Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0D029503.494ON28228214160.0
CAGL0I10472g3.494ON28827011851e-165
Smik_6.2283.494ON28727111791e-164
Suva_7.4203.494ON28727111711e-163
KAFR0C019803.494ON28326911681e-162
NDAI0G009203.494ON29627311661e-162
TDEL0D056203.494ON27926511621e-162
KLTH0F14872g3.494ON28026711581e-161
NCAS0E007903.494ON32726911601e-161
TPHA0D032903.494ON28527111551e-160
SAKL0F02728g3.494ON28226911551e-160
YGR132C (PHB1)3.494ON28727111471e-159
Kpol_1017.53.494ON28327011451e-159
Skud_7.4433.494ON28727111311e-157
Kwal_55.212403.494ON28325411091e-153
KNAG0B007903.494ON28427110811e-149
ZYRO0D09900g3.494ON28327110581e-146
Ecym_12353.494ON28327010461e-144
AFR313C3.494ON28326710391e-143
KLLA0D16302g3.494ON2262019291e-127
ADL141W5.98ON3072357631e-101
Smik_16.755.98ON3102357526e-99
YGR231C (PHB2)5.98ON3102347482e-98
Skud_7.5655.98ON3102347449e-98
Kpol_1050.615.98ON3102537421e-97
CAGL0L06490g5.98ON3132417422e-97
KAFR0B042505.98ON3102577422e-97
SAKL0G15510g5.98ON3082357412e-97
Kwal_27.127475.98ON3072377412e-97
NDAI0D025305.98ON3162577371e-96
KNAG0A015805.98ON2882537341e-96
TPHA0A050905.98ON3102317343e-96
TBLA0H022205.98ON3072347325e-96
ZYRO0B15136g5.98ON3102357326e-96
TDEL0G012105.98ON3092357317e-96
Suva_7.5235.98ON3102387318e-96
NCAS0F006005.98ON3132537319e-96
KLLA0E15731g5.98ON3082357291e-95
KLTH0C01672g5.98ON3072337282e-95
TDEL0B032908.520ON1830253760.54
TPHA0I013002.117ON37941740.71
NDAI0A022307.296ON816119740.75
TBLA0D040707.240ON661106668.2
KNAG0A074703.410ON18517648.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0D02950
         (282 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0D02950 Chr4 (720856..721704) [849 bp, 282 aa] {ON} Anc_3.49...   550   0.0  
CAGL0I10472g Chr9 (1036324..1037190) [867 bp, 288 aa] {ON} highl...   461   e-165
Smik_6.228 Chr6 complement(373467..374330) [864 bp, 287 aa] {ON}...   458   e-164
Suva_7.420 Chr7 complement(725738..726601) [864 bp, 287 aa] {ON}...   455   e-163
KAFR0C01980 Chr3 complement(394370..395221) [852 bp, 283 aa] {ON...   454   e-162
NDAI0G00920 Chr7 (192573..193463) [891 bp, 296 aa] {ON} Anc_3.494     453   e-162
TDEL0D05620 Chr4 complement(1012372..1013211) [840 bp, 279 aa] {...   452   e-162
KLTH0F14872g Chr6 complement(1218390..1219232) [843 bp, 280 aa] ...   450   e-161
NCAS0E00790 Chr5 (145987..146970) [984 bp, 327 aa] {ON} Anc_3.494     451   e-161
TPHA0D03290 Chr4 complement(676982..677839) [858 bp, 285 aa] {ON...   449   e-160
SAKL0F02728g Chr6 (231020..231868) [849 bp, 282 aa] {ON} highly ...   449   e-160
YGR132C Chr7 complement(755589..756452) [864 bp, 287 aa] {ON}  P...   446   e-159
Kpol_1017.5 s1017 (19813..20664) [852 bp, 283 aa] {ON} (19813..2...   445   e-159
Skud_7.443 Chr7 complement(734799..735662) [864 bp, 287 aa] {ON}...   440   e-157
Kwal_55.21240 s55 complement(745938..746789) [852 bp, 283 aa] {O...   431   e-153
KNAG0B00790 Chr2 (146405..147259) [855 bp, 284 aa] {ON} Anc_3.49...   421   e-149
ZYRO0D09900g Chr4 (835139..835990) [852 bp, 283 aa] {ON} similar...   412   e-146
Ecym_1235 Chr1 (483393..484244) [852 bp, 283 aa] {ON} similar to...   407   e-144
AFR313C Chr6 complement(1005181..1006032) [852 bp, 283 aa] {ON} ...   404   e-143
KLLA0D16302g Chr4 complement(1372447..1373127) [681 bp, 226 aa] ...   362   e-127
ADL141W Chr4 (444592..445515) [924 bp, 307 aa] {ON} Syntenic hom...   298   e-101
Smik_16.75 Chr16 (143216..144148) [933 bp, 310 aa] {ON} YGR231C ...   294   6e-99
YGR231C Chr7 complement(952548..953480) [933 bp, 310 aa] {ON}  P...   292   2e-98
Skud_7.565 Chr7 complement(927426..928358) [933 bp, 310 aa] {ON}...   291   9e-98
Kpol_1050.61 s1050 complement(135758..136690) [933 bp, 310 aa] {...   290   1e-97
CAGL0L06490g Chr12 (735080..736021) [942 bp, 313 aa] {ON} highly...   290   2e-97
KAFR0B04250 Chr2 complement(882694..883626) [933 bp, 310 aa] {ON...   290   2e-97
SAKL0G15510g Chr7 complement(1334598..1335524) [927 bp, 308 aa] ...   290   2e-97
Kwal_27.12747 s27 complement(1358872..1359795) [924 bp, 307 aa] ...   290   2e-97
NDAI0D02530 Chr4 complement(583429..584379) [951 bp, 316 aa] {ON...   288   1e-96
KNAG0A01580 Chr1 (79208..80074) [867 bp, 288 aa] {ON} Anc_5.98 Y...   287   1e-96
TPHA0A05090 Chr1 complement(1146837..1147769) [933 bp, 310 aa] {...   287   3e-96
TBLA0H02220 Chr8 (537650..538573) [924 bp, 307 aa] {ON} Anc_5.98...   286   5e-96
ZYRO0B15136g Chr2 (1233955..1234887) [933 bp, 310 aa] {ON} simil...   286   6e-96
TDEL0G01210 Chr7 (248098..249027) [930 bp, 309 aa] {ON} Anc_5.98...   286   7e-96
Suva_7.523 Chr7 complement(907005..907937) [933 bp, 310 aa] {ON}...   286   8e-96
NCAS0F00600 Chr6 (117964..118905) [942 bp, 313 aa] {ON} Anc_5.98...   286   9e-96
KLLA0E15731g Chr5 (1407793..1408719) [927 bp, 308 aa] {ON} simil...   285   1e-95
KLTH0C01672g Chr3 (147893..148816) [924 bp, 307 aa] {ON} highly ...   285   2e-95
TDEL0B03290 Chr2 complement(581901..587393) [5493 bp, 1830 aa] {...    34   0.54 
TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.1...    33   0.71 
NDAI0A02230 Chr1 (502448..504898) [2451 bp, 816 aa] {ON} Anc_7.296     33   0.75 
TBLA0D04070 Chr4 complement(1012284..1014269) [1986 bp, 661 aa] ...    30   8.2  
KNAG0A07470 Chr1 (1173486..1174043) [558 bp, 185 aa] {ON} Anc_3....    29   8.6  

