC NH+  ++ P DM+          +  
Sbjct: 1   MCILLASSAHPRYSLILISNRDEFVERQTRCTCLNHDDYVVSPLDMTL--------KDNN 52

Query: 61  KSEHGTWCGLNKDGKICTVLNLLKEEEARRDGDCNNS----LQSRGLIPIKYLCDFDHGF 116
           +   GTWCG N++G+I  +LNL       R G+ N +    + SRG + ++YL D     
Sbjct: 53  EPNLGTWCGANRNGRIAVILNL-------RTGNTNQTKTKRIVSRGNVTMRYLTD-KQPA 104

Query: 117 QDWNTYDKFIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMGQSQRVLDEENPYMVVSNI 176
            DWN+Y KF  +   I  K   FN+F GD KS +Y+ I+S G S  VL  +NPY+V+SN 
Sbjct: 105 SDWNSYAKFASKCPDI--KSCEFNMFYGDCKSGDYTAIDSSGHSFEVLRSQNPYLVISND 162

Query: 177 NWGDPKKMGEWSKIKNGIKLLETLINDKLDNSNKDELEILEDCFQISSTINLSGKKIDGN 236
           +     K   W KI+   KL+  L+ D +++S  D   +L  CF ++S       K D N
Sbjct: 163 SIESATK---WPKIELAEKLMRDLVRDSVNDSEDD---LLARCFSLAS------HKQDYN 210

Query: 237 IERLEQ---TKDLIFVPPLKRSEGEVRXXXXXXXXXXXXXESVKYYGTRSQIVVLCERKS 293
           ++ +++   T   IFVPPL+  + E                  ++YGTRSQIVVL  ++ 
Sbjct: 211 VDHMDKEKVTSSNIFVPPLEVPKSE---------DLGASVPCGRFYGTRSQIVVLVSKED 261

Query: 294 NKVTFVERILH 304
             + FVE +L+
Sbjct: 262 KSIRFVEHVLY 272

>KLLA0E04687g Chr5 complement(416178..417098) [921 bp, 306 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 306

 Score =  178 bits (452), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 114/314 (36%), Positives = 177/314 (56%), Gaps = 34/314 (10%)

Query: 1   MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHNSTILYPYDMSKDICHDGGGDERF 60
           MCIL  T AHP YKLIL+SNRDE FER+TH+TCWNH+  IL PYDM+  I   G G    
Sbjct: 1   MCILFATRAHPDYKLILLSNRDEFFERKTHATCWNHDGFILSPYDMA--IEKKGQG---- 54

Query: 61  KSEHGTWCGLNKDGKICTVLNLLKEEEARRDGD-CNNSLQSRGLIPIKYLCDFDHG-FQD 118
              +GTW G+N+ G+I  +LNL  +     +    N   +SRG++P+++L   D+  F +
Sbjct: 55  ---YGTWLGINRRGRIAVILNLKIDSPLDSESVLVNGEPRSRGIVPLQFLQQEDNAPFDN 111

Query: 119 WNTYDKFIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMGQSQRVLDEENPYMVVSN--I 176
           W++++KF  Q+G++  + G F LF GD KS+EY++I+ +  S     E+  +MV+SN   
Sbjct: 112 WDSWEKFNGQHGNLR-RTGPFTLFYGDAKSDEYNVIDYLKHSTNPF-EKMEHMVISNDIF 169

Query: 177 NWGDPKKMGEWSKIKNGIKLLETLINDKLDNSNKDELEILEDCFQISSTINLS-GKKIDG 235
           +    +    W+K + G  LL+ L  +    + +   E+L+ CF++ S    + G+ +D 
Sbjct: 170 HCAVGEHTSRWNKTEYGYVLLDALAKNTTGIAKE---ELLQKCFELLSNHTFNEGEDVDS 226

Query: 236 NIERLEQTKDLIFVPPLKRSEGEVRXXXXXXXXXXXXXESVKYYGTRSQIVVLCERKSNK 295
                  T   I+VPPL+ ++G                    YYGTRSQIV+L + K N+
Sbjct: 227 ------VTTSSIYVPPLRITKG--------ADAIGTSLPIGDYYGTRSQIVILVD-KDNR 271

