Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0D029803.491ON44344314890.0
SAKL0F02794g3.491ON3974216792e-84
Skud_16.4433.491ON4202795967e-72
KLTH0F14806g3.491ON3582675848e-71
Suva_16.4773.491ON4232835723e-68
Smik_16.4013.491ON4272865699e-68
Kwal_55.212273.491ON3762675604e-67
TDEL0D055903.491ON3442685514e-66
YPR148C3.491ON4352895453e-64
ZYRO0D10010g3.491ON3822675274e-62
NCAS0F035403.491ON4442675272e-61
Ecym_12383.491ON3932804944e-57
KLLA0E04621g3.491ON3892834928e-57
Kpol_1017.73.491ON3782684822e-55
TPHA0D032703.491ON3882834622e-52
AFR309C3.491ON3642774444e-50
KAFR0G036803.491ON4152684171e-45
NDAI0B058503.491ON4731113454e-35
KNAG0A079303.491ON4521163121e-30
CAGL0L08492g3.491ON385892932e-28
KLLA0E04511g7.221ON3021181762e-13
TDEL0H022407.221ON3382171585e-11
NDAI0A026607.221ON364651561e-10
KNAG0D017607.221ON342631497e-10
CAGL0L00891g7.221ON341681481e-09
Smik_9.1507.221ON326901443e-09
KLTH0A03894g7.221ON323651434e-09
Kwal_47.181487.221ON323651434e-09
SAKL0F08162g7.221ON3301221426e-09
YIL041W (GVP36)7.221ON326901426e-09
Ecym_43777.221ON3331211391e-08
Skud_9.1287.221ON329651382e-08
Suva_9.1597.221ON325651382e-08
KAFR0I019507.221ON330651382e-08
NCAS0A133807.221ON3292171363e-08
ADL115W7.221ON3331051354e-08
Kpol_1070.197.221ON311651336e-08
TPHA0B027507.221ON363701339e-08
Kpol_478.227.221ON350651321e-07
TBLA0D042007.221ON3311071311e-07
TBLA0B015807.221ON386601302e-07
ZYRO0D16522g7.221ON358611283e-07
TPHA0C012307.221ON305651274e-07
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0D02980
         (443 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.4...   578   0.0  
SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} simila...   266   2e-84
Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {...   234   7e-72
KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]...   229   8e-71
Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {...   224   3e-68
Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {...   223   9e-68
Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {...   220   4e-67
TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa] ...   216   4e-66
YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON} ...   214   3e-64
ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} simila...   207   4e-62
NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {O...   207   2e-61
Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar t...   194   4e-57
KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some s...   194   8e-57
Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137...   190   2e-55
TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {O...   182   2e-52
AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}...   175   4e-50
KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {O...   165   1e-45
NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa] ...   137   4e-35
KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa] ...   124   1e-30
CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} simil...   117   2e-28
KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {O...    72   2e-13
TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.2...    65   5e-11
NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON} Anc_7.221     65   1e-10
KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.2...    62   7e-10
CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} simil...    62   1e-09
Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W (...    60   3e-09
KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {O...    60   4e-09
Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {O...    60   4e-09
SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {O...    59   6e-09
YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR do...    59   6e-09
Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}...    58   1e-08
Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W (...    58   2e-08
Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W (...    58   2e-08
KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.22...    58   2e-08
NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {...    57   3e-08
ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic ho...    57   4e-08
Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON} (45405.....    56   6e-08
TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.2...    56   9e-08
Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON} (67833..6...    55   1e-07
TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7....    55   1e-07
TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.2...    55   2e-07
ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]...    54   3e-07
TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.22...    54   4e-07

>TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.491
           YPR148C
          Length = 443

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/443 (69%), Positives = 308/443 (69%)

Query: 1   MLHATRYXXXXXXXXXXXXXXXXXQMSGYFSNFSLDKLADSLQSAAQKTQDTLSNAIQNV 60
           MLHATRY                 QMSGYFSNFSLDKLADSLQSAAQKTQDTLSNAIQNV
Sbjct: 1   MLHATRYTLHTTHYTLYSPTSPPPQMSGYFSNFSLDKLADSLQSAAQKTQDTLSNAIQNV 60

Query: 61  NIDWNDPQTRLTLLSKQHYLQESIGQINEISKLPSQYNALERKTDALEKIIKRILIVTNT 120
           NIDWNDPQTRLTLLSKQHYLQESIGQINEISKLPSQYNALERKTDALEKIIKRILIVTNT
Sbjct: 61  NIDWNDPQTRLTLLSKQHYLQESIGQINEISKLPSQYNALERKTDALEKIIKRILIVTNT 120

Query: 121 FEIEGYDYPPNLSESISEWWLNDPLAFLRXXXXXXXXXXXXXXXXXTXXXXXXXXXXXFL 180
           FEIEGYDYPPNLSESISEWWLNDPLAFLR                 T           FL
Sbjct: 121 FEIEGYDYPPNLSESISEWWLNDPLAFLRDNDNTNDKNKSNSNPPDTKSKSDSDSESSFL 180

Query: 181 PRSFPHXXXXXXXXXXXXLTNLNNNEKLEFAKTKTXXXXXXXXXXIQLLIKVFDSWSLCN 240
           PRSFPH            LTNLNNNEKLEFAKTKT          IQLLIKVFDSWSLCN
Sbjct: 181 PRSFPHAISKASSDSSAILTNLNNNEKLEFAKTKTEDEEYEDDEDIQLLIKVFDSWSLCN 240

Query: 241 KNIDKSKFQRDQLIIKQFNKKLTSLLDVEFKNVKALRLKVQDARLKFDTMRYXXXXXXXX 300
           KNIDKSKFQRDQLIIKQFNKKLTSLLDVEFKNVKALRLKVQDARLKFDTMRY        
Sbjct: 241 KNIDKSKFQRDQLIIKQFNKKLTSLLDVEFKNVKALRLKVQDARLKFDTMRYEIAKAAEA 300

Query: 301 XXXXXXNDKPVEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIESQK 360
                 NDKPVEM                                          IESQK
Sbjct: 301 KVRAEENDKPVEMEKGEGEDEGEGEGKGKGKGKGETASTSTETASTSTTKDAAATIESQK 360

Query: 361 KDSPNPEFEKNDSQNXXXXXXXXXXXXFVSHTSAAVETMEEITESSKILDLIKLFQNFQL 420
           KDSPNPEFEKNDSQN            FVSHTSAAVETMEEITESSKILDLIKLFQNFQL
Sbjct: 361 KDSPNPEFEKNDSQNEDEKLLEHLEDEFVSHTSAAVETMEEITESSKILDLIKLFQNFQL 420

Query: 421 LHYQQCIKEVETNMKLLTDLTHE 443
           LHYQQCIKEVETNMKLLTDLTHE
Sbjct: 421 LHYQQCIKEVETNMKLLTDLTHE 443

>SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 397

 Score =  266 bits (679), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 155/421 (36%), Positives = 219/421 (52%), Gaps = 27/421 (6%)

Query: 26  MSGYFSNFSLDKLADSLQSAAQKTQDTLSNAIQNVNIDWNDPQTRLTLLSKQHYLQESIG 85
           MSGYFS+FSLDKL +S+ SAA KTQD LS AI N+ +D  DPQ +L+L  ++HYLQE++G
Sbjct: 1   MSGYFSSFSLDKLTNSISSAAHKTQDKLSTAIANIQLD--DPQAKLSLKVRKHYLQETLG 58

Query: 86  QINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISEWWLNDPL 145
            I++ISKLP QY  LE+K D+LEKI +R+L+VT TFE+EGYDYPPNLSESIS+WW  +  
Sbjct: 59  AIDDISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANRS 118

Query: 146 AFLRXXXXXXXXXXXXXXXXXTXXXXXXXXXXXFLPRSFPHXXXXXXXXXXXXLTNLNNN 205
             L                              FLPRSF              L  L + 
Sbjct: 119 GLL-------SFMDGKKGEGSRAKAEEKDENEGFLPRSFAQALSKAAKDSGDVLRTLKDE 171

Query: 206 EKLEFAKTKTXXXXXXXXXXIQLLIKVFDSWSLCNKNIDKSKFQRDQLIIKQFNKKLTSL 265
           +     K             I  LI +F++WS C + ID+ K + D L+ K+FNKKL  L
Sbjct: 172 Q-----KEPPQDEDEDEDEDINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLDKL 226

Query: 266 LDVEFKNVKALRLKVQDARLKFDTMRYX---XXXXXXXXXXXXXNDKPVEMXXXXXXXXX 322
           ++ +FK V +LR KV+++RLKFDT+RY                  ++ V++         
Sbjct: 227 INEDFKKVHSLRKKVEESRLKFDTLRYELNLKEKEQQKAKAKEEENEKVDVVEQNAPEEK 286

Query: 323 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIESQKKDSPNPEFEKNDSQNXXXXXXX 382
                                            +E+++ D+ +PE +             
Sbjct: 287 AKTEGQETSEGKEHDLKADEKLSEDTASKIPESVENEEVDNEDPEHK----------LLE 336