>TBLA0D02950 Chr4 (720856..721704) [849 bp, 282 aa] {ON} Anc_3.494
           YGR132C
          Length = 282

 Score =  550 bits (1416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/282 (95%), Positives = 270/282 (95%)

Query: 1   MSGXXXXXXXXXXXXPLGVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVP 60
           MSG            PLGVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVP
Sbjct: 1   MSGIKIAEKLAKIAIPLGVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVP 60

Query: 61  WLQKSVIFDIRTKPKNITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVL 120
           WLQKSVIFDIRTKPKNITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVL
Sbjct: 61  WLQKSVIFDIRTKPKNITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVL 120

Query: 121 PSIGNEVLKSIVAQFDAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEF 180
           PSIGNEVLKSIVAQFDAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEF
Sbjct: 121 PSIGNEVLKSIVAQFDAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEF 180

Query: 181 TKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIR 240
           TKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIR
Sbjct: 181 TKAVEQKQIAQQDAERAKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIR 240

Query: 241 RLETSKEIAETLAGSPHVTYLPGGGNQAEDASKNSLLLNLGR 282
           RLETSKEIAETLAGSPHVTYLPGGGNQAEDASKNSLLLNLGR
Sbjct: 241 RLETSKEIAETLAGSPHVTYLPGGGNQAEDASKNSLLLNLGR 282

>CAGL0I10472g Chr9 (1036324..1037190) [867 bp, 288 aa] {ON} highly
           similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132c prohibitin antiproliferative protein
          Length = 288

 Score =  461 bits (1185), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 221/270 (81%), Positives = 249/270 (92%), Gaps = 3/270 (1%)

Query: 16  PLGVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFDIRTKPK 75
           P+G+ VS + YSMYDV+GGSR VIFDR+QGVK  VVGEGTHFLVPWLQK++I+D+RTKPK
Sbjct: 18  PVGIAVSGLQYSMYDVQGGSRGVIFDRLQGVKSDVVGEGTHFLVPWLQKAIIYDVRTKPK 77

Query: 76  NITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQF 135
           +I TNTGT+DLQMVSLTLR+LHRPD++QLP+IYQNLGLDYDERVLPSIGNEVLKSIVAQF
Sbjct: 78  SIATNTGTKDLQMVSLTLRVLHRPDVMQLPLIYQNLGLDYDERVLPSIGNEVLKSIVAQF 137

Query: 136 DAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAE 195
           DAAELITQREIVSQ+IR+EL++RANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAE
Sbjct: 138 DAAELITQREIVSQKIRQELSNRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAE 197

