Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0D029603.493ON1891898521e-117
Kpol_1017.63.493ON1871494675e-59
YPR149W (NCE102)3.493ON1731444604e-58
TBLA0C044903.493ON1861414562e-57
Smik_16.4023.493ON1731444482e-56
CAGL0L08448g3.493ON1731494456e-56
CAGL0I10494g3.493ON1721474412e-55
ZYRO0D09966g3.493ON1781274404e-55
TPHA0D032803.493ON1841494353e-54
Skud_16.4443.493ON1731444292e-53
TDEL0D056103.493ON1751494266e-53
KNAG0B008003.493ON1821434251e-52
NDAI0G009303.493ON1761464188e-52
Smik_6.2273.493ON1741434171e-51
Suva_7.4193.493ON1741444144e-51
NDAI0B058803.493ON1821434128e-51
YGR131W (FHN1)3.493ON1741424119e-51
KNAG0A079503.493ON1821494129e-51
KAFR0C019703.493ON1791484083e-50
SAKL0F02750g3.493ON1701454032e-49
KAFR0G037003.493ON1861394023e-49
Suva_16.4783.493ON1661443925e-48
NCAS0E008003.493ON1741453813e-46
KLLA0D16280g3.493ON1691493711e-44
NCAS0F035603.493ON1831463684e-44
Skud_7.4423.493ON1741443571e-42
KLTH0F14850g3.493ON1711453353e-39
Kwal_55.212383.493ON1701493111e-35
AFR312W3.493ON1681242729e-30
Ecym_12363.493ON1691242352e-24
TBLA0B006702.61ON282113760.17
Suva_4.272.61ON32267720.60
TPHA0F023902.61ON294141710.73
KNAG0L023302.61ON305139691.2
NCAS0D003402.61ON333159691.2
NDAI0H038002.61ON354160672.3
KAFR0A080202.8ON97784672.8
ABL202W2.8ON93880646.9
YDL218W2.61ON31767638.2
KLTH0B07326g2.61ON30733638.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0D02960
         (189 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON...   332   e-117
Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}...   184   5e-59
YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Prot...   181   4e-58
TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3....   180   2e-57
Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W...   177   2e-56
CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {...   176   6e-56
CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa] ...   174   2e-55
ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly ...   174   4e-55
TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.49...   172   3e-54
Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W...   169   2e-53
TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3....   168   6e-53
KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON...   168   1e-52
NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON...   165   8e-52
Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W (...   165   1e-51
Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W (...   164   4e-51
NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3....   163   8e-51
YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein...   162   9e-51
KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3....   163   9e-51
KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.49...   161   3e-50
SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {O...   159   2e-49
KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.49...   159   3e-49
Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W...   155   5e-48
NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON...   151   3e-46
KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} simil...   147   1e-44
NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.49...   146   4e-44
Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W (...   142   1e-42
KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} simil...   133   3e-39
Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W...   124   1e-35
AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic h...   109   9e-30
Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON} ...    95   2e-24
TBLA0B00670 Chr2 (141759..142607) [849 bp, 282 aa] {ON} Anc_2.61...    34   0.17 
Suva_4.27 Chr4 (54848..55816) [969 bp, 322 aa] {ON} YDL218W (REAL)     32   0.60 
TPHA0F02390 Chr6 complement(527739..528623) [885 bp, 294 aa] {ON...    32   0.73 
KNAG0L02330 Chr12 complement(413866..414783) [918 bp, 305 aa] {O...    31   1.2  
NCAS0D00340 Chr4 (50708..51709) [1002 bp, 333 aa] {ON} Anc_2.61        31   1.2  
NDAI0H03800 Chr8 complement(928498..929562) [1065 bp, 354 aa] {O...    30   2.3  
KAFR0A08020 Chr1 complement(1604597..1607530) [2934 bp, 977 aa] ...    30   2.8  
ABL202W Chr2 (28894..31710) [2817 bp, 938 aa] {ON} Syntenic homo...    29   6.9  
YDL218W Chr4 (66493..67446) [954 bp, 317 aa] {ON} Putative prote...    29   8.2  
KLTH0B07326g Chr2 complement(591369..592292) [924 bp, 307 aa] {O...    29   8.7  

>TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON}
           Anc_3.493 YPR149W
          Length = 189

 Score =  332 bits (852), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 166/189 (87%), Positives = 166/189 (87%)

Query: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60
           MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA
Sbjct: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60

Query: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120
           NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR
Sbjct: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120

Query: 121 EAQACIAFFYFSMFLFLVKVLITLVTYFTXXXXXXXXXXXXXXXXXXXXXXXTRAPPQMN 180
           EAQACIAFFYFSMFLFLVKVLITLVTYFT                       TRAPPQMN
Sbjct: 121 EAQACIAFFYFSMFLFLVKVLITLVTYFTGGELGQTGYGGGYGGRSFGRRPRTRAPPQMN 180