Query: 383 XXXXXFVSHTSAAVETMEEITESSKILDLIKLFQNFQLLHYQQCIKEVETNMKLLTDLTH 442
                FVS T+ AVE M EIT+SS+IL L+KLF  FQL++++QC++E+E + K+L  L +
Sbjct: 337 KLEDEFVSSTTEAVEIMGEITDSSEILSLVKLFHKFQLIYHRQCVQELEASTKILDGLDN 396

Query: 443 E 443
           E
Sbjct: 397 E 397

>Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {ON}
           YPR148C (REAL)
          Length = 420

 Score =  234 bits (596), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 121/279 (43%), Positives = 164/279 (58%), Gaps = 23/279 (8%)

Query: 26  MSGYFSNFSLDKLADSLQSAAQKTQDTLSNAIQNVNIDWNDPQTRLTLLSKQHYLQESIG 85
           MSGYFS FSL+K+ DS+ +AA KTQDTL+NA+ + N++ NDP+TRL++ S+  ++QES+G
Sbjct: 1   MSGYFSGFSLNKITDSIATAAHKTQDTLNNALASANVNLNDPETRLSIKSRTRFVQESLG 60

Query: 86  QINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISEWWLNDPL 145
            +++ISKLP QY  LE+K+D+LEK+ +RIL+V+ TFE+EGYDYPPNL+ESIS+WW  +  
Sbjct: 61  TVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWWSVNKD 120

Query: 146 AFLRXXXXXXXXXXXXXXXXXTXXXXXXXXXXXFLPRSFPHXXXXXXXXXXXXLTNLNNN 205
            +                               FLPRSF                +L  +
Sbjct: 121 GWF-----------GSRKSENANKKKVSNHDDAFLPRSFAQAISKAAVDCECEFQSLKQD 169

Query: 206 EKLEFAKTKTXXXX------------XXXXXXIQLLIKVFDSWSLCNKNIDKSKFQRDQL 253
           EK    K                         +  LIKVFDSWS C KNID+ K + D  
Sbjct: 170 EKAGLKKKSESNETAQDAEAQEEDEEDEEDEDLSNLIKVFDSWSTCYKNIDEGKAEMDST 229

Query: 254 IIKQFNKKLTSLLDVEFKNVKALRLKVQDARLKFDTMRY 292
           +IK+FNKKL  L++ +FK V  LR KV+D+RLKFDTMRY
Sbjct: 230 MIKEFNKKLEKLINKDFKKVHELRKKVEDSRLKFDTMRY 268

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 46/53 (86%)

Query: 388 FVSHTSAAVETMEEITESSKILDLIKLFQNFQLLHYQQCIKEVETNMKLLTDL 440
           FVS+T+ AVE MEEIT+SS IL L+KLFQNFQL++++QC++EVE N+K+L  L
Sbjct: 366 FVSNTTTAVEIMEEITDSSDILGLVKLFQNFQLVYFRQCVQEVEANLKVLNSL 418

>KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]
           {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 358

 Score =  229 bits (584), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 114/267 (42%), Positives = 159/267 (59%), Gaps = 17/267 (6%)

Query: 26  MSGYFSNFSLDKLADSLQSAAQKTQDTLSNAIQNVNIDWNDPQTRLTLLSKQHYLQESIG 85
           MS YF  FSL+KL +S+ + A KTQDTLS AI N+ +D  DPQ +L+L +++HYLQE++G
Sbjct: 1   MSNYFGGFSLNKLTNSITNVAHKTQDTLSTAIANIQLD--DPQAKLSLKARKHYLQETLG 58

Query: 86  QINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISEWWLNDPL 145
            I +ISKLP QY  LE+K D+LEK+ +R+L+VT T+E+EGYDYPPNLSES+S+WW ++  
Sbjct: 59  TIEDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNKE 118

Query: 146 AFLRXXXXXXXXXXXXXXXXXTXXXXXXXXXXXFLPRSFPHXXXXXXXXXXXXLTNLNNN 205
                                             +PRSF              +T L   
Sbjct: 119 GLFGFVSSSKKEK---------KLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTALKTE 169

Query: 206 EKLEFAKTKTXXXXXXXXXXIQLLIKVFDSWSLCNKNIDKSKFQRDQLIIKQFNKKLTSL 265
           E+      K           I  LIK+F++WS C  N+D+SK + D L++K+FN KLT+ 
Sbjct: 170 EQ------KASAEEDEEDEDITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAF 223

Query: 266 LDVEFKNVKALRLKVQDARLKFDTMRY 292
           ++ +FKN + LR KV+D+RLKFDTMRY
Sbjct: 224 VEEKFKNARTLRKKVEDSRLKFDTMRY 250

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/85 (43%), Positives = 56/85 (65%), Gaps = 1/85 (1%)

Query: 357 ESQKKDSPNPEFEKN-DSQNXXXXXXXXXXXXFVSHTSAAVETMEEITESSKILDLIKLF 415
           ESQK      E  K+ DS +            FVS+T+ AVETM EIT+S++I++L+KLF
Sbjct: 269 ESQKPQEDEAEASKDSDSSDEAQKLLEKLEDEFVSNTTEAVETMGEITDSAEIINLVKLF 328

Query: 416 QNFQLLHYQQCIKEVETNMKLLTDL 440
            NFQL++Y+QC++ +ET++  L +L
Sbjct: 329 HNFQLIYYKQCVQNLETSINSLNEL 353

>Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {ON}
           YPR148C (REAL)
          Length = 423

 Score =  224 bits (572), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 119/283 (42%), Positives = 164/283 (57%), Gaps = 32/283 (11%)

Query: 26  MSGYFSNFSLDKLADSLQSAAQKTQDTLSNAIQNVNIDWNDPQTRLTLLSKQHYLQESIG 85
           MSGY+     +K+ DS+ +AA KTQDTL++A+ N N++ NDPQTRL++ S+  ++QES+G
Sbjct: 1   MSGYW-----NKITDSIATAAHKTQDTLNSALANANVNLNDPQTRLSIKSRTRFVQESLG 55

Query: 86  QINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISEWWLNDPL 145
            +++ISKLP QY  LE+K+D+LEK+ KRIL+V+ TFE+EGYDYPPNL+ESIS+WW  +  
Sbjct: 56  TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 115

Query: 146 AFLRXXXXXXXXXXXXXXXXXTXXXXXXXXXXXFLPRSFPHXXXXXXXXXXXXLTNLNNN 205
            +                   T           FLPRSF                NL  N
Sbjct: 116 GWFGSKKTEHASKKKDSNHDDT-----------FLPRSFAQAISKAAVDCESEFKNLEQN 164

Query: 206 EKLEFAKTKTXXX----------------XXXXXXXIQLLIKVFDSWSLCNKNIDKSKFQ 249
           EK +  + K                           +  LIKVFDSWS C KNID+ K +
Sbjct: 165 EKEDLKQKKEAKKTTQETAEQEEEEEEEEEEEDDEDLSNLIKVFDSWSTCYKNIDEGKAE 224

Query: 250 RDQLIIKQFNKKLTSLLDVEFKNVKALRLKVQDARLKFDTMRY 292
            D +++K+FNKKL  L++ +FK V  LR KV+++RLKFDTMRY
Sbjct: 225 MDSMMVKEFNKKLEKLINEDFKKVHELRRKVEESRLKFDTMRY 267

 Score = 79.7 bits (195), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 48/53 (90%)

Query: 388 FVSHTSAAVETMEEITESSKILDLIKLFQNFQLLHYQQCIKEVETNMKLLTDL 440
           FVS+T+AAVETMEEIT+SS+IL L+KLFQNFQL++++QC +EVE N+K+L  +
Sbjct: 369 FVSNTTAAVETMEEITDSSEILSLVKLFQNFQLVYFRQCAQEVEANLKVLNGM 421

>Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {ON}
           YPR148C (REAL)
          Length = 427

 Score =  223 bits (569), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 129/286 (45%), Positives = 169/286 (59%), Gaps = 31/286 (10%)

Query: 26  MSGYFSNFSLDKLADSLQSAAQKTQDTLSNAIQNVNIDWNDPQTRLTLLSKQHYLQESIG 85
           MSGYFS+FSL+K+ DS+ +AA KT DTL+NA+ N N++ NDPQTRL++ S+  ++QES+G
Sbjct: 1   MSGYFSSFSLNKITDSIATAAHKTHDTLNNALANANVNLNDPQTRLSIKSRTRFVQESLG 60

Query: 86  QINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISEWW-LNDP 144
            I++ISKLP QY  LE+K+D+LEK+ KRIL+V+ TFE+EGYDYPPNL+ESIS+WW LN  
Sbjct: 61  TISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120

Query: 145 LAFLRXXXXXXXXXXXXXXXXXTXXXXXXXXXXXFLPRSFPHXXXXXXXXXXXXLTNLNN 204
             F                   T           FLPRSF                NL N
Sbjct: 121 GWF------------GSKKSEITNKKKGSNHDDAFLPRSFAQAISKAAVDCEFEFQNLEN 168