Query: 196 RAKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIAETLAGS 255
           RA+FLVEKAEQERQASVIRAEGEAESAE IS+AL K GDGLLLIRRLE SKEIA+TLA S
Sbjct: 198 RARFLVEKAEQERQASVIRAEGEAESAEYISKALSKVGDGLLLIRRLEASKEIAQTLANS 257

Query: 256 PHVTYLP---GGGNQAEDASKNSLLLNLGR 282
            ++TYLP    GG++ +  S N+LLLNLGR
Sbjct: 258 NNITYLPSNHAGGDKDDKGSPNTLLLNLGR 287

>Smik_6.228 Chr6 complement(373467..374330) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  458 bits (1179), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 222/271 (81%), Positives = 243/271 (89%), Gaps = 4/271 (1%)

Query: 16  PLGVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFDIRTKPK 75
           P+G+  S + YSMYDVKGGSR VIFDRI GVKQ VVGEGTHFLVPWLQK++I+D+RTKPK
Sbjct: 17  PIGIVASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPK 76

Query: 76  NITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQF 135
           +I TNTGTRDLQMVSLTLR+LHRP+++QLP IYQNLGLDYDERVLPSIGNEVLKSIVAQF
Sbjct: 77  SIATNTGTRDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERVLPSIGNEVLKSIVAQF 136

Query: 136 DAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAE 195
           DAAELITQREI+SQ+IRKEL+ RANEFGI+LEDVSITHMTFGPEFTKAVEQKQIAQQDAE
Sbjct: 137 DAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAE 196

Query: 196 RAKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIAETLAGS 255
           RAKFLVEKAEQERQASVIRAEGEAESAE IS+AL K GDGLLLIRRLE SK+IA+TLA S
Sbjct: 197 RAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANS 256

Query: 256 PHVTYLP----GGGNQAEDASKNSLLLNLGR 282
            +V YLP    G GN     S NSLLLN+GR
Sbjct: 257 SNVVYLPSQHSGNGNSESSGSPNSLLLNIGR 287

>Suva_7.420 Chr7 complement(725738..726601) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  455 bits (1171), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 221/271 (81%), Positives = 243/271 (89%), Gaps = 4/271 (1%)

Query: 16  PLGVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFDIRTKPK 75
           P+G+  S + YSMYDVKGGSR VIFDRI GVKQ VVGEGTHFLVPWLQK++I+D+RTKPK
Sbjct: 17  PIGLVASGLQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPK 76

Query: 76  NITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQF 135
           +I TNTGTRDLQMVSLTLR+LHRP+++QLP IYQNLGLDYDERVLPSIGNEVLKSIVAQF
Sbjct: 77  SIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQF 136

Query: 136 DAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAE 195
           DAAELITQREI+SQ+IRKEL+ RANEFGI+LEDVSITHMTFGPEFTKAVEQKQIAQQDAE
Sbjct: 137 DAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAE 196

Query: 196 RAKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIAETLAGS 255
           RAKF+VEKAEQERQASVIRAEGEAESAE IS+AL K GDGLLLIRRLE SK+IA+TLA S
Sbjct: 197 RAKFIVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANS 256

Query: 256 PHVTYLP----GGGNQAEDASKNSLLLNLGR 282
            +V YLP    G GN     S NSLLLN+GR
Sbjct: 257 SNVIYLPSQHAGSGNSEYSGSPNSLLLNIGR 287

>KAFR0C01980 Chr3 complement(394370..395221) [852 bp, 283 aa] {ON}
           Anc_3.494 YGR132C
          Length = 283

 Score =  454 bits (1168), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 218/269 (81%), Positives = 246/269 (91%), Gaps = 2/269 (0%)

Query: 16  PLGVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFDIRTKPK 75
           P G+ ++ +DYSMYDVKGGSR VIFDRI GVK+AV+GEGTHFLVPWLQK++I+D+RTKPK
Sbjct: 15  PSGLLLTAVDYSMYDVKGGSRGVIFDRISGVKKAVIGEGTHFLVPWLQKAIIYDVRTKPK 74

Query: 76  NITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQF 135
           +I+TNTGT+DLQMVSLTLRLLHRP++V+LP IYQNLGLDYDERVLPSIGNEVLKSIVAQF
Sbjct: 75  SISTNTGTKDLQMVSLTLRLLHRPNVVELPRIYQNLGLDYDERVLPSIGNEVLKSIVAQF 134

Query: 136 DAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAE 195
           DAAELITQREIVSQRIRKE++HRANEFGI+LEDVSITHMTFG EFTKAVEQKQIAQQDAE
Sbjct: 135 DAAELITQREIVSQRIRKEMSHRANEFGIKLEDVSITHMTFGAEFTKAVEQKQIAQQDAE 194

Query: 196 RAKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIAETLAGS 255
           RA+FLVEKAEQERQASVIRAEGEAESAE IS+AL + GDGLLLIRRLE SK+IA TL+ S
Sbjct: 195 RARFLVEKAEQERQASVIRAEGEAESAECISKALSRVGDGLLLIRRLEASKDIARTLSKS 254