Query: 181 KGGISISQV 189
           KGGISISQV
Sbjct: 181 KGGISISQV 189

>Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}
           complement(22157..22720) [564 nt, 188 aa]
          Length = 187

 Score =  184 bits (467), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 116/149 (77%), Gaps = 1/149 (0%)

Query: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60
           ML L DN+ R  NFCFFVI  G+IG+LL TE GH SSRVNYCMF P + +V+DSFYGILA
Sbjct: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKGH-SSRVNYCMFVPPFAVVTDSFYGILA 59

Query: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120
           N+   PFA+P ILFAFDFLNF FTFTAGTVL+VGIRTHSC N+ Y   N IIQGS  RCR
Sbjct: 60  NIWTTPFAWPIILFAFDFLNFAFTFTAGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCR 119

Query: 121 EAQACIAFFYFSMFLFLVKVLITLVTYFT 149
           +AQA IAFFYFS F+F VKV+++ +   +
Sbjct: 120 KAQASIAFFYFSFFIFFVKVVMSAINLLS 148

>YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Protein
           of unknown function; contains transmembrane domains;
           involved in secretion of proteins that lack classical
           secretory signal sequences; component of the
           detergent-insoluble glycolipid-enriched complexes (DIGs)
          Length = 173

 Score =  181 bits (460), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 88/144 (61%), Positives = 106/144 (73%), Gaps = 2/144 (1%)

Query: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60
           ML L DN+ RI NF F VI+ G+I +LLNT+H  HSSRVNYCMF  A+G+ +DS YG+ A
Sbjct: 1   MLALADNILRIINFLFLVISIGLISSLLNTQH-RHSSRVNYCMFACAYGIFTDSLYGVFA 59

Query: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120
           N + EP A+P +LF  DFLNFVFTFTAGTVLAVGIR HSC N  Y   N I QGS  RCR
Sbjct: 60  NFI-EPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCR 118

Query: 121 EAQACIAFFYFSMFLFLVKVLITL 144
           +AQA +AF YFS  +FL K L+++
Sbjct: 119 QAQAAVAFLYFSCAIFLAKTLMSV 142

>TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  180 bits (456), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 103/141 (73%)

Query: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60
           ML    NV RI NFCF VI  GMIG L+ +E   HS RVNYCMF   + LV+DSFY I A
Sbjct: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60

Query: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120
           N  P PFA+P +L++FDFLNF FTFTAGTVL+VGIRTHSC NK Y   N I QGS  RCR
Sbjct: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120

Query: 121 EAQACIAFFYFSMFLFLVKVL 141
            AQA IAF+YFS F++LV+++
Sbjct: 121 LAQASIAFYYFSFFIYLVQLV 141

>Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  177 bits (448), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 86/144 (59%), Positives = 104/144 (72%), Gaps = 2/144 (1%)

Query: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60
           ML L DN+ RI NF F VI+  +I +LLNT+   HSSRVNYCMF  A+G+ +DS YG+ A
Sbjct: 1   MLALADNILRIINFLFLVISIALISSLLNTQD-KHSSRVNYCMFACAYGIFTDSLYGVFA 59

Query: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120
           N + EP A+P +LF  DFLNFVFTFTAGTVLAVGIR HSC N  Y   N I QGS  RCR
Sbjct: 60  NFI-EPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCR 118

Query: 121 EAQACIAFFYFSMFLFLVKVLITL 144
           +AQA +AF YFS  +FL K L+++
Sbjct: 119 QAQAAVAFLYFSCAIFLAKTLMSI 142

>CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {ON}
           highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 173

 Score =  176 bits (445), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 86/149 (57%), Positives = 106/149 (71%), Gaps = 2/149 (1%)

Query: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60
           ML + DN+ RI NF F VI  G+I +L+ T    HSSRVNYCMF  A+G+ +DS YG+ A
Sbjct: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRD-RHSSRVNYCMFAAAYGIATDSLYGVFA 59

Query: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120
           N   E  A+P ILF  DFLNF F  TAG VLAVGIR HSC N  YR  N IIQGSERRCR
Sbjct: 60  NFF-EILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCR 118

Query: 121 EAQACIAFFYFSMFLFLVKVLITLVTYFT 149
           E+QA +AFF+FSM +FL K++++L+  F+
Sbjct: 119 ESQAAVAFFFFSMAIFLAKMIMSLLNIFS 147

>CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa]
           {ON} highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w NCE2 or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 172

 Score =  174 bits (441), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 85/147 (57%), Positives = 108/147 (73%), Gaps = 3/147 (2%)

Query: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60
           ML + DN+ RI N  F +I  G+  +L+NT    HSSRVN+C+F  A+G+ +DS YGI A
Sbjct: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRK-RHSSRVNFCLFAAAYGIATDSLYGIFA 59

Query: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEY-RRENYIIQGSERRC 119
           N   EP A+P +LF  DFLNFVFTFTAGTVLAVGIR HSC NK Y  RE  I+QGS  RC
Sbjct: 60  NFF-EPLAWPLVLFVLDFLNFVFTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRC 118