Query: 205 NEKLEFAKTKTXXXXXXXXXX------------------IQLLIKVFDSWSLCNKNIDKS 246
           +EK E  K +                             +  LIKVFDSWS C KNID+ 
Sbjct: 169 DEKAELKKKRESTKNAQTTGAQDEENEEDEDEEEEEDEDLSNLIKVFDSWSTCYKNIDEG 228

Query: 247 KFQRDQLIIKQFNKKLTSLLDVEFKNVKALRLKVQDARLKFDTMRY 292
           K + D +++K+FNKKL  L++ +FK V  LR KV+ +RLKFDTMRY
Sbjct: 229 KTEMDSMMVKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMRY 274

 Score = 80.5 bits (197), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 36/53 (67%), Positives = 48/53 (90%)

Query: 388 FVSHTSAAVETMEEITESSKILDLIKLFQNFQLLHYQQCIKEVETNMKLLTDL 440
           FVS+T+AAVETMEEI +SS+IL LIKLFQNFQL++++QC++EVE N+K+L  L
Sbjct: 373 FVSNTTAAVETMEEIADSSEILGLIKLFQNFQLVYFRQCVQEVEANLKVLNGL 425

>Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {ON}
           YPR148C - Hypothetical ORF [contig 130] FULL
          Length = 376

 Score =  220 bits (560), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 114/267 (42%), Positives = 153/267 (57%), Gaps = 17/267 (6%)

Query: 26  MSGYFSNFSLDKLADSLQSAAQKTQDTLSNAIQNVNIDWNDPQTRLTLLSKQHYLQESIG 85
           MS YF  FS +KL D+L +AA KTQDTLS AI N+ +D  DPQ  L+L +++HYLQE++G
Sbjct: 1   MSSYFGGFSFNKLTDTLTNAAHKTQDTLSTAIANIQLD--DPQAILSLKARKHYLQETLG 58

Query: 86  QINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISEWWLNDPL 145
            I +ISKLP QY  LE+K D+LEK  +R+L+VT TFE+EGYDYPPNLSES+S+WW ++  
Sbjct: 59  TIEDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKE 118

Query: 146 AFLRXXXXXXXXXXXXXXXXXTXXXXXXXXXXXFLPRSFPHXXXXXXXXXXXXLTNLNNN 205
                                             +PRSF              L  L + 
Sbjct: 119 GLFGLMSSSKKDKGAESAAAAK---------SALMPRSFAQAIAKAAKDSGDVLAALKDQ 169

Query: 206 EKLEFAKTKTXXXXXXXXXXIQLLIKVFDSWSLCNKNIDKSKFQRDQLIIKQFNKKLTSL 265
           E+      +           I  LIK+F +WS C   ID+ K + D L+ K+FN+KL +L
Sbjct: 170 EQ------QASADEEDEDEDITPLIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNAL 223

Query: 266 LDVEFKNVKALRLKVQDARLKFDTMRY 292
           ++ +FKN   LR KV+D+RLKFDTMRY
Sbjct: 224 IEEKFKNASVLRRKVEDSRLKFDTMRY 250

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 47/56 (83%)

Query: 388 FVSHTSAAVETMEEITESSKILDLIKLFQNFQLLHYQQCIKEVETNMKLLTDLTHE 443
           FVS+T+ AVETM EIT+S+++L+L+KLF NFQL++++QC++++E ++  L +L  E
Sbjct: 319 FVSNTTEAVETMGEITDSAELLNLVKLFHNFQLVYHRQCVQDLEASLSTLNELEGE 374

>TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa]
           {ON} Anc_3.491 YPR148C
          Length = 344

 Score =  216 bits (551), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 119/268 (44%), Positives = 157/268 (58%), Gaps = 29/268 (10%)

Query: 26  MSGYFSNFSLDKLADSLQSAAQKTQDTLSNAIQNVNIDWNDPQTRLTLLSKQHYLQESIG 85
           MSGY SNFSL+K+ D+L +AA KTQDTL++AI NV+    DPQ +L+L ++  YLQE++G
Sbjct: 1   MSGYLSNFSLNKITDTLANAAHKTQDTLNSAIANVS----DPQAKLSLKARTRYLQETLG 56

Query: 86  QINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISEWW-LNDP 144
            I++ SKLP QY +LE+K+DALEK  KRIL+VT TFE+EGYDYPPNL+ESIS+WW LN  
Sbjct: 57  TIDDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNKD 116

Query: 145 LAFLRXXXXXXXXXXXXXXXXXTXXXXXXXXXXXFLPRSFPHXXXXXXXXXXXXLTNLNN 204
             F                               FLPRSF               TNL  
Sbjct: 117 GWF-------------GTKKPEKTKNDSSDGSDAFLPRSFSQAISKAANDCNSVFTNLQE 163

Query: 205 NEKLEFAKTKTXXXXXXXXXXIQLLIKVFDSWSLCNKNIDKSKFQRDQLIIKQFNKKLTS 264
           +                    +  + K+FDSWS C KNID+ K + D +I K+FN KL  
Sbjct: 164 H-----------GDEDEEDEDVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEK 212

Query: 265 LLDVEFKNVKALRLKVQDARLKFDTMRY 292
           +++ +FK V A R KV+++RLKFDT+RY
Sbjct: 213 IINEDFKKVHASRKKVEESRLKFDTVRY 240

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 46/53 (86%)

Query: 388 FVSHTSAAVETMEEITESSKILDLIKLFQNFQLLHYQQCIKEVETNMKLLTDL 440
           FVS+T+AAVE M E+TES++IL L KLFQNFQL++++QC++EVE ++K+L  L
Sbjct: 287 FVSNTTAAVEIMGEVTESAEILGLAKLFQNFQLVYFRQCVQEVEASLKILGAL 339

>YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON}
           Protein of unknown function that may interact with
           ribosomes, based on co-purification experiments; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 435

 Score =  214 bits (545), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 127/289 (43%), Positives = 172/289 (59%), Gaps = 34/289 (11%)

Query: 26  MSGYFSNFSLDKLADSLQSAAQKTQDTLSNAIQNVNIDWNDPQTRLTLLSKQHYLQESIG 85
           MSGYFS FSL+K+ DS+ +AA KTQDTL+NA+ N N++ NDPQTRL++ S+  ++QES+G
Sbjct: 1   MSGYFSGFSLNKITDSIATAAHKTQDTLNNALANANVNLNDPQTRLSIKSRTRFVQESLG 60

Query: 86  QINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISEWW-LNDP 144
            +++ISKLP QY  LE+K+D+LEK+ KRIL+V+ TFE+EGYDYPPNL+ESIS+WW LN  
Sbjct: 61  TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120

Query: 145 LAFLRXXXXXXXXXXXXXXXXXTXXXXXXXXXXXFLPRSFPHXXXXXXXXXXXXLTNLNN 204
             F                   +           FLPRSF                NL +
Sbjct: 121 GWF------------GSKKSESSTKKKGSNHDDAFLPRSFAQAISKAAVDCECEFQNLEH 168

Query: 205 N---------EKLEFAKTKTXXXX------------XXXXXXIQLLIKVFDSWSLCNKNI 243
           N         E ++ A+T                        +  LIKVFDSWS C KNI
Sbjct: 169 NEKAELKKKKESIKTAQTTEAQGADHNEEDEEDEEDEEDDEDLSNLIKVFDSWSTCYKNI 228

Query: 244 DKSKFQRDQLIIKQFNKKLTSLLDVEFKNVKALRLKVQDARLKFDTMRY 292
           D+ K + D +++K+FNKKL +L++ +FK V  LR KV+++RLKFDTMRY
Sbjct: 229 DEGKAEMDSMMVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMRY 277

 Score = 82.0 bits (201), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 37/53 (69%), Positives = 49/53 (92%)

Query: 388 FVSHTSAAVETMEEITESSKILDLIKLFQNFQLLHYQQCIKEVETNMKLLTDL 440
           FVS+T+AAVETMEEIT+SS+IL LIKLFQNFQL++++QC++EVE N+K+L  L
Sbjct: 381 FVSNTTAAVETMEEITDSSEILGLIKLFQNFQLVYFRQCVQEVEANLKVLNGL 433

>ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 382

 Score =  207 bits (527), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 110/267 (41%), Positives = 155/267 (58%), Gaps = 20/267 (7%)

Query: 26  MSGYFSNFSLDKLADSLQSAAQKTQDTLSNAIQNVNIDWNDPQTRLTLLSKQHYLQESIG 85
           MS YFS+FS   L DS+ +AA +TQD LSNA+ NVN+  NDPQTRL++ ++  YL+E++G
Sbjct: 1   MSEYFSSFSFKNLGDSIANAAHRTQDKLSNAVANVNL--NDPQTRLSIKTRTRYLKETLG 58

Query: 86  QINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISEWWLNDPL 145
            ++EISKLP QY  LERK+DALEK  KR+L+VT TFE+EGYDYPPNL ES S+WW     
Sbjct: 59  AVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKE 118

Query: 146 AFLRXXXXXXXXXXXXXXXXXTXXXXXXXXXXXFLPRSFPHXXXXXXXXXXXXLTNLNNN 205
            +                   +            +PRSF                N   +
Sbjct: 119 GWF--------GSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKS 170