Query: 256 PHVTYLPGGGNQA--EDASKNSLLLNLGR 282
            ++TYLPGG  +   E    NSLLLN+GR
Sbjct: 255 SNITYLPGGKGREGDEKTPPNSLLLNIGR 283

>NDAI0G00920 Chr7 (192573..193463) [891 bp, 296 aa] {ON} Anc_3.494
          Length = 296

 Score =  453 bits (1166), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 220/273 (80%), Positives = 245/273 (89%), Gaps = 6/273 (2%)

Query: 16  PLGVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFDIRTKPK 75
           P+G+ V+ +DYSMYDVKGGSR VIFDR+ GVK  VVGEGTHFLVPWLQK+VI+D+RTKPK
Sbjct: 24  PIGLLVTGVDYSMYDVKGGSRGVIFDRLSGVKSTVVGEGTHFLVPWLQKAVIYDVRTKPK 83

Query: 76  NITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQF 135
           +I TNTGT+DLQMVSLTLR+LHRP++ +LP IYQNLGLDYDE+VLPSIGNEVLKSIVAQF
Sbjct: 84  SIATNTGTKDLQMVSLTLRVLHRPNVNELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQF 143

Query: 136 DAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAE 195
           DAAELITQREIVSQRI+ EL+ RANEFG+RLEDVSITHMTFGPEFTKAVEQKQIAQQDAE
Sbjct: 144 DAAELITQREIVSQRIKSELSMRANEFGLRLEDVSITHMTFGPEFTKAVEQKQIAQQDAE 203

Query: 196 RAKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIAETLAGS 255
           RAKFLVEKAEQERQASVIRAEGEAESAE IS+AL K GDGLLLIRRLE SK+IA+TLA S
Sbjct: 204 RAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANS 263

Query: 256 PHVTYLP------GGGNQAEDASKNSLLLNLGR 282
           P+VTYLP      G G    ++S NSLLLN+GR
Sbjct: 264 PNVTYLPGQNRHSGSGTDGGNSSPNSLLLNIGR 296

>TDEL0D05620 Chr4 complement(1012372..1013211) [840 bp, 279 aa] {ON}
           Anc_3.494 YGR132C
          Length = 279

 Score =  452 bits (1162), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 215/265 (81%), Positives = 244/265 (92%)

Query: 16  PLGVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFDIRTKPK 75
           PLG+ VS + YSMYDV+GGSRAVIFDR+ GV++ VVGEGTHFLVPWLQK++++DIRTKPK
Sbjct: 14  PLGIVVSGVQYSMYDVRGGSRAVIFDRLSGVQKQVVGEGTHFLVPWLQKAIVYDIRTKPK 73

Query: 76  NITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQF 135
            I TNTGT+D+QMVSLTLR+LHRPD++QLP IYQNLGLDYDERVLPSIGNEVLK+IVAQF
Sbjct: 74  GIATNTGTKDMQMVSLTLRVLHRPDVLQLPRIYQNLGLDYDERVLPSIGNEVLKAIVAQF 133

Query: 136 DAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAE 195
           DAAELITQRE+VSQRIR EL+HRA+EFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAE
Sbjct: 134 DAAELITQRELVSQRIRDELSHRASEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAE 193

Query: 196 RAKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIAETLAGS 255
           RAKFLVEKAEQ R+ASVIRAEGEAESAE IS+AL +AGDGLLLIRRLE SKEIA+TLA S
Sbjct: 194 RAKFLVEKAEQVRKASVIRAEGEAESAEYISKALARAGDGLLLIRRLEASKEIAQTLAAS 253

Query: 256 PHVTYLPGGGNQAEDASKNSLLLNL 280
            ++TYLPG  +   + S+NSLLLN+
Sbjct: 254 SNITYLPGKAHGNTEGSQNSLLLNI 278

>KLTH0F14872g Chr6 complement(1218390..1219232) [843 bp, 280 aa]
           {ON} highly similar to uniprot|P40961 Saccharomyces
           cerevisiae YGR132C
          Length = 280

 Score =  450 bits (1158), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 216/267 (80%), Positives = 242/267 (90%)

Query: 16  PLGVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFDIRTKPK 75
           PLG+  S + YSMYDVKGGSRAVIFDR+ GV+Q VVGEGTHFLVPWLQK+V++D+RTKPK
Sbjct: 14  PLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLVPWLQKAVLYDVRTKPK 73

Query: 76  NITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQF 135
           NI TNTGT+DLQMVSLTLR+LHRPD+++LP IYQNLGLDYDERVLPSIGNEVLK+IVAQF
Sbjct: 74  NIATNTGTKDLQMVSLTLRVLHRPDVMKLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQF 133

Query: 136 DAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAE 195
           DAAELITQRE VSQRIR+EL+ RA+EF IRLEDVSITHMTFG EFTKAVEQKQIAQQDAE
Sbjct: 134 DAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAE 193