Query: 120 REAQACIAFFYFSMFLFLVKVLITLVT 146
           R+AQA +AFFYFSM +FL K+++++V+
Sbjct: 119 RQAQALVAFFYFSMAIFLAKMIMSIVS 145

>ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 178

 Score =  174 bits (440), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 96/127 (75%), Gaps = 1/127 (0%)

Query: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60
           ML L DN+ R  NFCFFVI  G++G L+ +E   H+SRVN+CMF  A+G+V+DSFYGILA
Sbjct: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60

Query: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120
           N+   PFAFP ILF  DFLNFVFTFTA T LAVGIRTHSCTN+ Y   N I QGS  RCR
Sbjct: 61  NIFV-PFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCR 119

Query: 121 EAQACIA 127
           EAQA +A
Sbjct: 120 EAQAVVA 126

>TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.493
           YPR149W
          Length = 184

 Score =  172 bits (435), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 92/149 (61%), Positives = 112/149 (75%), Gaps = 1/149 (0%)

Query: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60
           ML L DN+ R  NFCFFVI  G++G+LL T++  HSSRVNYC+F P + LV+D+FYG LA
Sbjct: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQN-QHSSRVNYCIFVPPFALVTDTFYGALA 59

Query: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120
           N+   P A+P ILF FDFLNF FTFTAGTVLAVG RTHSCTN+ Y   N I QGS  RCR
Sbjct: 60  NIWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCR 119

Query: 121 EAQACIAFFYFSMFLFLVKVLITLVTYFT 149
           +AQA  AFFYFS F+FL K++++ +  FT
Sbjct: 120 KAQAATAFFYFSFFIFLAKLIMSSINLFT 148

>Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  169 bits (429), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 103/144 (71%), Gaps = 2/144 (1%)

Query: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60
           ML   DN+ RI NF F VI  G+I +LLNT+   +SSRVN+CMF  A+G+ +DS YG+ A
Sbjct: 1   MLAPADNILRIINFLFLVIVIGLISSLLNTQD-RNSSRVNFCMFAAAYGIFTDSLYGVFA 59

Query: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120
           N   EP A+P +LF  DFLNFVFTFTAGTVLAVGIR HSC N+ Y   N I QGS  RCR
Sbjct: 60  NFF-EPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNRSYVDSNGITQGSGTRCR 118

Query: 121 EAQACIAFFYFSMFLFLVKVLITL 144
           +AQA +AF YFS  +FL K L+++
Sbjct: 119 QAQAAVAFLYFSCAIFLAKTLMSV 142

>TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3.493
           YPR149W
          Length = 175

 Score =  168 bits (426), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 89/149 (59%), Positives = 113/149 (75%), Gaps = 2/149 (1%)

Query: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60
           ML + DN  R+ NF F VI  G++G L+++E GH SSRVN+CMF  A+G+V+DSFYGILA
Sbjct: 1   MLAIVDNALRLVNFAFLVILLGLVGELISSEDGH-SSRVNFCMFAAAFGIVTDSFYGILA 59

Query: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120
           N + E FA+P ILFA DFLNF FTF+A T LAVGIRTHSC N++Y   N I QGS +RCR
Sbjct: 60  N-IWEVFAWPVILFALDFLNFAFTFSAATALAVGIRTHSCKNQDYLDSNNITQGSTQRCR 118

Query: 121 EAQACIAFFYFSMFLFLVKVLITLVTYFT 149
            AQA +AFFYFS F+FL K++++L+   T
Sbjct: 119 LAQASVAFFYFSFFIFLAKMIMSLIGIIT 147

>KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON}
           Anc_3.493 YPR149W
          Length = 182

 Score =  168 bits (425), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 101/143 (70%), Gaps = 2/143 (1%)

Query: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60
           ML + DN+ R+ NFCF VI    I  L+NT+   H SRVNYCMF  A+G+ +D  YG+LA
Sbjct: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQK-FHISRVNYCMFAAAYGIATDGLYGLLA 59

Query: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120
           N   EP A+P ILF  DFLNF FT TAG VLAVGIR HSC N  YR  N+IIQGSE RCR
Sbjct: 60  NFW-EPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCR 118

Query: 121 EAQACIAFFYFSMFLFLVKVLIT 143
            +QA  AFF+FSM +F+ K++++
Sbjct: 119 ISQAATAFFFFSMGIFIAKMVMS 141

>NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON}
           Anc_3.493 YGR131W
          Length = 176

 Score =  165 bits (418), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 105/146 (71%), Gaps = 2/146 (1%)

Query: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60
           ML + DN+ R+ N  F VI  G+   LLNT+ GH+S R+NYCMF   + L++DSF+GILA
Sbjct: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQGHNS-RINYCMFTCVYCLLTDSFFGILA 59