Query: 206 EKLEFAKTKTXXXXXXXXXXIQLLIKVFDSWSLCNKNIDKSKFQRDQLIIKQFNKKLTSL 265
           EK +  + +              L+++F++ S+C +NID+ K + D+ I ++FN KL  L
Sbjct: 171 EKKQIDEDEDDVN----------LVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQL 220

Query: 266 LDVEFKNVKALRLKVQDARLKFDTMRY 292
           L+ +FK +  LR KV+++RLKFDTMRY
Sbjct: 221 LNRDFKKIHVLRNKVENSRLKFDTMRY 247

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 43/53 (81%)

Query: 388 FVSHTSAAVETMEEITESSKILDLIKLFQNFQLLHYQQCIKEVETNMKLLTDL 440
           FVS+TS AVETM  I E S+IL L+KLFQN QL++Y+QC++E+E ++K L DL
Sbjct: 328 FVSNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQEMEASLKGLNDL 380

>NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {ON}
           Anc_3.491 YPR148C
          Length = 444

 Score =  207 bits (527), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 114/267 (42%), Positives = 150/267 (56%), Gaps = 29/267 (10%)

Query: 30  FSNFSLDKLADSLQSAAQKTQDTLSNAIQNVNIDWNDPQTRLTLLSKQHYLQESIGQINE 89
           FSNFSLDK+ +SL +AAQKT DTLSNAI        DP T+L+L S++   QESIG +++
Sbjct: 2   FSNFSLDKITNSLATAAQKTSDTLSNAITTAT----DPATKLSLRSQKRLFQESIGTVHD 57

Query: 90  ISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISEWWLNDPLAFLR 149
           IS LP QY  LE +TDALEK ++RILIV+ TFE+EGYDYPPNLSES S+WW         
Sbjct: 58  ISTLPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNLSESFSDWW--------- 108

Query: 150 XXXXXXXXXXXXXXXXXTXXXXXXXXXXXFLPRSFPHXXXXXXXXXXXXLTNLNNNE--- 206
                                        FLPRSF                ++N+ +   
Sbjct: 109 ------------SLSSKKKKEQEKEDKKGFLPRSFAQAISNSAEDCVEIYQHVNDGDDED 156

Query: 207 -KLEFAKTKTXXXXXXXXXXIQLLIKVFDSWSLCNKNIDKSKFQRDQLIIKQFNKKLTSL 265
            +      +           ++ LIK FDSW+ C KNID+ K + D +++K+FN KL  L
Sbjct: 157 KEENANNEEENEEEDEEDEDVKNLIKTFDSWAKCYKNIDQGKAEMDSMMMKEFNAKLEKL 216

Query: 266 LDVEFKNVKALRLKVQDARLKFDTMRY 292
           L+ EFK V  LR +V+D+RLKFDT+RY
Sbjct: 217 LNEEFKKVHTLRKRVKDSRLKFDTVRY 243

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 47/53 (88%)

Query: 388 FVSHTSAAVETMEEITESSKILDLIKLFQNFQLLHYQQCIKEVETNMKLLTDL 440
           FVS T++AVE MEEIT+SS+I+ L+KLFQNFQL++Y+QC++E+E N+K L +L
Sbjct: 390 FVSSTASAVEMMEEITDSSEIIGLVKLFQNFQLVYYRQCVQEIEANLKTLNEL 442

>Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar to
           Ashbya gossypii AFR309C
          Length = 393

 Score =  194 bits (494), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 110/280 (39%), Positives = 158/280 (56%), Gaps = 27/280 (9%)

Query: 26  MSGYFSNFSLDKLADSLQSAAQKTQ-------DTLSNAIQNVNIDWNDPQTRLTLLSKQH 78
           MS YFSNFSLDK+A ++ +AA KTQ       + L++AI ++N+D  DPQT L+L +++H
Sbjct: 1   MSSYFSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLD--DPQTMLSLRTRKH 58

Query: 79  YLQESIGQINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISE 138
            LQE++G I +ISKLP +Y  LERK DA EK+  RIL+V+ TFE++GYDYPPNL+ESIS+
Sbjct: 59  QLQETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISD 118

Query: 139 WWLNDP------LAFLRXXXXXXXXXXXXXXXXXTXXXXXXXXXXXFLPRSFPHXXXXXX 192
           WW +          F +                             ++P SF        
Sbjct: 119 WWGSSSKKDGVFWGFGKKSKNDKNKAEQ-------KSSAEKKSNEGYIPPSFAQAISKAA 171

Query: 193 XXXXXXLTNLNNNEKLEFAKTKTXXXXXXXXXXIQLLIKVFDSWSLCNKNIDKSKFQRDQ 252
                 L  L N E+L                 +  L+ + ++W+    NID++K Q DQ
Sbjct: 172 DDSITILKEL-NEEQL----VNPSNGAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQ 226

Query: 253 LIIKQFNKKLTSLLDVEFKNVKALRLKVQDARLKFDTMRY 292
            +I +FNKKL SL++ +F  V+ALR KV+++RLKFDT+RY
Sbjct: 227 FMINEFNKKLDSLVNNDFLKVRALRKKVEESRLKFDTLRY 266

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 42/56 (75%)

Query: 388 FVSHTSAAVETMEEITESSKILDLIKLFQNFQLLHYQQCIKEVETNMKLLTDLTHE 443
           FVS+T+ AV  M +IT+S  +  L+KLF NFQL+++++C++E++ ++ ++  LT E
Sbjct: 333 FVSNTTDAVAYMTQITDSVNLSTLVKLFHNFQLIYHKKCVQELQASLNVINTLTVE 388

>KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some
           similarites with uniprot|Q06523 Saccharomyces cerevisiae
           YPR148C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 389

 Score =  194 bits (492), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 108/283 (38%), Positives = 154/283 (54%), Gaps = 32/283 (11%)

Query: 30  FSNFSLDKLADSLQSAAQKTQDTLSNAIQNVNIDWNDPQTRLTLLSKQHYLQESIGQINE 89
           FS  SL+ + DS+ +AAQ+TQ+  S+AI+ +++D  DP+TRL++L ++H LQE++G +++
Sbjct: 2   FSKLSLNNITDSISNAAQRTQEQFSSAIEKIHLD--DPETRLSILKRRHQLQETLGTVHD 59

Query: 90  ISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISEWWLNDPLAFLR 149
           IS+LP QY  LE+K+DALEKI KR+L+VT TFE+EGYDYPPNL+ES ++WW  +  +   
Sbjct: 60  ISQLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIF- 118

Query: 150 XXXXXXXXXXXXXXXXXTXXXXXXXXXXXFLPRSFPHXXXXXXXXXXXXL-------TNL 202
                                         LPRSF              L       T  
Sbjct: 119 ---------SFSKKKAEVSPEVKETAENGLLPRSFAQALSKAATDSALILKQLKAEETRT 169

Query: 203 NNNEKLEFAKTKTXXXXXXXXXXIQL-------------LIKVFDSWSLCNKNIDKSKFQ 249
           N  E  E A  K                           LIK F+SW+ C  +ID+SK +
Sbjct: 170 NQEESQEGADQKPAEETKAEPELEAEADEDEDEDEDVDNLIKAFESWTKCQLSIDQSKAE 229

Query: 250 RDQLIIKQFNKKLTSLLDVEFKNVKALRLKVQDARLKFDTMRY 292
            D L++K+FN KL+ L++ +FK    LR KVQDARL FDT+R+
Sbjct: 230 MDSLMVKEFNAKLSKLIETDFKKGHELRAKVQDARLNFDTLRH 272

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 43/56 (76%)

Query: 388 FVSHTSAAVETMEEITESSKILDLIKLFQNFQLLHYQQCIKEVETNMKLLTDLTHE 443
           FVS TS  VE + E+T+SS+I+ L+KLF NFQL+HY+QC+K +E ++++L  L  E
Sbjct: 332 FVSATSETVEFLGELTDSSEIISLVKLFHNFQLIHYKQCVKSLEEDLEVLNSLDSE 387

>Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137
           bp, 378 aa] {ON}
           (27496..28272,28322..28330,28419..28769) [1137 nt, 379
           aa]
          Length = 378

 Score =  190 bits (482), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 111/268 (41%), Positives = 147/268 (54%), Gaps = 25/268 (9%)

Query: 30  FSNFSLDKLADSLQSAAQKTQDTLSNAIQNVNIDW----NDPQTRLTLLSKQHYLQESIG 85
           FS FS+DKL DS+ + A KTQ+ L+NA+ NVN +     NDP T+L++ SK  ++QE +G
Sbjct: 2   FSGFSIDKLTDSISNVALKTQENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKLG 61

Query: 86  QINE-ISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISEWWLNDP 144
            IN+  SKLP  Y  LE KTDA+EK +KR+L VT T+E EGYDYPPNL+ES+S+WW ND 
Sbjct: 62  TINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSDWWTND- 120