Query: 196 RAKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIAETLAGS 255
           RA+++VE AEQERQASVIRAEGEAESAE IS+AL KAGDGLLLIRR+E SKEIA+TLA S
Sbjct: 194 RARYVVELAEQERQASVIRAEGEAESAEYISKALAKAGDGLLLIRRIEASKEIAKTLANS 253

Query: 256 PHVTYLPGGGNQAEDASKNSLLLNLGR 282
            +VTYLP   + +E  S NSLLLNLGR
Sbjct: 254 SNVTYLPSSHSASEQGSPNSLLLNLGR 280

>NCAS0E00790 Chr5 (145987..146970) [984 bp, 327 aa] {ON} Anc_3.494
          Length = 327

 Score =  451 bits (1160), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 218/269 (81%), Positives = 245/269 (91%), Gaps = 2/269 (0%)

Query: 16  PLGVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFDIRTKPK 75
           PLG+  + ++YSMYDVKGGSR VIFDR+ GV++ V+GEGTHFLVPWLQK+VI+D+RTKPK
Sbjct: 59  PLGILATGLEYSMYDVKGGSRGVIFDRLSGVQKRVIGEGTHFLVPWLQKAVIYDVRTKPK 118

Query: 76  NITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQF 135
           +I TNTGT+DLQMVSLTLR+LHRP+I +LP IYQNLGLDYDE+VLPSIGNEVLKSIVAQF
Sbjct: 119 SIATNTGTKDLQMVSLTLRVLHRPNIRELPKIYQNLGLDYDEKVLPSIGNEVLKSIVAQF 178

Query: 136 DAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAE 195
           DAAELITQREIVSQRI+ EL+ RA+EFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAE
Sbjct: 179 DAAELITQREIVSQRIKSELSTRADEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAE 238

Query: 196 RAKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIAETLAGS 255
           RAKFLVEKAEQERQASVIRAEGEAESAE IS+AL K GDGLLLIRRLE SK+IA+TLA S
Sbjct: 239 RAKFLVEKAEQERQASVIRAEGEAESAEYISKALAKVGDGLLLIRRLEASKDIAQTLANS 298

Query: 256 PHVTYLPG--GGNQAEDASKNSLLLNLGR 282
           P++TYLPG  GG   +  S NSLLLN+GR
Sbjct: 299 PNITYLPGQQGGRGNDSGSPNSLLLNIGR 327

>TPHA0D03290 Chr4 complement(676982..677839) [858 bp, 285 aa] {ON}
           Anc_3.494 YGR132C
          Length = 285

 Score =  449 bits (1155), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 217/271 (80%), Positives = 243/271 (89%), Gaps = 4/271 (1%)

Query: 16  PLGVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFDIRTKPK 75
           PLG+ VS + Y+MYDVKGGSRAVIFDR+ GVKQ V+GEGTHFL PWLQK+++FD+RTKPK
Sbjct: 15  PLGIAVSGIQYAMYDVKGGSRAVIFDRLSGVKQQVIGEGTHFLFPWLQKAIVFDVRTKPK 74

Query: 76  NITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQF 135
           +I TNTGT+DLQMVSLTLR+LHRPD+ QLP IYQNLGLDYDERVLPSIGNEVLK+IVAQF
Sbjct: 75  SIATNTGTKDLQMVSLTLRVLHRPDVQQLPTIYQNLGLDYDERVLPSIGNEVLKAIVAQF 134

Query: 136 DAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAE 195
           DAAELITQREIVS +IR+EL+ R+NEFGI+LEDVSITHMTFG EFTKAVEQKQIAQQDAE
Sbjct: 135 DAAELITQREIVSNKIREELSIRSNEFGIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAE 194

Query: 196 RAKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIAETLAGS 255
           RAKFLVE+AEQERQA+VIRAEGEAESAE IS+AL KAGDGLLLIRRLE SKEIA+TL+ S
Sbjct: 195 RAKFLVERAEQERQAAVIRAEGEAESAEYISKALAKAGDGLLLIRRLEASKEIAKTLSQS 254

Query: 256 PHVTYLPGG----GNQAEDASKNSLLLNLGR 282
            +VTYLP G    GN     + NSLLLNLGR
Sbjct: 255 SNVTYLPSGSSSNGNNESAGTPNSLLLNLGR 285

>SAKL0F02728g Chr6 (231020..231868) [849 bp, 282 aa] {ON} highly
           similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132C
          Length = 282

 Score =  449 bits (1155), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 216/269 (80%), Positives = 243/269 (90%), Gaps = 2/269 (0%)

Query: 16  PLGVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFDIRTKPK 75
           P+G+  S + YSMYDVKGG+RAVIFDR+ GV+Q V+GEGTHFLVPWLQ+++++D+RTKPK
Sbjct: 14  PIGIAFSALQYSMYDVKGGTRAVIFDRLSGVQQQVIGEGTHFLVPWLQRAIVYDVRTKPK 73

Query: 76  NITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQF 135
           NI TNTGT+DLQMVSLTLR+LHRP+++QLP IYQNLGLDYDERVLPSIGNEVLK+IVAQF
Sbjct: 74  NIATNTGTKDLQMVSLTLRVLHRPEVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVAQF 133