Query: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120
           N   E  +FP ILF  DFLNF FTF AGTVLA GIR+HSC N+ Y   N I QGS  RCR
Sbjct: 60  NFF-EFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCR 118

Query: 121 EAQACIAFFYFSMFLFLVKVLITLVT 146
           E+QA +AFFYFSMF+FL+K+ ++ ++
Sbjct: 119 ESQALVAFFYFSMFIFLIKLAMSTIS 144

>Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  165 bits (417), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 97/143 (67%), Gaps = 2/143 (1%)

Query: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60
           ML   DN+ RI N  F +I+ G+I  L++T+   HSSRVN+CMF  A+GLV+DS YG LA
Sbjct: 1   MLSAADNLIRIINAVFLIISIGLISGLISTQ-AKHSSRVNFCMFTAAYGLVTDSLYGFLA 59

Query: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120
           N       +P IL A D LNF+FTF A T LAVGIR HSC NK Y  +N I Q S  RC 
Sbjct: 60  NF-WSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCH 118

Query: 121 EAQACIAFFYFSMFLFLVKVLIT 143
           ++QA +AFFYFS FLFL+KV +T
Sbjct: 119 QSQAAVAFFYFSCFLFLIKVTVT 141

>Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  164 bits (414), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 103/144 (71%), Gaps = 2/144 (1%)

Query: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60
           ML + DN+ RI N  F +I+ G++  L++++   HSSRVN+CMF  A+GL++DSFYG LA
Sbjct: 1   MLSVADNIVRIINAIFLIISIGLVSGLISSQT-KHSSRVNFCMFAAAYGLLTDSFYGCLA 59

Query: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120
           NL      +P I+F  DFLNF+FTF AGT LAVGIR HSC+NK Y   N I QGS  RC 
Sbjct: 60  NL-WSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCH 118

Query: 121 EAQACIAFFYFSMFLFLVKVLITL 144
           +A+A + FFYFS  LFL+KV++++
Sbjct: 119 QAKAAVVFFYFSCILFLIKVVVSI 142

>NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3.493
           YGR131W
          Length = 182

 Score =  163 bits (412), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 78/143 (54%), Positives = 103/143 (72%), Gaps = 1/143 (0%)

Query: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60
           ML   DN+ R+ N  F V+T   I  LLNT+  ++SSR+N+CMF  A+GL++DSF+G+  
Sbjct: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQR-NNSSRINFCMFAAAFGLLTDSFFGVAF 59

Query: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120
           N+     ++P +LF FDFLNFVFTFTAGTVLAV IR HSC N+ Y   N I QGSE RCR
Sbjct: 60  NMFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCR 119

Query: 121 EAQACIAFFYFSMFLFLVKVLIT 143
            +QA +AFFYFS F+FL K++++
Sbjct: 120 MSQAAVAFFYFSCFIFLAKMIMS 142

>YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein of
           unknown function; induced by ketoconazole; promoter
           region contains sterol regulatory element motif, which
           has been identified as a Upc2p-binding site;
           overexpression complements function of Nce102p in NCE102
           deletion strain
          Length = 174

 Score =  162 bits (411), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 79/142 (55%), Positives = 96/142 (67%), Gaps = 2/142 (1%)

Query: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60
           ML   DN+ RI N  F +I+ G+I  L+ T+   HSSRVN+CMF   +GLV+DS YG LA
Sbjct: 1   MLSAADNLVRIINAVFLIISIGLISGLIGTQT-KHSSRVNFCMFAAVYGLVTDSLYGFLA 59

Query: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120
           N       +P IL   DFLNF+FTF A T LAVGIR HSC NK Y  +N IIQGS  RC 
Sbjct: 60  NF-WTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCH 118

Query: 121 EAQACIAFFYFSMFLFLVKVLI 142
           ++QA +AFFYFS FLFL+KV +
Sbjct: 119 QSQAAVAFFYFSCFLFLIKVTV 140

>KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3.493
           YPR149W
          Length = 182

 Score =  163 bits (412), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 111/149 (74%), Gaps = 2/149 (1%)

Query: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60
           ML L D   R+ NF F VI  G+I  LLNT+HGH SSR+NYCMF  A+G+ +DSFYG++A
Sbjct: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQHGH-SSRINYCMFTAAYGITTDSFYGVVA 59

Query: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120
           N   EP ++P +L A DFLNFVFT TAG VLAVGIR HSC N  YR +N I+QGSE RCR
Sbjct: 60  NFW-EPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCR 118

Query: 121 EAQACIAFFYFSMFLFLVKVLITLVTYFT 149
           +AQA +AFF+FSM +FL K +++LV  FT
Sbjct: 119 QAQAAVAFFFFSMAIFLAKFIMSLVNIFT 147

>KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.493
           YPR149W
          Length = 179

 Score =  161 bits (408), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 102/148 (68%), Gaps = 1/148 (0%)

Query: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60
           ML + DN+ R+ N  F +I   +   L+NT++GHH+SRVNYCMF  A+GL  DS YGI A
Sbjct: 1   MLGVADNILRLINAVFLIIAIALTSALINTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60