Query: 145 LAFLRXXXXXXXXXXXXXXXXXTXXXXXXXXXXXFLPRSFPHXXXXXXXXXXXXLTNLNN 204
                                             FLPRSF              + ++ N
Sbjct: 121 ----------------DNVTNTDENDENIQSNKSFLPRSFAQAISNASFDAASNVNSVTN 164

Query: 205 NEKLEFAKTKTXXXXXXXXXXIQLLIKVFDSWSLCNKNIDKSKFQRDQLIIKQFNKKLTS 264
             KL     K              L K+F+S   C +NID  K + D+LI+ +FN KL  
Sbjct: 165 TIKLNH---KDDEEEEEDDEEWSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLKD 221

Query: 265 LLDVEFKNVKALRLKVQDARLKFDTMRY 292
           L++ EFKNV  LR  V+++RLKFDTMRY
Sbjct: 222 LINTEFKNVHQLRKSVENSRLKFDTMRY 249

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 48/53 (90%)

Query: 388 FVSHTSAAVETMEEITESSKILDLIKLFQNFQLLHYQQCIKEVETNMKLLTDL 440
           FVS+T  AVE MEE+T++SKI++L+KL+QNFQL++Y+QCI+E+E+N+K+L  L
Sbjct: 324 FVSNTQNAVEKMEELTDNSKIINLVKLYQNFQLVYYKQCIQEIESNLKILNGL 376

>TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {ON}
           Anc_3.491 YPR148C
          Length = 388

 Score =  182 bits (462), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 112/283 (39%), Positives = 147/283 (51%), Gaps = 48/283 (16%)

Query: 30  FSNFSLDKLADSLQSAAQKTQDTLSNAIQNVNID----WNDPQTRLTLLSKQHYLQESIG 85
           FSNFSLDKL DS+ + A KTQ+  +NAI ++N +     NDP T+L++ ++  Y+QE +G
Sbjct: 2   FSNFSLDKLTDSISNVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQLG 61

Query: 86  QIN-EISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISEWWLNDP 144
            ++ EISKLP QY  LE KTD++EKI+KR+L+VTNTF  EGYDYPPNL+ESIS+WW  D 
Sbjct: 62  TLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWAED- 120

Query: 145 LAFLRXXXXXXXXXXXXXXXXXTXXXXXXXXXXXFLPRSFPHXXXXXXXXXXXXLTNLNN 204
                                             FLPRSF                    
Sbjct: 121 ---------------------------ETTENKNFLPRSFAQALAKAYSDSKLITDKAER 153

Query: 205 NEKLEFAKTKTXXXXX---------------XXXXXIQLLIKVFDSWSLCNKNIDKSKFQ 249
           N KL+ +   T                         +  L K F + S    NID  K +
Sbjct: 154 NIKLQTSPKNTGTKDENPEAGAEEEVEADDDEEDEDLVTLGKAFKALSNSFTNIDNGKNE 213

Query: 250 RDQLIIKQFNKKLTSLLDVEFKNVKALRLKVQDARLKFDTMRY 292
            D +I+ +FNKKL  LL+VEFK V  LR  V+++RLKFDTMRY
Sbjct: 214 MDTMIVNEFNKKLEHLLEVEFKEVAQLRRNVENSRLKFDTMRY 256

 Score = 83.2 bits (204), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 50/53 (94%)

Query: 388 FVSHTSAAVETMEEITESSKILDLIKLFQNFQLLHYQQCIKEVETNMKLLTDL 440
           FVS+TS+AVE MEE+T+S+KILDL+KLFQNFQL++Y+QC++E+E N+K ++DL
Sbjct: 332 FVSNTSSAVEKMEELTDSAKILDLVKLFQNFQLVYYRQCVQEIENNLKTISDL 384

>AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR148C
          Length = 364

 Score =  175 bits (444), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 106/277 (38%), Positives = 150/277 (54%), Gaps = 28/277 (10%)

Query: 26  MSGYFSNFSLDKLADSLQSAAQKTQDTLS-------NAIQNVNIDWNDPQTRLTLLSKQH 78
           MS YF   SLDKLA++L +AAQKTQ  LS       +AIQN+ ID  DP+T L+L +++ 
Sbjct: 1   MSAYFGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKID--DPKTILSLKTRKR 58

Query: 79  YLQESIGQINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISE 138
            LQE++G   +IS+LP QY  LERK DA+E++ K+IL+V+ TFE+EGYDYPPN +ESIS+
Sbjct: 59  QLQETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISD 118

Query: 139 WWLNDPLA---FLRXXXXXXXXXXXXXXXXXTXXXXXXXXXXXFLPRSFPHXXXXXXXXX 195
            W N       FL+                               P SF H         
Sbjct: 119 -WWNTSTKETRFLKFGKGGTDKQKEDKQKQAAGSSD---------PPSFAHALHRAAKGS 168

Query: 196 XXXLTNLNNNEKLEFAKTKTXXXXXXXXXXIQLLIKVFDSWSLCNKNIDKSKFQRDQLII 255
              +  L           +           ++ LIK+F +W+    N+D +K + DQ ++
Sbjct: 169 QGIIQELKEQ------AEEEQEQEVEIDEDVESLIKMFGTWADAQYNMDIAKREMDQFMV 222

Query: 256 KQFNKKLTSLLDVEFKNVKALRLKVQDARLKFDTMRY 292
           K+FN+KL  LL+VEFK    LR KV+++RL FDT++Y
Sbjct: 223 KEFNEKLKHLLEVEFKKGHTLRRKVEESRLTFDTLKY 259

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 43/53 (81%)

Query: 388 FVSHTSAAVETMEEITESSKILDLIKLFQNFQLLHYQQCIKEVETNMKLLTDL 440
           FVS+T+ AVE M  I +++K++ L+KLFQNFQL+++++C++E+E ++  LT L
Sbjct: 308 FVSNTAEAVEFMTSIADATKLISLVKLFQNFQLVYHRKCVQELEVSLNSLTSL 360

>KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {ON}
           Anc_3.491 YPR148C
          Length = 415

 Score =  165 bits (417), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 103/268 (38%), Positives = 142/268 (52%), Gaps = 34/268 (12%)

Query: 30  FSNFSLDKLADSLQSAAQKTQDTLSNAIQNVNIDWNDPQTRLTLLSKQHYLQESIGQI-- 87
           FSNF+ DK+ +S+ +AAQ  Q  +++ I   ++     QT+L       + QE +GQI  
Sbjct: 2   FSNFNFDKITNSISTAAQSAQQKINDTILTPDV-----QTKLHFKKTARFWQEKVGQIPD 56

Query: 88  NEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISEWWLNDPLAF 147
            EISKLP  Y  LE K DALEKI+KR+LIVT T+EIEGYDYPPNLSES+++WW +D    
Sbjct: 57  KEISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLNDWWWSD---- 112

Query: 148 LRXXXXXXXXXXXXXXXXXTXXXXXXXXXXXFLPRSFPHXXXXXXXXXXXXLTNLNNNEK 207
                                          F+  SFP             L +L   ++
Sbjct: 113 -------------------LKKSKKHQEKSSFMNNSFPMAISKAAFDSKSILDDLKEKQQ 153

Query: 208 LEFAKTKTXXXXXXXXXXIQL---LIKVFDSWSLCNKNIDKSKFQRDQLIIKQFNKKLTS 264
            +  K                   L++VF+S S C KNIDKSK + D +I+K+FN KL  
Sbjct: 154 -DLPKEGEEPEEEVEEEDDDEFLNLLEVFNSLSNCYKNIDKSKAEMDAMIVKEFNFKLEH 212

Query: 265 LLDVEFKNVKALRLKVQDARLKFDTMRY 292
           L++ +FK V  LR KVQD+RL+FDT+R+
Sbjct: 213 LINNDFKKVSKLRTKVQDSRLEFDTLRH 240

 Score = 78.2 bits (191), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 46/53 (86%)

Query: 388 FVSHTSAAVETMEEITESSKILDLIKLFQNFQLLHYQQCIKEVETNMKLLTDL 440
           FVS+T AAVE M E+TE+S++++L+KLFQNFQL+HY+QC++E+E NMK L  L
Sbjct: 362 FVSNTGAAVELMTELTETSEVINLVKLFQNFQLIHYKQCVQEIENNMKFLDQL 414

>NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa]
           {ON} Anc_3.491 YPR148C
          Length = 473

 Score =  137 bits (345), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 65/111 (58%), Positives = 86/111 (77%), Gaps = 4/111 (3%)

Query: 30  FSNFSLDKLADSLQSAAQKTQDTLSNAIQNVNIDWNDPQTRLTLLSKQHYLQESIGQINE 89
           FS+FSLDK+ +S+ +AAQK  +TL+NAI        DPQT+L++ S+    QE +G I++
Sbjct: 2   FSSFSLDKITNSIGNAAQKATNTLNNAINTAT----DPQTKLSIKSQTRLFQEQLGTIHD 57

Query: 90  ISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISEWW 140
           ISKLP QY +LE KTD+LEK IKRIL+V+ TFE+EGYDYPPNL+ES S+WW
Sbjct: 58  ISKLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWW 108