Query: 296 VTFVERILHCKNED 309
           VT+ E +++  +ED
Sbjct: 272 VTYEEHVIYESDED 285

>KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} similar
           to uniprot|P53275 Saccharomyces cerevisiae YGR127W
           Hypothetical ORF
          Length = 300

 Score =  177 bits (449), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 111/304 (36%), Positives = 162/304 (53%), Gaps = 31/304 (10%)

Query: 1   MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHNSTILYPYDMSKDICHDGGGDERF 60
           MCIL+ + AHP Y LI ISNRDE FER+T +TC NH+  IL P D +             
Sbjct: 1   MCILMASVAHPKYSLIAISNRDEFFERKTSNTCLNHDDYILSPLDTAL--------RSNN 52

Query: 61  KSEHGTWCGLNKDGKICTVLNLLKEEEARRDGDCNNSLQSRGLIPIKYLCDFDHGFQDWN 120
           K   GTWCG+N+ G++  +LNL  +E A+R      S  SRG +P+KYL D      DWN
Sbjct: 53  KPALGTWCGVNRKGRVAVILNLRNKEPAKRIP--VKSPISRGSVPMKYLMDRGPS-TDWN 109

Query: 121 TYDKFIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMGQSQRVLDEENPYMVVSNINWGD 180
           +++KF+ +   I      FN+F GD  + EY+ I+S+G S   L    P +V+SN +   
Sbjct: 110 SFEKFVSKYPQITE--CEFNMFYGDCIAGEYTCIDSLGYSSEALTANKPNLVLSNDHIDS 167

Query: 181 PKKMGEWSKIKNGIKLLETLINDKLDNSNKDELEILEDCFQISSTINLSGKKIDGNIERL 240
             +   W K++    LL+ L+     +S   E E++E CF ++S  N    +ID N ++ 
Sbjct: 168 SSR---WPKVQKADILLQELVQSSQHDS---EEELIEKCFALAS--NTEPAEID-NSDKE 218

Query: 241 EQTKDLIFVPPLKRSEGEVRXXXXXXXXXXXXXESVKYYGTRSQIVVLCERKSNKVTFVE 300
           E T   IF+PP++  E                    ++YGTRSQIV+L +R    ++F E
Sbjct: 219 EFTCSSIFIPPVEIPE---------KVDVGASLPCGRFYGTRSQIVILVKRHERTISFTE 269

Query: 301 RILH 304
           R+LH
Sbjct: 270 RVLH 273

>KAFR0C01930 Chr3 (386752..387693) [942 bp, 313 aa] {ON} Anc_3.487
           YGR127W
          Length = 313

 Score =  175 bits (443), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 126/331 (38%), Positives = 175/331 (52%), Gaps = 60/331 (18%)

Query: 1   MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHNSTILYPYDMSKDICHDGGGDERF 60
           MCIL  T +H  Y+LILISNRDE   R+TH TCW++++ IL PYDMS++  H   G++ F
Sbjct: 1   MCILFATRSHKEYELILISNRDEYLGRKTHETCWHNDNFILSPYDMSREENH---GNKIF 57

Query: 61  KSEHGTWCGLNKDGKICTVLNL-------LKEEEARRDGDCNNSLQSRGLIPIKYL-CDF 112
               GTW G+NK GKI T+LNL       LKE    R         SRGLIP  +L  D+
Sbjct: 58  ----GTWLGMNKKGKIATILNLRRFSSIDLKELVKPR---------SRGLIPFTFLYSDW 104

Query: 113 --DHGFQDWNTYDKFIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMGQSQRVLDEENPY 170
             +  F++W T++KF  +   +    G FN F GD+K   Y II+S+G + +VLD  N  
Sbjct: 105 TNEDSFEEWETFEKFKSKYPFLQSS-GDFNFFYGDIKEGNYRIIDSLGNTFKVLDNNNRN 163

Query: 171 MVVSNINW-------GDPKKMGEWSKIKNGIKLLETLINDKLDNSNKDELEILEDCFQIS 223
           M++SN  +       G P     W KIK G + L   + +  + SN+D  E+L  CF+++
Sbjct: 164 MIISNDLYQHKDEYEGKPT----WGKIKIGAERLNKFLKET-ERSNED--EVLAKCFELA 216