Query: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120
           N   +  A+P +LF  DFLNF FTF+A T LAVGIR HSC N+ Y   N I++GS +RCR
Sbjct: 61  NFF-QVLAWPLLLFTLDFLNFAFTFSAATALAVGIRAHSCGNQSYLDSNKIVRGSGQRCR 119

Query: 121 EAQACIAFFYFSMFLFLVKVLITLVTYF 148
           EAQA +AF YFS  +F+ K++++ +  F
Sbjct: 120 EAQALVAFLYFSTAIFIAKMIMSCINLF 147

>SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {ON}
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 170

 Score =  159 bits (403), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 78/145 (53%), Positives = 103/145 (71%), Gaps = 2/145 (1%)

Query: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60
           ML + DN  R+ NF F VI  G+ G+L+ T+   HS RVN+ +F  A+ LV+DSFY + A
Sbjct: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQD-EHSPRVNFAIFTAAFALVTDSFYAVFA 59

Query: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120
           NL    FA+P +L  +DFLNFVFTF+A T LAVGIRTHSCTN+ Y   N I QGS  RCR
Sbjct: 60  NLF-SAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCR 118

Query: 121 EAQACIAFFYFSMFLFLVKVLITLV 145
           +AQA +AF YFS F+FL K++++++
Sbjct: 119 KAQATVAFLYFSFFIFLTKLVLSVI 143

>KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  159 bits (402), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 104/139 (74%), Gaps = 1/139 (0%)

Query: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60
           ML + DN  R+ NFCF VIT   I  LLNT  GH+S+RVNYCMF  A+G+++DS YG+ A
Sbjct: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60

Query: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120
           N   E  A+P ILF FDFLNFVF FTAGTVLAVGIR H+C N+ YR  N I++GSE RCR
Sbjct: 61  NFF-EQLAWPIILFVFDFLNFVFFFTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCR 119

Query: 121 EAQACIAFFYFSMFLFLVK 139
            AQA +AFFYFSM +FLVK
Sbjct: 120 VAQAAVAFFYFSMAIFLVK 138

>Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W
           (REAL)
          Length = 166

 Score =  155 bits (392), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 80/144 (55%), Positives = 99/144 (68%), Gaps = 9/144 (6%)

Query: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60
           ML   DN+ RI NF F VI+ G+I +LLNT+ G+ SSR+NYCMF  A+ +V+DS YG+ A
Sbjct: 1   MLAPVDNILRIINFLFLVISIGLISSLLNTQSGN-SSRINYCMFAVAYAIVTDSLYGVFA 59

Query: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120
           N   EP A+P ILF+ DFLNFVFTFTA       IR HSC N+ Y   N I QGS  RCR
Sbjct: 60  NFF-EPLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCR 111

Query: 121 EAQACIAFFYFSMFLFLVKVLITL 144
           EAQA +AF YFS  +FL K L+++
Sbjct: 112 EAQAAVAFLYFSCAIFLAKTLMSV 135

>NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON}
           Anc_3.493 YGR131W
          Length = 174

 Score =  151 bits (381), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 98/145 (67%), Gaps = 2/145 (1%)

Query: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60
           ML + DN+ RI N  F VI  G+   LLNT+  H++SR+NYCMF  A+ L +DS YGI A
Sbjct: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTK-THNNSRINYCMFTCAYCLTTDSIYGIFA 59

Query: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120
           N   +  A P + F  DFLNF FTF AGTVLA GIR HSC ++ Y   N I QG + RCR
Sbjct: 60  NFF-DILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCR 118

Query: 121 EAQACIAFFYFSMFLFLVKVLITLV 145
           E+QA +AFFYFSM +FL K++++ +
Sbjct: 119 ESQALVAFFYFSMAIFLAKLIMSTI 143

>KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 169

 Score =  147 bits (371), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 98/149 (65%), Gaps = 2/149 (1%)

Query: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60
           ML + DN  R  NF F +I  G++GNL+ T+  H SSRVN+ +F   +G+V DS Y ++A
Sbjct: 1   MLSILDNSLRGVNFVFLIIVLGLVGNLIATQD-HSSSRVNFAIFAAVFGIVFDSLYALIA 59

Query: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120
           N +    A+P IL + DFLN+VFTF+A T LAVGIR  SCTN  +   N I +GS+ RCR
Sbjct: 60  NFI-SALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCR 118

Query: 121 EAQACIAFFYFSMFLFLVKVLITLVTYFT 149
           +AQA   F YFS  +FLVK ++++V   T
Sbjct: 119 KAQASTVFLYFSFAIFLVKFILSIVNAIT 147

>NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.493
           YGR131W
          Length = 183

 Score =  146 bits (368), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 83/146 (56%), Positives = 106/146 (72%), Gaps = 1/146 (0%)