 Score = 80.1 bits (196), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 38/67 (56%), Positives = 49/67 (73%)

Query: 226 IQLLIKVFDSWSLCNKNIDKSKFQRDQLIIKQFNKKLTSLLDVEFKNVKALRLKVQDARL 285
           IQ LIK F+SWS C KNID+ K + D ++ K+FN KL  L++ EFK V  LR KV D+RL
Sbjct: 217 IQNLIKAFESWSNCYKNIDQGKSEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRL 276

Query: 286 KFDTMRY 292
           KFDT+R+
Sbjct: 277 KFDTVRH 283

 Score = 79.0 bits (193), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 35/55 (63%), Positives = 46/55 (83%)

Query: 388 FVSHTSAAVETMEEITESSKILDLIKLFQNFQLLHYQQCIKEVETNMKLLTDLTH 442
           FVS T++AVE M EITESS I+ LIKLFQNFQL++Y+QC++E+E N+K L +L H
Sbjct: 418 FVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQEIEANLKTLNELDH 472

>KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa]
           {ON} Anc_3.491 YPR148C
          Length = 452

 Score =  124 bits (312), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 59/116 (50%), Positives = 81/116 (69%), Gaps = 7/116 (6%)

Query: 30  FSNFSLDKLADSLQSAAQKTQDTLSNAIQNVNIDWNDPQTRLTLLSKQHYLQESIGQI-- 87
           FSNFSLDKL  ++ +AAQ  QDT+ N I +      D QT+L  L    Y QE +G I  
Sbjct: 2   FSNFSLDKLTSTITNAAQSAQDTIHNTILSP-----DAQTKLQFLKTTRYFQEKVGTISE 56

Query: 88  NEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISEWWLND 143
           +EI+KLP  Y  L+ K++A+EK++KR+L+VT TFE+EGYDYPPN++ES++ WW  D
Sbjct: 57  DEIAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWWNED 112

 Score = 77.8 bits (190), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 33/64 (51%), Positives = 49/64 (76%)

Query: 229 LIKVFDSWSLCNKNIDKSKFQRDQLIIKQFNKKLTSLLDVEFKNVKALRLKVQDARLKFD 288
           +I  F  WS C KNID+SK + D +I+K+FN+KLT +L+++FK V  L  +VQD+RL+FD
Sbjct: 201 MISAFGLWSNCYKNIDQSKAEMDSMIVKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFD 260

Query: 289 TMRY 292
           T+R+
Sbjct: 261 TLRH 264

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 46/56 (82%)

Query: 388 FVSHTSAAVETMEEITESSKILDLIKLFQNFQLLHYQQCIKEVETNMKLLTDLTHE 443
           FVS+ +AAVE M E+T+SS+++ L+KLFQN QL+HY+QC++E+E +MK L +L  E
Sbjct: 393 FVSNITAAVEKMTELTDSSELISLVKLFQNIQLVHYRQCVQELEASMKSLDELEAE 448

>CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148c
          Length = 385

 Score =  117 bits (293), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 71/89 (79%)

Query: 52  TLSNAIQNVNIDWNDPQTRLTLLSKQHYLQESIGQINEISKLPSQYNALERKTDALEKII 111
           ++S   Q++   +NDP+T+L++ +K  +LQE+IG   +ISKLP QY  LE+K D++EK++
Sbjct: 12  SISEGTQSLVQQFNDPKTKLSIKAKTRFLQEAIGNERDISKLPPQYVVLEKKCDSIEKVL 71

Query: 112 KRILIVTNTFEIEGYDYPPNLSESISEWW 140
           KRILIVT T+EIEGYDYPPN+SES+S WW
Sbjct: 72  KRILIVTKTYEIEGYDYPPNISESLSSWW 100

 Score = 96.3 bits (238), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 67/214 (31%), Positives = 96/214 (44%), Gaps = 16/214 (7%)

Query: 229 LIKVFDSWSLCNKNIDKSKFQRDQLIIKQFNKKLTSLLDVEFKNVKALRLKVQDARLKFD 288
           L+K+F  WS C   I  SK + DQ++IK+FN KL   L   F+ +  LR KV+++RL FD
Sbjct: 178 LVKIFKIWSDCFYEISDSKTEMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFD 237

Query: 289 TMRYXXXXXXXXXXXXXXND----KPVEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 344
           TMRY               +    KP  M                               
Sbjct: 238 TMRYEVAQTSKQTDSKELGNEDETKPSSMDANKTNTEEKEAANDKVETKEKTETNATIAD 297

Query: 345 XXXXXXXXXXXIESQKKDSPNPEFEKNDSQNXXXXX-XXXXXXXFVSHTSAAVETMEEIT 403
                         + KD+ + E  K DS+              FVS+T+ AVE M E++
Sbjct: 298 ETK-----------ETKDTKDSEDLKEDSKTSTDGQLLEQLEDEFVSNTTEAVEVMTEVS 346

Query: 404 ESSKILDLIKLFQNFQLLHYQQCIKEVETNMKLL 437
           E+S++L LIKLFQ FQL ++Q C+K +E ++K L
Sbjct: 347 ENSELLSLIKLFQTFQLSYHQHCVKSLEQSLKDL 380

>KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 302

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 68/118 (57%), Gaps = 13/118 (11%)

Query: 26  MSGYFSNFS--LDKLADSLQSAAQKTQDTLSNAIQNVNIDWNDPQTRLTLL--SKQHYLQ 81
           MS YF +FS  + +L+ S+   AQ+ Q         ++  + D +T L LL  S Q  LQ
Sbjct: 1   MSQYFDSFSKKVQELSTSVSQKAQEAQ---------LDQKFKDLKTNLPLLANSTQRMLQ 51

Query: 82  ESIGQINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISEW 139
           E +GQ+ +IS+LP +Y  LE + + ++ I +  L VT  +E E YDYP N+ ES+ E+
Sbjct: 52  EKLGQVTDISQLPDEYVQLEHRVETIKLIYENFLKVTKIYENESYDYPSNVKESVDEF 109

>TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.221
           YIL041W
          Length = 338

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 53/217 (24%), Positives = 96/217 (44%), Gaps = 28/217 (12%)

Query: 75  SKQHYLQESIGQINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSE 134
           S Q  +QE +GQ+ +IS+LP +Y  LERK D ++ I +  L VT+ +E E YDYP  ++E
Sbjct: 39  STQRLVQERLGQVTDISQLPREYLELERKVDTIKLIYENFLHVTSIYENESYDYPKYVTE 98

Query: 135 SISEWWLNDPLAFLRXXXXXXXXXXXXXXXXXTXXXXXXXXXXXFLPRSFPHXXXXXXXX 194
           S++++  +  +A                    T             PR+  +        
Sbjct: 99  SVNDF--SKIVAHKVQELSHASSASEAQNILITPTPAKE-------PRTLNYALSKVSLI 149

Query: 195 XXXXLTNLNNNEKLEFAKTKTXXXXXXXXXXIQLLIKVFDSWSLCNKNIDKSKFQRDQLI 254
               L ++ ++++ + A                +L+K  D        + +++ Q+D +I
Sbjct: 150 SSEYLNHIGDHDEAQVAS---------------VLLKYSD----LQAKVAQARLQQDTMI 190

Query: 255 IKQFNKKLTSLLDVEFKNVKALRLKVQDARLKFDTMR 291
             +FNK+L   L+  FK  +  R  V+  RL++D  R
Sbjct: 191 QTRFNKQLKDNLEHNFKKAQKARKDVEYKRLQYDVAR 227

>NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON} Anc_7.221
          Length = 364

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 42/65 (64%)

Query: 75  SKQHYLQESIGQINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSE 134
           S Q  +QE +GQ+ +IS+LP +Y  LERK D ++ +    L VTNTFE + YDYP    E
Sbjct: 42  STQRMVQERLGQVTDISQLPEEYLQLERKIDTIKSVYDNFLSVTNTFEHQSYDYPNVARE 101

Query: 135 SISEW 139
           S+ E+
Sbjct: 102 SVIEF 106

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 37/65 (56%)

Query: 227 QLLIKVFDSWSLCNKNIDKSKFQRDQLIIKQFNKKLTSLLDVEFKNVKALRLKVQDARLK 286
           +L+  +   +S     I +++ Q+D LI ++FN  L + L+  F+  + +R  VQ+ RL+
Sbjct: 175 KLVSSILLKFSDIQAKIAQARLQQDLLIKQKFNNNLRNDLNTSFERAQKVRKDVQNKRLQ 234

Query: 287 FDTMR 291
           +D  R
Sbjct: 235 YDVAR 239

>KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.221
           YIL041W
          Length = 342

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 43/63 (68%)

Query: 77  QHYLQESIGQINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESI 136
           Q  +QE +GQ+ +IS+LP +Y  LE++ DAL+ + +  L VT  +E E YDYP  + +S+
Sbjct: 41  QRLVQEKLGQVTDISQLPQEYLELEKRVDALKLVHEHFLQVTAIYENESYDYPKYVRDSV 100