Query: 224 STINLSGKKIDGNIERLEQ-----TKDLIFVPPLKRSEGEVRXXXXXXXXXXXXXESVKY 278
           S  +     ID +I R E        + I+VPPLK    E                + KY
Sbjct: 217 SYCS-----IDSSITREENPNKELAAETIYVPPLKVCPDE---------DIGLTKTNGKY 262

Query: 279 YGTRSQIVVLCERKSNKVTFVERILHCKNED 309
           YGTR+QIVVL  +    VT VE  +H  +E+
Sbjct: 263 YGTRTQIVVLVHKDRKHVTLVEHTIHNSDEE 293

>Ecym_1242 Chr1 complement(495583..496518) [936 bp, 311 aa] {ON}
           similar to Ashbya gossypii AFR305W
          Length = 311

 Score =  173 bits (439), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 109/312 (34%), Positives = 167/312 (53%), Gaps = 24/312 (7%)

Query: 1   MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHNSTILYPYDMSKDICHDGGGDERF 60
           MCILL TT HP YKLILISNRDE +ER TH TCW+ +  IL PYD+S     +     + 
Sbjct: 1   MCILLATTDHPDYKLILISNRDEFYERRTHVTCWHQDGVILAPYDISN--SENASDASKA 58

Query: 61  KSEHGTWCGLNKDGKICTVLNLLKEEEARRDGDCNNSLQSRGLIPIKYLCDFDHGFQD-W 119
           +  +GTW G+N+ G +  +LNL +  EA   G  N   +SRG + + +L D  +G  D W
Sbjct: 59  ELSYGTWLGINRVGHVSVLLNLKEVSEAVNPGAGNR--KSRGNVTVAFLRDLSNGNWDKW 116

Query: 120 NTYDKFIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMGQSQRVLDEENPYMVVSNINWG 179
           N Y+KF E   ++D     F LF GD+K+ ++ +I+S  +S      + PY+V+SN    
Sbjct: 117 NNYEKFSEHFAALDDTQS-FTLFYGDIKTGDFGLIDSYKRSMNPFSSKQPYVVISNSRVN 175

Query: 180 DPKKMGEWSKIKNGIKLLETLINDKLDNSNKDELEILEDCFQISSTINLSGKKIDGNIER 239
              +   W K+  G +LL+ L+   L+ S +    +L+ CF+++ T   S   ++G I+ 
Sbjct: 176 CEDEGPRWKKVVEGEQLLKELVKGNLNVSKE---HLLQKCFELAGT---SQFDVNGVIQV 229

Query: 240 LEQT--KDLIFVPPLKRSEGEVRXXXXXXXXXXXXXESVKYYGTRSQIVVLCERKSNKVT 297
            + +  +  IFVP LK +                     +YYGTR+ IV+L +   N VT
Sbjct: 230 TDTSLPEKTIFVPTLKAAGNSSMGVSKIVG---------EYYGTRTTIVILVD-NFNHVT 279

Query: 298 FVERILHCKNED 309
             E ++H  ++D
Sbjct: 280 MHEHVIHDSDKD 291

>TDEL0D05550 Chr4 (1003288..1004220) [933 bp, 310 aa] {ON} Anc_3.487
           YGR127W
          Length = 310

 Score =  171 bits (433), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 115/315 (36%), Positives = 165/315 (52%), Gaps = 30/315 (9%)

Query: 1   MCILLGTTAHPFYKLILISNRDEVFERETHSTCWNHNSTILYPYDMSKDICHDGGGDERF 60
           MCIL+ T+ HP Y L+L+SNRDE F R+     W  ++ +L P D       D  G++  
Sbjct: 1   MCILIATSDHPKYDLVLVSNRDEYFARKASPASWTEDNFMLCPLDKGL----DSSGEDL- 55