Query: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60
           ML   DN  R FN  F V+    I  LL+T++ H SSRVNYCMF  A+GL++DSF+G+ A
Sbjct: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQN-HGSSRVNYCMFAAAFGLLTDSFFGMAA 59

Query: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120
           NL+    ++P ILF FDFLNFVFTFTAGTVLAVGIR HSC N+ Y   N IIQGS  RCR
Sbjct: 60  NLIDFLSSWPIILFVFDFLNFVFTFTAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCR 119

Query: 121 EAQACIAFFYFSMFLFLVKVLITLVT 146
            +QA +AFFYF+ F+FL K++++ ++
Sbjct: 120 VSQAAVAFFYFAAFVFLAKMIMSAIS 145

>Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  142 bits (357), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 100/144 (69%), Gaps = 2/144 (1%)

Query: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60
           ML   DN+ RI +  F +I+ G+IG L+ T+  + SSRVN+CMF  A+GL++DSFYG LA
Sbjct: 1   MLSAADNLIRIVSAVFLIISIGLIGGLMGTQT-NGSSRVNFCMFAAAYGLITDSFYGFLA 59

Query: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120
           N       +P IL   DFLNF+FTF A T LAVGIR HSC NK Y  +N I QGS  RC 
Sbjct: 60  NF-WSSLTYPAILLVLDFLNFLFTFAAATALAVGIRCHSCKNKTYLEQNNITQGSSSRCH 118

Query: 121 EAQACIAFFYFSMFLFLVKVLITL 144
           ++QA +AFFYFS FLFL+KV +++
Sbjct: 119 QSQAAVAFFYFSCFLFLIKVTVSV 142

>KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 171

 Score =  133 bits (335), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 75/145 (51%), Positives = 97/145 (66%), Gaps = 1/145 (0%)

Query: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60
           ML + DN  R  NF F VI  G+ G+L  T   H++ +VN+ +F  A+GL+ DS Y I A
Sbjct: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60

Query: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120
           N V    A+P ++  FDFLNFVFTF A T LAV IRTHSCTN++Y   N + QGS  RCR
Sbjct: 61  NFV-SALAWPLLIAVFDFLNFVFTFAAATALAVAIRTHSCTNQDYLDSNTVTQGSTDRCR 119

Query: 121 EAQACIAFFYFSMFLFLVKVLITLV 145
           +AQA +AF YFS F+FL K+ ++LV
Sbjct: 120 KAQASVAFLYFSFFIFLAKLGLSLV 144

>Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W
           (NCE102) - Involved in secretion of proteins that lack
           classical secretory signal sequences [contig 130] FULL
          Length = 170

 Score =  124 bits (311), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 71/149 (47%), Positives = 98/149 (65%), Gaps = 2/149 (1%)

Query: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60
           ML + DN  R  NF F +I  G+ G+L  T   +++ +VN+ +F  A+GL+ D+ Y I A
Sbjct: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAATRD-NNNPQVNFAVFAAAFGLLFDTLYAIPA 59

Query: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120
           N +    A+P ++  FDFLNFVFTF A T LAV IR HSCTN +Y   N + QGS  RCR
Sbjct: 60  NFI-SALAWPLLIAVFDFLNFVFTFAAATALAVAIRVHSCTNSDYVDNNKVTQGSSDRCR 118

Query: 121 EAQACIAFFYFSMFLFLVKVLITLVTYFT 149
           +AQA +AF YF+ F+FLVK+ ++LV  F+
Sbjct: 119 KAQASVAFLYFAFFVFLVKLALSLVNVFS 147

>AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR149W (NCE102) and
           YGR131W
          Length = 168

 Score =  109 bits (272), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 54/124 (43%), Positives = 74/124 (59%), Gaps = 2/124 (1%)

Query: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60
           ML + DN  R  NF F +I  G+ G+L++ +   HS RVN+ +F   + LV+DSFY I+A
Sbjct: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHS-RVNFGLFTAVFALVTDSFYSIVA 59

Query: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120
           N +   FA+P I  A D LN +FTF A T L   I  HSC+N+ +   N I + S  RCR
Sbjct: 60  NFI-SAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCR 118

Query: 121 EAQA 124
           + QA
Sbjct: 119 KVQA 122

>Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON}
           similar to Ashbya gossypii AFR312W
          Length = 169

 Score = 95.1 bits (235), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 52/124 (41%), Positives = 72/124 (58%), Gaps = 2/124 (1%)

Query: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60
           ML + DN  R  NF F +I   + G+L+N ++  HS RVN+ +F   + L+ DS Y +LA
Sbjct: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHS-RVNFGLFTAIFALLFDSLYSVLA 59

Query: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120
           N +    A+P +L   D LN +FTF A T L   I  HSC+N  + R N I +G E RCR
Sbjct: 60  NFI-SALAWPILLITTDVLNLIFTFAAATALGAAIGPHSCSNSGFLRGNDISEGREGRCR 118