Query: 136 DAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAE 195
           DAAELITQREIVSQRIRKEL+ RA EF IRLEDVSITHMTFG EFTKAVEQKQIAQQDAE
Sbjct: 134 DAAELITQREIVSQRIRKELSLRAAEFNIRLEDVSITHMTFGREFTKAVEQKQIAQQDAE 193

Query: 196 RAKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIAETLAGS 255
           RAKFLVE+AEQERQA+VIRAEGEAESA+ IS+AL KAGDGLLLIRRLE SKEIA+TLA S
Sbjct: 194 RAKFLVERAEQERQAAVIRAEGEAESADYISKALSKAGDGLLLIRRLEASKEIAQTLANS 253

Query: 256 PHVTYLP--GGGNQAEDASKNSLLLNLGR 282
            +VTYLP  G G   +  S NSLLLNLGR
Sbjct: 254 SNVTYLPSNGAGGAEQQGSPNSLLLNLGR 282

>YGR132C Chr7 complement(755589..756452) [864 bp, 287 aa] {ON}
           PHB1Subunit of the prohibitin complex (Phb1p-Phb2p), a
           1.2 MDa ring-shaped inner mitochondrial membrane
           chaperone that stabilizes newly synthesized proteins;
           determinant of replicative life span; involved in
           mitochondrial segregation
          Length = 287

 Score =  446 bits (1147), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 221/271 (81%), Positives = 243/271 (89%), Gaps = 4/271 (1%)

Query: 16  PLGVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFDIRTKPK 75
           P+G+  S + YSMYDVKGGSR VIFDRI GVKQ VVGEGTHFLVPWLQK++I+D+RTKPK
Sbjct: 17  PIGIIASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPK 76

Query: 76  NITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQF 135
           +I TNTGT+DLQMVSLTLR+LHRP+++QLP IYQNLGLDYDERVLPSIGNEVLKSIVAQF
Sbjct: 77  SIATNTGTKDLQMVSLTLRVLHRPEVLQLPAIYQNLGLDYDERVLPSIGNEVLKSIVAQF 136

Query: 136 DAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAE 195
           DAAELITQREI+SQ+IRKEL+ RANEFGI+LEDVSITHMTFGPEFTKAVEQKQIAQQDAE
Sbjct: 137 DAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAE 196

Query: 196 RAKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIAETLAGS 255
           RAKFLVEKAEQERQASVIRAEGEAESAE IS+AL K GDGLLLIRRLE SK+IA+TLA S
Sbjct: 197 RAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANS 256

Query: 256 PHVTYLPG----GGNQAEDASKNSLLLNLGR 282
            +V YLP     GGN     S NSLLLN+GR
Sbjct: 257 SNVVYLPSQHSGGGNSESSGSPNSLLLNIGR 287

>Kpol_1017.5 s1017 (19813..20664) [852 bp, 283 aa] {ON}
           (19813..20664) [852 nt, 284 aa]
          Length = 283

 Score =  445 bits (1145), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 216/270 (80%), Positives = 240/270 (88%), Gaps = 3/270 (1%)

Query: 16  PLGVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFDIRTKPK 75
           P+G+ VS + +SMYDVKGGSRAVIFDRI GVKQ ++GEGTHFL+PWLQK++I+D+RTKPK
Sbjct: 14  PIGIVVSGIQFSMYDVKGGSRAVIFDRISGVKQNIIGEGTHFLIPWLQKAIIYDVRTKPK 73

Query: 76  NITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQF 135
           +I TNTGT+DLQMVSLTLR+LHRPD+VQLP IYQNLGLDYDERVLPSI NEVLK+IVAQF
Sbjct: 74  SIATNTGTKDLQMVSLTLRVLHRPDVVQLPTIYQNLGLDYDERVLPSISNEVLKAIVAQF 133

Query: 136 DAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAE 195
           DAAELITQRE+VS RIR EL  R+NEFGIRLEDVSITHMTFG EFTKAVE KQIAQQDAE
Sbjct: 134 DAAELITQREVVSDRIRAELGRRSNEFGIRLEDVSITHMTFGNEFTKAVELKQIAQQDAE 193

Query: 196 RAKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIAETLAGS 255
           RAKFLVEKAEQERQA+VIRAEGEAESAE IS+AL KAGDGLLLIRRLE SKEIA TL+ S
Sbjct: 194 RAKFLVEKAEQERQAAVIRAEGEAESAEYISKALDKAGDGLLLIRRLEASKEIAATLSQS 253

Query: 256 PHVTYLPGGGNQA---EDASKNSLLLNLGR 282
            +VTYLP G   A    D + N+LLLNLGR
Sbjct: 254 SNVTYLPNGHGNARGGSDGTPNTLLLNLGR 283

>Skud_7.443 Chr7 complement(734799..735662) [864 bp, 287 aa] {ON}
           YGR132C (REAL)
          Length = 287

 Score =  440 bits (1131), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 218/271 (80%), Positives = 242/271 (89%), Gaps = 4/271 (1%)

