Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0D02970singletonON31031012001e-166
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0D02970
         (310 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0D02970 Chr4 complement(722838..723770) [933 bp, 310 aa] {ON}     466   e-166

>TBLA0D02970 Chr4 complement(722838..723770) [933 bp, 310 aa] {ON} 
          Length = 310

 Score =  466 bits (1200), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 245/310 (79%), Positives = 245/310 (79%)

Query: 1   MHICIYMETFIYSTLFNPKTKGNRTRKRNGKERGRGHXXXXXXXXXXXXQFWETAGKQPG 60
           MHICIYMETFIYSTLFNPKTKGNRTRKRNGKERGRGH            QFWETAGKQPG
Sbjct: 1   MHICIYMETFIYSTLFNPKTKGNRTRKRNGKERGRGHVVRVRAPRDRPRQFWETAGKQPG 60

Query: 61  NKSAPTGQPAWPSTGATRVTCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHAPLRHAPL 120
           NKSAPTGQPAWPSTGATRVTC                              HAPLRHAPL
Sbjct: 61  NKSAPTGQPAWPSTGATRVTCRSALPRRPTATATARSRRRSALPLRYAPLRHAPLRHAPL 120

Query: 121 ASFHTKLARRSRPLAANGKQMXXXXXXXXXXXXXPMSQLHPLTAVRPAAVSVTARLRVSQ 180
           ASFHTKLARRSRPLAANGKQM             PMSQLHPLTAVRPAAVSVTARLRVSQ
Sbjct: 121 ASFHTKLARRSRPLAANGKQMASRATSATASISIPMSQLHPLTAVRPAAVSVTARLRVSQ 180

Query: 181 TGSPRGIPFGHRPVRVSSSPSTFAASGNPGQHFACPFGPPPTHLRIALRPPLRVRAYAHA 240
           TGSPRGIPFGHRPVRVSSSPSTFAASGNPGQHFACPFGPPPTHLRIALRPPLRVRAYAHA
Sbjct: 181 TGSPRGIPFGHRPVRVSSSPSTFAASGNPGQHFACPFGPPPTHLRIALRPPLRVRAYAHA 240

Query: 241 RTHTPARTPARHGPAAAALTLPHRATVSFPEAATRQHTXXXXXXXXXXVRTHISQSGNRT 300
           RTHTPARTPARHGPAAAALTLPHRATVSFPEAATRQHT          VRTHISQSGNRT
Sbjct: 241 RTHTPARTPARHGPAAAALTLPHRATVSFPEAATRQHTRPPPARLLLRVRTHISQSGNRT 300

Query: 301 SCFRCACGPV 310
           SCFRCACGPV
Sbjct: 301 SCFRCACGPV 310

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.131    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,170,471
Number of extensions: 780545
Number of successful extensions: 1649
Number of sequences better than 10.0: 9
Number of HSP's gapped: 1676
Number of HSP's successfully gapped: 9
Length of query: 310
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 201
Effective length of database: 40,982,805
Effective search space: 8237543805
Effective search space used: 8237543805
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 65 (29.6 bits)