Query: 137 SEW 139
           +EW
Sbjct: 101 NEW 103

>CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} similar
           to uniprot|P40531 Saccharomyces cerevisiae YIL041w
          Length = 341

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/68 (42%), Positives = 44/68 (64%)

Query: 75  SKQHYLQESIGQINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSE 134
           S Q  +QE +GQ+ +IS+LP +Y  LE K D ++ + +  L VT  +E E YDYP  +SE
Sbjct: 39  STQRMVQEKLGQVTDISQLPQEYLELENKVDTIKIVYEHFLQVTAVYENESYDYPKYVSE 98

Query: 135 SISEWWLN 142
           S++E+  N
Sbjct: 99  SVNEFSKN 106

>Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W
           (REAL)
          Length = 326

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 52/90 (57%), Gaps = 2/90 (2%)

Query: 52  TLSNAIQNVNIDWNDPQTRLTLL--SKQHYLQESIGQINEISKLPSQYNALERKTDALEK 109
           +LS  +Q ++   ++    L  L  S Q  +QE +GQ+ +IS+LP +Y  LE K D ++ 
Sbjct: 9   SLSKKLQEISTSVSEKTQELPSLAQSTQRMVQERLGQVTDISQLPREYTELEEKVDTIKL 68

Query: 110 IIKRILIVTNTFEIEGYDYPPNLSESISEW 139
           I    L VT  +E   YDYP  ++ES++E+
Sbjct: 69  IYNHFLGVTAIYENGSYDYPKYINESVNEF 98

 Score = 33.5 bits (75), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 28/65 (43%)

Query: 227 QLLIKVFDSWSLCNKNIDKSKFQRDQLIIKQFNKKLTSLLDVEFKNVKALRLKVQDARLK 286
           Q L      +S     I +++ Q+D LI  +FNK L   L  E       R  V   RL+
Sbjct: 158 QPLASALLQFSDVQAKIAQARIQQDTLIQTKFNKNLRERLSFEIGKADKTRKDVHSMRLR 217

Query: 287 FDTMR 291
           +D  R
Sbjct: 218 YDVAR 222

>KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 323

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 42/65 (64%)

Query: 75  SKQHYLQESIGQINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSE 134
           S Q  +QE +GQ+ +IS+LP +Y  LE K D +  + +  L VT  +E E YDYP N+ +
Sbjct: 58  STQRLVQEKLGQVTDISQLPQEYVELENKIDRVRLVYENFLKVTQVYENESYDYPNNVRD 117

Query: 135 SISEW 139
           S++E+
Sbjct: 118 SVNEF 122

 Score = 34.3 bits (77), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 30/56 (53%)

Query: 236 WSLCNKNIDKSKFQRDQLIIKQFNKKLTSLLDVEFKNVKALRLKVQDARLKFDTMR 291
           +S     + +++ Q+D LI  +FNKKL  +L  +    +  R  V+  RL++D  R
Sbjct: 191 YSDVQAKVAQARLQQDTLIQTRFNKKLRDILANDLNEAQKARKNVEHKRLQYDIAR 246

>Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {ON}
           YIL041W - Hypothetical ORF [contig 197] FULL
          Length = 323

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 42/65 (64%)

Query: 75  SKQHYLQESIGQINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSE 134
           S Q  +QE +GQ+ +IS+LP  Y  LE K D ++ + +  L VT  +E E YDYP N+ +
Sbjct: 58  STQRLMQEKLGQVTDISQLPQDYVELENKIDRMKLVYENFLKVTQVYENESYDYPNNVRD 117

Query: 135 SISEW 139
           S++E+
Sbjct: 118 SVNEF 122

 Score = 33.5 bits (75), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 30/56 (53%)

Query: 236 WSLCNKNIDKSKFQRDQLIIKQFNKKLTSLLDVEFKNVKALRLKVQDARLKFDTMR 291
           +S     I +++  +D LI  +FNKKL + L  +    +  R  V++ RL++D  R
Sbjct: 191 YSDVQAKIAQARLHQDTLIQTKFNKKLRAALADDLNRAQKARKNVENKRLQYDIAR 246

>SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {ON}
           highly similar to uniprot|Q75AN7 Ashbya gossypii ADL115W
           ADL115Wp and similar to YIL041W uniprot|P40531
           Saccharomyces cerevisiae YIL041W GVP36 Golgi-vesicle
           protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm
          Length = 330

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 60/122 (49%), Gaps = 15/122 (12%)

Query: 33  FSLDKLADSLQSAAQKTQDTLSNAIQNVNID-------------WNDPQTRLTLL--SKQ 77
            S +  ADSL    Q+   ++S   Q   +D               D  T L  L  S Q
Sbjct: 1   MSFNAFADSLNKKFQELSTSVSQKAQEAQLDKKFKDLSQAVSQRTQDLTTSLPSLAQSTQ 60

Query: 78  HYLQESIGQINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESIS 137
             +QE +GQ+ +IS+LP +Y  LE + D +  + +  L VT  +E E YDYP N+ +S++
Sbjct: 61  RLVQERLGQVTDISQLPQEYLELENRIDRIRLVYENFLKVTQVYEHESYDYPNNVRDSVN 120

Query: 138 EW 139
           E+
Sbjct: 121 EF 122

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%)

Query: 236 WSLCNKNIDKSKFQRDQLIIKQFNKKLTSLLDVEFKNVKALRLKVQDARLKFDTMR 291
           +S     I +++ Q+D LI  +FNKKL   L  +       R +V++ RL++D  R
Sbjct: 190 YSDVQAKIAQARLQQDTLIQTKFNKKLRETLASDLNKAVKARKEVENKRLQYDIAR 245

>YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR
           domain-containing protein that localizes to both early
           and late Golgi vesicles; required for adaptation to
           varying nutrient concentrations, fluid-phase
           endocytosis, polarization of the actin cytoskeleton, and
           vacuole biogenesis
          Length = 326

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 52/90 (57%), Gaps = 2/90 (2%)

Query: 52  TLSNAIQNVNIDWNDPQTRLTLL--SKQHYLQESIGQINEISKLPSQYNALERKTDALEK 109
           +LS  +Q ++   ++    L  L  S Q  +QE +GQ+ +IS+LP +Y  LE K D ++ 
Sbjct: 9   SLSKKLQEISTSVSEKTQELPSLAQSTQRMVQERLGQVTDISQLPREYTELEDKVDTIKL 68

Query: 110 IIKRILIVTNTFEIEGYDYPPNLSESISEW 139
           I    L VT  +E   YDYP  ++ES++E+
Sbjct: 69  IYNHFLGVTAIYENGSYDYPKYINESVNEF 98

 Score = 34.3 bits (77), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 28/65 (43%)

Query: 227 QLLIKVFDSWSLCNKNIDKSKFQRDQLIIKQFNKKLTSLLDVEFKNVKALRLKVQDARLK 286
           Q L      +S     I +++ Q+D LI  +FNK L   L  E       R  V   RL+
Sbjct: 158 QPLASALLQFSDVQAKIAQARIQQDTLIQTKFNKNLRERLSFEIGKADKCRKDVHSMRLR 217

Query: 287 FDTMR 291
           +D  R
Sbjct: 218 YDVAR 222

>Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}
           similar to Ashbya gossypii ADL115W
          Length = 333

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 58/121 (47%), Gaps = 15/121 (12%)

Query: 33  FSLDKLADSLQSAAQKTQDTLSNAIQNVNIDWNDPQTRLTLLSK---------------Q 77
            S +  AD+     Q+   ++    Q  N+D       +T+  K                
Sbjct: 1   MSFNSFADTFTKKFQEISSSVQQKAQEANLDKRFKDLSMTVTQKTQDLTSTLPSIAQTTH 60

Query: 78  HYLQESIGQINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESIS 137
             +QE +GQI +IS++P +Y  +E++ D +  I +  L VT  +E E YDYP ++SES++
Sbjct: 61  RMVQEKLGQITDISQMPEEYVHMEKRVDKIRLIYENFLKVTQIYESETYDYPQHVSESVN 120

Query: 138 E 138
           E
Sbjct: 121 E 121

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%)

Query: 236 WSLCNKNIDKSKFQRDQLIIKQFNKKLTSLLDVEFKNVKALRLKVQDARLKFDTMR 291
           +S     I +++ Q+D LI  +FNK+L   L+ EF      R +V + RL++D  R
Sbjct: 190 YSDIQAQIAQARLQQDMLIRTRFNKQLKEKLNNEFAAAARARKEVDNKRLQYDIAR 245

>Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W
           (REAL)
          Length = 329

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 41/65 (63%)

Query: 75  SKQHYLQESIGQINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSE 134
           S Q  +QE +GQ+ +IS+LP +Y  LE K D ++ I    L VT  +E   YDYP  ++E
Sbjct: 34  STQRMVQERLGQVTDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYINE 93

Query: 135 SISEW 139
           S++E+
Sbjct: 94  SVNEF 98

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 29/65 (44%)