Query: 16  PLGVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFDIRTKPK 75
           P+G+  + + Y+MYDVKGGSR VIFDRI GVKQ VVGEGTHFLVPWLQK++I+D+RTKPK
Sbjct: 17  PIGIIATGIQYTMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDVRTKPK 76

Query: 76  NITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQF 135
           +I TNTGTRDLQMVSLTLR+LHRP+++QLP IYQNLGLDYDERVLPSIGNEVLKSIVAQF
Sbjct: 77  SIATNTGTRDLQMVSLTLRVLHRPEVLQLPSIYQNLGLDYDERVLPSIGNEVLKSIVAQF 136

Query: 136 DAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAE 195
           DAAELITQREI+SQ+IRKEL+ RANEFGI+LEDVSITHMTFGPEFTKAVEQKQIAQQDAE
Sbjct: 137 DAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAE 196

Query: 196 RAKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIAETLAGS 255
           RAKFLVEKAEQERQASVIRAEGEAESAE IS+AL K GDGLLLIRRLE SK+IA+TLA S
Sbjct: 197 RAKFLVEKAEQERQASVIRAEGEAESAEFISKALAKVGDGLLLIRRLEASKDIAQTLANS 256

Query: 256 PHVTYLPG----GGNQAEDASKNSLLLNLGR 282
            +V YLP      G+     S NSLLLN+GR
Sbjct: 257 SNVVYLPSQHSGNGSGDSSGSPNSLLLNIGR 287

>Kwal_55.21240 s55 complement(745938..746789) [852 bp, 283 aa] {ON}
           YGR132C (PHB1) - mitochondrial protein, prohibitin
           homolog; similar to S. cerevisiae Phb2p [contig 130]
           FULL
          Length = 283

 Score =  431 bits (1109), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 208/254 (81%), Positives = 231/254 (90%)

Query: 16  PLGVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFDIRTKPK 75
           PLG+  S + YSMYDVKGGSRAVIFDR+ GV+Q VVGEGTHFL+PWLQK+V+FD+RTKPK
Sbjct: 14  PLGLAASALQYSMYDVKGGSRAVIFDRLSGVQQQVVGEGTHFLIPWLQKAVLFDVRTKPK 73

Query: 76  NITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQF 135
           NI TNTGT+DLQMVSLTLR+LHRPD+++LP IYQNLGLDYDERVLPSIGNEVLKSIVAQF
Sbjct: 74  NIATNTGTKDLQMVSLTLRVLHRPDVMKLPGIYQNLGLDYDERVLPSIGNEVLKSIVAQF 133

Query: 136 DAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAE 195
           DAAELITQRE VSQRIR+EL+ RA+EF IRLEDVSITHMTFG +FTKAVEQKQIAQQDAE
Sbjct: 134 DAAELITQRETVSQRIRQELSLRASEFNIRLEDVSITHMTFGRDFTKAVEQKQIAQQDAE 193

Query: 196 RAKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIAETLAGS 255
           RA+F+VE AEQERQASVIRAEGEAESAE IS+AL KAGDGLLLIRR+E SKEIA+TLA S
Sbjct: 194 RARFVVELAEQERQASVIRAEGEAESAEYISKALAKAGDGLLLIRRIEASKEIAKTLANS 253

Query: 256 PHVTYLPGGGNQAE 269
            +VTYLP     AE
Sbjct: 254 SNVTYLPSNQQGAE 267

>KNAG0B00790 Chr2 (146405..147259) [855 bp, 284 aa] {ON} Anc_3.494
           YGR132C
          Length = 284

 Score =  421 bits (1081), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 214/271 (78%), Positives = 241/271 (88%), Gaps = 4/271 (1%)

Query: 16  PLGVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFDIRTKPK 75
           P G+ +   DY+MYDVKGGSR VIFDR+ GV+Q VVGEGTHFLVPWLQK++I+D+R+KPK
Sbjct: 14  PAGLLIMAADYAMYDVKGGSRGVIFDRVSGVQQRVVGEGTHFLVPWLQKAIIYDVRSKPK 73

Query: 76  NITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQF 135
           +I TNTGT+DLQMVSLTLR+LHRP++++LP IYQ+LGLDYDERVLPSIGNEVLKSIVAQF
Sbjct: 74  SIATNTGTKDLQMVSLTLRVLHRPEVMELPRIYQSLGLDYDERVLPSIGNEVLKSIVAQF 133

Query: 136 DAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAE 195
           DAAELITQRE+VSQRIR+EL+ RA EFGIRLEDVSITHMTFG EFTKAVEQKQIAQQDAE
Sbjct: 134 DAAELITQREVVSQRIRRELSTRAGEFGIRLEDVSITHMTFGAEFTKAVEQKQIAQQDAE 193

Query: 196 RAKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIAETLAGS 255
           RAKFLVEKAEQ RQASVIRAEGEAESAE IS+AL K GDGLLLIRRLE SKEIA TL+ S
Sbjct: 194 RAKFLVEKAEQMRQASVIRAEGEAESAEAISKALAKVGDGLLLIRRLEASKEIARTLSRS 253