Query: 61  KSEHGTWCGLNKDGKICTVLNLLKEEEAR-RDGDCNNSLQSRGLIPIKYLCDFDHGFQDW 119
               GTW G N+DGKI TVLNL    + R R   C    +SRG IP+ +L      F+DW
Sbjct: 56  ----GTWIGANRDGKIGTVLNLKLFSDPRGRPAVCP---ESRGKIPVSFLSSRGANFKDW 108

Query: 120 NTYDKFIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMGQSQRVLDEEN-PYMVVSN-IN 177
           +TYDKF  Q   ++     FN F GD    +Y +I+S+G + +VL + N  Y+VVSN I 
Sbjct: 109 DTYDKFCHQFQGLEFTRD-FNFFYGDCSIGDYRVIDSLGNTTKVLGKTNEKYIVVSNDIF 167

Query: 178 WGDPKKMGEWSKIKNGIKLLETLINDKLDNSNKDELEILEDCFQISSTINLSGKKIDGN- 236
            G+  K   W KI    + L  L+ +  D    DE + +++CF I+S      K   GN 
Sbjct: 168 QGESNKNRVWDKISLADQALHHLVREFNDT---DEDKFIQECFGIASINPFHSKHDHGNY 224

Query: 237 -IERLEQTKDLIFVPPLKRSEGEVRXXXXXXXXXXXXXESVKYYGTRSQIVVLCERKSNK 295
            ++ +E +   +FVPPLK S  +                  +YYGTRSQ V+L  +  + 
Sbjct: 225 YMKAVELSMQTVFVPPLKTSCDD---------GLGASVPIGEYYGTRSQTVILVSKDRSH 275

Query: 296 VTFVERILHCKNEDA 310
           +T+VERI+H  + DA
Sbjct: 276 ITYVERIIHDSDLDA 290

>ZYRO0D10098g Chr4 complement(851071..851901) [831 bp, 276 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 276

 Score =  147 bits (370), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 97/255 (38%), Positives = 137/255 (53%), Gaps = 34/255 (13%)

Query: 65  GTWCGLNKDGKICTVLNLLKEEEARRDGDCNNSLQSRGLIPIKYLCDFDHGFQDWNTYDK 124
           GTWCG+NKDG++ TVLNL  ++ A+R    +  L SRG +P  +L   D  ++ WN+Y+K
Sbjct: 24  GTWCGINKDGRVGTVLNLKLDQGAQRGHPLH--LSSRGKVPTAFLSQHDLDWEQWNSYNK 81

Query: 125 FIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMGQSQRVL-----DEENPYMVVSNINWG 179
           F  Q   +D   G FN F GD K+ +Y II+S+ Q+  VL      +++ YMVVSN  + 
Sbjct: 82  FANQFSELDN-TGDFNFFYGDCKNGQYKIIDSLRQTHDVLTNNESQDDSSYMVVSNDVY- 139

Query: 180 DPKKMGE--WSKIKNGIKLLETLINDKLDNSNKDELEILEDCFQISSTINLSGKKIDGNI 237
             +  GE  W K++   K L  LI D   N N+D+   +  CFQ++ST       +D   
Sbjct: 140 --RYQGEETWPKVQLAKKNLRKLIED---NVNEDQDSFISKCFQVAST----SPGLDWQS 190

Query: 238 ERLEQTKDL----IFVPPLKRSEGEVRXXXXXXXXXXXXXESVKYYGTRSQIVVLCERKS 293
           E L ++ D+    IFVPPLK                        +YGTRSQIV+L  +  
Sbjct: 191 EELLKSSDVTKQSIFVPPLKFPPD----------LNLGTTTHAGFYGTRSQIVLLVSKDR 240

Query: 294 NKVTFVERILHCKNE 308
            KVTFVER+LH  +E
Sbjct: 241 QKVTFVERVLHNSDE 255

>Suva_1.31 Chr1 (56284..57150) [867 bp, 288 aa] {ON} YAL034W-A
           (REAL)
          Length = 288

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 44/75 (58%), Gaps = 9/75 (12%)

Query: 189 KIKNGIKLLETLINDKLD-NSNKDELEILEDCFQISSTINLSGKKIDGNIERLEQTKDLI 247
           +IKNG+  LE+L+ + +D N +K EL +L +  +I          +D N+ RLE  KDL+
Sbjct: 60  EIKNGVAKLESLLENSVDKNFDKLELYVLRNVLRIPEEF------LDANVFRLENQKDLV 113