Query: 227 QLLIKVFDSWSLCNKNIDKSKFQRDQLIIKQFNKKLTSLLDVEFKNVKALRLKVQDARLK 286
           Q L      +S     I +++ Q+D LI  +FNKKL   L  E       R  V   RL+
Sbjct: 158 QPLASALLQFSDVQAKIAQTRIQQDTLIQTKFNKKLRERLSFEIGKADKCRKDVHSMRLR 217

Query: 287 FDTMR 291
           +D  R
Sbjct: 218 YDVAR 222

>Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W
           (REAL)
          Length = 325

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 41/65 (63%)

Query: 75  SKQHYLQESIGQINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSE 134
           S Q  +QE +GQ+ +IS+LP +Y  LE K D ++ I    L VT  +E   YDYP  ++E
Sbjct: 34  STQRMVQERLGQVTDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYINE 93

Query: 135 SISEW 139
           S++E+
Sbjct: 94  SVNEF 98

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 28/56 (50%)

Query: 236 WSLCNKNIDKSKFQRDQLIIKQFNKKLTSLLDVEFKNVKALRLKVQDARLKFDTMR 291
           +S     I +++ Q+D LI  +FNKKL   +  E       R +V   RL++D  R
Sbjct: 167 FSDVQAKIAQARIQQDTLIQTKFNKKLRERVSFEIGKADKCRKEVHSMRLRYDVAR 222

>KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.221
           YIL041W
          Length = 330

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 45/65 (69%)

Query: 75  SKQHYLQESIGQINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSE 134
           S Q  +QE +GQ+ +IS+LP +Y  LE+K D+++ I +  L VT+ +E E YDYP  + +
Sbjct: 39  STQRLVQEKLGQVTDISQLPQEYLELEKKVDSIKLIHEHFLQVTSIYENESYDYPKVIKD 98

Query: 135 SISEW 139
           S++++
Sbjct: 99  SVNDF 103

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 28/56 (50%)

Query: 236 WSLCNKNIDKSKFQRDQLIIKQFNKKLTSLLDVEFKNVKALRLKVQDARLKFDTMR 291
           +S     I +++ Q+D LI  +FNK L   L          R +VQ+ RL++D  R
Sbjct: 173 FSNVQSKIAQARLQQDTLIQTKFNKALRDDLSTSLAKANKFRKEVQNKRLQYDVAR 228

>NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {ON}
           Anc_7.221
          Length = 329

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 51/217 (23%), Positives = 85/217 (39%), Gaps = 26/217 (11%)

Query: 75  SKQHYLQESIGQINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSE 134
           S Q  +QE +GQ+ +IS+LP +Y  LE K D++++I    L V++ +E + YDYP    E
Sbjct: 39  STQRMVQERLGQVTDISQLPEEYLELEMKLDSIKQIYDNFLAVSSVYEQQSYDYPYVAKE 98

Query: 135 SISEWWLNDPLAFLRXXXXXXXXXXXXXXXXXTXXXXXXXXXXXFLPRSFPHXXXXXXXX 194
           S+ E        F +                               P++           
Sbjct: 99  SLIE--------FSKTAASKVEELSHASSAHEAQNILTTSSTQIKEPKTLNFALSKVALK 150

Query: 195 XXXXLTNLNNNEKLEFAKTKTXXXXXXXXXXIQLLIKVFDSWSLCNKNIDKSKFQRDQLI 254
               L   N+NE  + + +              LL     ++S     I +++ Q+D LI
Sbjct: 151 SSEHLNQFNDNEAFKSSASA-------------LL-----NFSNIQAKIAQARLQQDLLI 192

Query: 255 IKQFNKKLTSLLDVEFKNVKALRLKVQDARLKFDTMR 291
            ++FN  L   L         +R +VQ  RL++D  R
Sbjct: 193 KQKFNDALRHDLATNIAKATKVRKEVQSKRLQYDIAR 229

>ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL041W
          Length = 333

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 58/105 (55%), Gaps = 17/105 (16%)

Query: 37  KLADSLQSAAQKTQDTLSNAIQNVNIDWNDPQTRLTLLSK--QHYLQESIGQINEISKLP 94
           KL D   S +Q+TQD  SN               L  L++  Q  +QE +GQ+ +IS++P
Sbjct: 33  KLKDLSLSVSQRTQDLTSN---------------LPSLAQTTQRRVQERLGQVTDISQMP 77

Query: 95  SQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISEW 139
            +Y  LE++ D  + I    L V+  +E E YDYP ++S+S++++
Sbjct: 78  EEYVELEQRVDRTKLIYDNFLKVSQIYESESYDYPQHISDSVNDF 122

 Score = 34.7 bits (78), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 30/56 (53%)

Query: 236 WSLCNKNIDKSKFQRDQLIIKQFNKKLTSLLDVEFKNVKALRLKVQDARLKFDTMR 291
           +S     I +++ Q+D LI  +FN++L   L+ +F      R +V   RL++D  R
Sbjct: 190 YSDVQAKIAQARLQQDTLIQTRFNRRLREKLNTQFAEAMQSRKQVDQKRLQYDIAR 245

>Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON}
           (45405..46340) [936 nt, 312 aa]
          Length = 311

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 43/65 (66%)

Query: 75  SKQHYLQESIGQINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSE 134
           S Q  +QE +G + +IS+LP +Y  LER+ D ++ + +  L +T  +E E YDYP  +S+
Sbjct: 38  STQRLVQEKLGNVTDISQLPQEYIELERQVDTIKLVYEHFLQITAIYENESYDYPKYVSD 97

Query: 135 SISEW 139
           S++++
Sbjct: 98  SVNDF 102

>TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.221
           YIL041W
          Length = 363

 Score = 55.8 bits (133), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 38/70 (54%), Gaps = 2/70 (2%)

Query: 77  QHYLQESIGQINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESI 136
           Q  ++E +GQ  +IS LP +Y  LE K D +++I +  L VT  +E E YDYP    ES 
Sbjct: 36  QRLMKEKLGQAKDISTLPQEYVELETKIDTMKEIYEHFLKVTMVYEKESYDYPKEFGESF 95

Query: 137 SEWWLNDPLA 146
             W   D + 
Sbjct: 96  --WEFTDSVG 103

>Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON}
           (67833..68885) [1053 nt, 351 aa]
          Length = 350

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 41/65 (63%)

Query: 75  SKQHYLQESIGQINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSE 134
           S    ++E +GQ+++IS LP +Y  LE K D  + + +  L +T+ +E E YDYP   SE
Sbjct: 34  STHRMVKEKLGQVDDISPLPQEYLDLELKIDTYKSVYEHFLKITSIYERESYDYPKEFSE 93

Query: 135 SISEW 139
           S++E+
Sbjct: 94  SVNEF 98

>TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7.221
           YIL041W
          Length = 331

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 5/107 (4%)

Query: 33  FSLDKLADSLQSAAQKTQDTLSNAIQNVNIDWNDPQTRLTLLSKQHYLQESIGQINEISK 92
            S + L  S+  A Q   +++S   Q +   W  P        +Q   QE +GQI +IS+
Sbjct: 1   MSFNNLKSSIGQALQGLSESVSQKTQEMASTW--PAYAQV---QQRLAQEKLGQITDISQ 55

Query: 93  LPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISEW 139
           +P +Y  LE + D L+  I+ +L VT  +E   YD+P +  ES+ +W
Sbjct: 56  MPREYIDLEDRIDNLQNSIQVLLHVTRVYEEPAYDWPYSTQESVQDW 102

>TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.221
           YIL041W
          Length = 386

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 40/60 (66%)

Query: 80  LQESIGQINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISEW 139
           +QE  GQ+ +IS LP +Y  LE++ D+++ +    L +T  +E E YDYP ++ +SI+E+
Sbjct: 1   MQEKFGQVTDISPLPQEYLDLEQQVDSIKLVYDHFLRITTVYENESYDYPKDVRDSITEF 60

>ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]
           {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 358

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 39/61 (63%)

Query: 79  YLQESIGQINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISE 138
           Y+QE +G   +IS++P +Y  L  K DA++ I    L VT  ++ E YDYP  ++ESI+E
Sbjct: 38  YMQEKLGHATDISEMPQEYIDLTTKVDAIKLIYNHFLQVTQVYDNESYDYPKYINESINE 97

Query: 139 W 139
           +
Sbjct: 98  F 98

>TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.221
           YIL041W
          Length = 305

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 44/65 (67%)

Query: 75  SKQHYLQESIGQINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSE 134
           S Q  +QE +G + +IS+LP +Y  LE++ D ++ + +  L +T+ ++ E YDYP  +S+
Sbjct: 38  STQRLVQEKLGNVTDISQLPQEYLELEKEIDTIKLVYEHFLKITSIYDNESYDYPKYVSD 97

Query: 135 SISEW 139
           S++++
Sbjct: 98  SVNDY 102

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.131    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,009,204
Number of extensions: 1127306
Number of successful extensions: 4300
Number of sequences better than 10.0: 50
Number of HSP's gapped: 4407
Number of HSP's successfully gapped: 101
Length of query: 443
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 330
Effective length of database: 40,524,141
Effective search space: 13372966530
Effective search space used: 13372966530
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)