Query: 121 EAQA 124
           + QA
Sbjct: 119 KVQA 122

>TBLA0B00670 Chr2 (141759..142607) [849 bp, 282 aa] {ON} Anc_2.61
           YDL218W
          Length = 282

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 48/113 (42%), Gaps = 2/113 (1%)

Query: 9   FRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILANLVPEPFA 68
            R + FC  V+   ++   ++  H H S R N+ +   A G     F  +L  +VP    
Sbjct: 13  LRFWEFCSSVLVMSLLAAAMSESHFHGSKRFNFSLAQGAIGTCYSLFVILLPPIVPG-LV 71

Query: 69  FPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCRE 121
           F    F ++ +  +       V+A  +  HSC NK  +  N    GS+ R +E
Sbjct: 72  FAGFYFCWEVIMNLLWLCCFIVVAKVVGEHSCHNKFTKTYNPKY-GSQTRYQE 123

>Suva_4.27 Chr4 (54848..55816) [969 bp, 322 aa] {ON} YDL218W (REAL)
          Length = 322

 Score = 32.3 bits (72), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 26/67 (38%), Gaps = 7/67 (10%)

Query: 90  VLAVGIRTHSCTNKEYRRE-------NYIIQGSERRCREAQACIAFFYFSMFLFLVKVLI 142
           VLA     HSC ++    E        Y      R C  +QA IAF      LFL  V++
Sbjct: 92  VLAKAQGQHSCKSRNSSGEYYDPYSGQYTTTNHRRACNSSQAAIAFAGLCFLLFLTSVVL 151

Query: 143 TLVTYFT 149
             V   T
Sbjct: 152 LGVNILT 158

>TPHA0F02390 Chr6 complement(527739..528623) [885 bp, 294 aa] {ON}
           Anc_2.61 YDL218W
          Length = 294

 Score = 32.0 bits (71), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 31/141 (21%), Positives = 53/141 (37%), Gaps = 30/141 (21%)

Query: 31  EHGHHSSRVNYCMFPPAWGLVSDSFYGILA----NLVPEPFAFPPILFAFDFLNFVFTFT 86
           E G H S+         W LV   F+ +LA    +LV        +L   +F+      +
Sbjct: 36  EFGFHGSK----KLTTGWLLVLSRFFILLAVIIGSLVTPGLVMAGLLLIGEFIMAGLWIS 91

Query: 87  AGTVLAVGIRTHSCTNKEYRREN----------------------YIIQGSERRCREAQA 124
           A  V+A  +  + C+NK+    N                      Y  Q S R C   + 
Sbjct: 92  AFIVIADSVGKNGCSNKQSSTYNPNYGSMGDYGMSGGTYNEFTGQYGNQSSGRACNSIKT 151

Query: 125 CIAFFYFSMFLFLVKVLITLV 145
            +AF   +  LF++ +++ +V
Sbjct: 152 SVAFAGLAAVLFIISLILVIV 172

>KNAG0L02330 Chr12 complement(413866..414783) [918 bp, 305 aa] {ON}
           Anc_2.61 YDL218W
          Length = 305

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 30/139 (21%), Positives = 59/139 (42%), Gaps = 5/139 (3%)

Query: 8   VFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILANLVPEPF 67
           + R   FC  V+   ++   LN+ +   S R N+C+     G        +L  L+P+  
Sbjct: 38  ILRFLQFCSAVLVMSLLAYSLNSYNFFGSKRANFCLSVGVIGTFYIMCVIVLVWLMPKVV 97

Query: 68  AFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYI----IQGSERRCREAQ 123
              P L   + +  +       V A    +HSC++  +  + ++        +R C+ A+
Sbjct: 98  LVGPYLI-MEIVICLLWLCGFIVSAKVFGSHSCSSNGFSYDPFVGRITDHSHKRACQAAK 156

Query: 124 ACIAFFYFSMFLFLVKVLI 142
           + IAF  FS  L ++  ++
Sbjct: 157 SSIAFSGFSFVLGVITSIL 175

>NCAS0D00340 Chr4 (50708..51709) [1002 bp, 333 aa] {ON} Anc_2.61
          Length = 333

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 64/159 (40%), Gaps = 29/159 (18%)

Query: 8   VFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFY---GILANLVP 64
             RI  F   V+   ++   ++  H H + + N+ +   A G++S +FY    +L  L  
Sbjct: 70  TLRILEFASSVLVFALLSFAIHDYHDHGNHKTNFGL---AVGVIS-TFYLLAVMLGTLFA 125

Query: 65  EPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKE---YRRE-----NYIIQGSE 116
             F F  +L   + +  +    A  V+A  I  H C+NK    Y  E      ++  G E
Sbjct: 126 PQFVFAGVLLIAEGIVCLLWLCAFIVIAKSIGEHGCSNKTVAVYDPEFGSVPQFVSTGGE 185