Query: 248 FV--PPLKRSEGEVR 260
            V    +KRSE E+R
Sbjct: 114 IVDDKEIKRSEEELR 128

>Smik_1.31 Chr1 (62639..63508) [870 bp, 289 aa] {ON} YAL034W-A
           (REAL)
          Length = 289

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 45/75 (60%), Gaps = 9/75 (12%)

Query: 189 KIKNGIKLLETLINDKLD-NSNKDELEILEDCFQISSTINLSGKKIDGNIERLEQTKDLI 247
           +IK+G+  LE+L+ + +D N +K EL +L +  +I        + +D N+ RLE  KDL+
Sbjct: 60  EIKSGVAKLESLLENSVDKNFDKLELYVLRNVLRIPE------EYLDANVFRLENQKDLV 113

Query: 248 FVP--PLKRSEGEVR 260
            V    LKRSE E+R
Sbjct: 114 IVDDNELKRSEEELR 128

>Skud_1.26 Chr1 (55314..56180) [867 bp, 288 aa] {ON} YAL034W-A
           (REAL)
          Length = 288

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/84 (36%), Positives = 49/84 (58%), Gaps = 12/84 (14%)

Query: 183 KMGE---WSKIKNGIKLLETLINDKLD-NSNKDELEILEDCFQISSTINLSGKKIDGNIE 238
           K+GE     +IK+G+  LE+L+ + +D N +K EL +L +  +I        + +D N+ 
Sbjct: 51  KIGEEDYGEEIKSGVAKLESLLENSVDKNFDKLELYVLRNVLRIPE------EYLDANVF 104

Query: 239 RLEQTKDLIFV--PPLKRSEGEVR 260
           RLE  KDL+ V    +KRSE E+R
Sbjct: 105 RLESQKDLVIVNDTEIKRSEEELR 128

>YAL034W-A Chr1 (79718..80587) [870 bp, 289 aa] {ON}  MTW1Essential
           component of the MIND kinetochore complex (Mtw1p
           Including Nnf1p-Nsl1p-Dsn1p) which joins kinetochore
           subunits contacting DNA to those contacting
           microtubules; critical to kinetochore assembly
          Length = 289

 Score = 37.0 bits (84), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 30/84 (35%), Positives = 49/84 (58%), Gaps = 12/84 (14%)

Query: 183 KMGEW---SKIKNGIKLLETLINDKLD-NSNKDELEILEDCFQISSTINLSGKKIDGNIE 238
           K+GE     +IK+G+  LE+L+ + +D N +K EL +L +  +I        + +D N+ 
Sbjct: 51  KIGEEDYGEEIKSGVAKLESLLENSVDKNFDKLELYVLRNVLRIPE------EYLDANVF 104

Query: 239 RLEQTKDLIFVP--PLKRSEGEVR 260
           RLE  KDL+ V    LK+SE ++R
Sbjct: 105 RLENQKDLVIVDENELKKSEEKLR 128

>Kpol_1065.11 s1065 (24654..25517) [864 bp, 287 aa] {ON}
           (24654..25517) [864 nt, 288 aa]
          Length = 287

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 35/62 (56%), Gaps = 7/62 (11%)

Query: 188 SKIKNGIKLLETLINDKLD-NSNKDELEILEDCFQISSTINLSGKKIDGNIERLEQTKDL 246
           S+IK GI  LETL+   +D N +K EL IL +  +I   +      +D N+ RL+  KDL
Sbjct: 59  SEIKVGIAKLETLLEHSVDKNFDKLELYILRNVLRIPQEL------LDNNVFRLKHQKDL 112

Query: 247 IF 248
           + 
Sbjct: 113 VI 114

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.137    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 37,291,421
Number of extensions: 1752339
Number of successful extensions: 5196
Number of sequences better than 10.0: 46
Number of HSP's gapped: 5265
Number of HSP's successfully gapped: 46
Length of query: 318
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 209
Effective length of database: 40,982,805
Effective search space: 8565406245
Effective search space used: 8565406245
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)