Query: 117 --------------RRCREAQACIAFFYFSMFLFLVKVL 141
                         R C  ++  IAF  F+  LF++  +
Sbjct: 186 YNPFTGRYTTSNFHRACNTSKTAIAFAGFAFVLFVISCI 224

>NDAI0H03800 Chr8 complement(928498..929562) [1065 bp, 354 aa] {ON}
           Anc_2.61
          Length = 354

 Score = 30.4 bits (67), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 33/160 (20%), Positives = 63/160 (39%), Gaps = 29/160 (18%)

Query: 8   VFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGI---LANLVP 64
             RI  F   V+   ++   ++  + H + + N+ +   A G++S +FY +   L  L+ 
Sbjct: 63  TLRILEFASSVLVFSLLAFAIHDYNDHGNHKTNFAL---AVGVIS-TFYLLAVFLGTLLM 118

Query: 65  EPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRREN--------------- 109
             F F  +L   + +  +    A  V+A  +  HSC+N    + N               
Sbjct: 119 PQFVFAGVLLIAEAIVCLLWLCAFIVIAKTVGEHSCSNSRVNQYNPAYGSISSFQQSGGT 178

Query: 110 -------YIIQGSERRCREAQACIAFFYFSMFLFLVKVLI 142
                  Y      R C  ++  IAF  F+  LF++  ++
Sbjct: 179 YNPYTGEYTTSNYHRACNTSKTAIAFAGFAFVLFVITCIL 218

>KAFR0A08020 Chr1 complement(1604597..1607530) [2934 bp, 977 aa]
           {ON} Anc_2.8 YNL236W
          Length = 977

 Score = 30.4 bits (67), Expect = 2.8,   Method: Composition-based stats.
 Identities = 25/84 (29%), Positives = 32/84 (38%), Gaps = 21/84 (25%)

Query: 36  SSRVNYCMFPPA----WGLVSDSFYGILANLV--PEPFAFP---------------PILF 74
           SS  +Y   PP+    W  VS S  GI+  +V  P P  FP                + F
Sbjct: 486 SSGFHYPALPPSGVIEWMTVSPSMAGIITKIVKDPVPKFFPVYQNDVLSKANDNINAVAF 545

Query: 75  AFDFLNFVFTFTAGTVLAVGIRTH 98
           AF F N      A   L +  +TH
Sbjct: 546 AFSFANITHRQLASEDLTIACKTH 569

>ABL202W Chr2 (28894..31710) [2817 bp, 938 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YNL236W (SIN4)
          Length = 938

 Score = 29.3 bits (64), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 35/80 (43%), Gaps = 21/80 (26%)

Query: 40  NYCMFPPA----WGLVSDSFYGILANLV--PEP--FAFPPIL-------------FAFDF 78
           NY + PPA    W  +S S  GI+  L   P+P  +A    +             FAF+F
Sbjct: 461 NYPLLPPADAIEWCAISPSSGGIILKLKCKPQPTFYALEQSVLTDPSRDIVHATAFAFEF 520

Query: 79  LNFVFTFTAGTVLAVGIRTH 98
           + F     +G  LA+  +TH
Sbjct: 521 VRFNNMIHSGEDLAIAAKTH 540

>YDL218W Chr4 (66493..67446) [954 bp, 317 aa] {ON} Putative protein
           of unknown function; YDL218W transcription is regulated
           by Azf1p and induced by starvation and aerobic
           conditions; expression also induced in cells treated
           with the mycotoxin patulin
          Length = 317

 Score = 28.9 bits (63), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 25/67 (37%), Gaps = 7/67 (10%)

Query: 90  VLAVGIRTHSCTNKEYR-------RENYIIQGSERRCREAQACIAFFYFSMFLFLVKVLI 142
           VLA      SC+N              Y      R C  +QA IAF      LFL+ V++
Sbjct: 92  VLAKAQGERSCSNTNADGLYYNPYSGQYTADSHRRACNSSQAAIAFSGLCFVLFLISVIL 151

Query: 143 TLVTYFT 149
             +   T
Sbjct: 152 LGINVLT 158

>KLTH0B07326g Chr2 complement(591369..592292) [924 bp, 307 aa] {ON}
           weakly similar to uniprot|Q7LGR3 Saccharomyces
           cerevisiae YDL218W
          Length = 307

 Score = 28.9 bits (63), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 16/33 (48%)

Query: 110 YIIQGSERRCREAQACIAFFYFSMFLFLVKVLI 142
           Y      R CR A+A IAF      LF++  LI
Sbjct: 127 YTTDSHMRPCRSAKASIAFAGLCTVLFMISTLI 159

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.333    0.145    0.462 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 16,620,445
Number of extensions: 605932
Number of successful extensions: 1617
Number of sequences better than 10.0: 46
Number of HSP's gapped: 1584
Number of HSP's successfully gapped: 46
Length of query: 189
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 86
Effective length of database: 41,670,801
Effective search space: 3583688886
Effective search space used: 3583688886
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (22.0 bits)
S2: 62 (28.5 bits)