Query: 256 PHVTYLP----GGGNQAEDASKNSLLLNLGR 282
            +VTYLP    GG +  ED S N+LLLN+GR
Sbjct: 254 SNVTYLPSAGAGGKHGREDGSGNTLLLNIGR 284

>ZYRO0D09900g Chr4 (835139..835990) [852 bp, 283 aa] {ON} similar to
           uniprot|P40961 Saccharomyces cerevisiae YGR132C
          Length = 283

 Score =  412 bits (1058), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 210/271 (77%), Positives = 240/271 (88%), Gaps = 7/271 (2%)

Query: 16  PLGVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFDIRTKPK 75
           PLG+  S + YSMYDV+GGSRAVIFDR+ GV+Q VVGEGTHFLVPWLQK+VI+D+RTKPK
Sbjct: 15  PLGIVASGIQYSMYDVRGGSRAVIFDRLSGVQQEVVGEGTHFLVPWLQKAVIYDVRTKPK 74

Query: 76  NITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQF 135
           +I TNTGT+D+QMVSLTLR+LHRP ++QLP IYQNLGLDYDERVLPSIGNEVLK+IVA++
Sbjct: 75  SIATNTGTKDMQMVSLTLRVLHRPQVLQLPHIYQNLGLDYDERVLPSIGNEVLKAIVARY 134

Query: 136 DAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAE 195
           DAAELITQRE+VS  IR EL++RA+EF IRLEDVSITHMTFGPEFTKAVE KQIAQQDAE
Sbjct: 135 DAAELITQRELVSNTIRDELSNRASEFSIRLEDVSITHMTFGPEFTKAVELKQIAQQDAE 194

Query: 196 RAKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIAETLAGS 255
           RAKFLVEKAEQ R+ SVIRAEGEAE+AE IS+AL KAGDGLLLIRRLE SK+IA+TLA S
Sbjct: 195 RAKFLVEKAEQIRKVSVIRAEGEAEAAESISKALAKAGDGLLLIRRLEASKDIAQTLANS 254

Query: 256 PHVTYLP----GGGNQAEDASKNSLLLNLGR 282
            +VTYLP    GGG   ++ +  SLLLNLGR
Sbjct: 255 SNVTYLPSQQSGGG---QEGTSQSLLLNLGR 282

>Ecym_1235 Chr1 (483393..484244) [852 bp, 283 aa] {ON} similar to
           Ashbya gossypii AFR313C
          Length = 283

 Score =  407 bits (1046), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 193/270 (71%), Positives = 235/270 (87%), Gaps = 3/270 (1%)

Query: 16  PLGVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFDIRTKPK 75
           P+GV +      +YDV+GG+RAVIFDR+ GV+Q VVGEGTHFL+PWLQK+VI+D+RTKPK
Sbjct: 14  PIGVAIFAAQSCIYDVRGGTRAVIFDRLSGVQQKVVGEGTHFLIPWLQKAVIYDVRTKPK 73

Query: 76  NITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQF 135
           NI TNTGT+DLQ+V+LTLR+LHRPD++ LP IYQ LGLDYDERVLPSIGNEVLK+IVAQF
Sbjct: 74  NIATNTGTKDLQIVTLTLRVLHRPDVIALPKIYQELGLDYDERVLPSIGNEVLKAIVAQF 133

Query: 136 DAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAE 195
           DAAELITQRE+VSQ+IR+EL  RA+ F I+LEDV+ITHM FG EFTK+VE+KQIAQQ++E
Sbjct: 134 DAAELITQRELVSQKIRQELAKRAHAFHIKLEDVAITHMVFGHEFTKSVEKKQIAQQESE 193

Query: 196 RAKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIAETLAGS 255
           RAK+LV+ AEQER A+VIRAEG+AE+AE IS+AL KAGDGLL+IRRLE SK+IA+TLAGS
Sbjct: 194 RAKYLVQLAEQERAAAVIRAEGDAEAAEYISKALNKAGDGLLMIRRLEASKKIAQTLAGS 253

Query: 256 PHVTYLPG---GGNQAEDASKNSLLLNLGR 282
            ++TYLP    GG+     + +SLLLNLGR
Sbjct: 254 SNITYLPSSSKGGSHDACGTPSSLLLNLGR 283

>AFR313C Chr6 complement(1005181..1006032) [852 bp, 283 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR132C
           (PHB1)
          Length = 283

 Score =  404 bits (1039), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 201/267 (75%), Positives = 237/267 (88%)

Query: 16  PLGVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFDIRTKPK 75
           P+ +  S + +SMYDV+GG+RA+IFDRI GVK  VVGEGTHFL+PWLQK++IFD+RTKP+
Sbjct: 17  PIALAFSAVQFSMYDVRGGTRAIIFDRISGVKPDVVGEGTHFLIPWLQKAIIFDVRTKPR 76

Query: 76  NITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQF 135
           NI TNTGT+DLQMVSLTLR+LHRPD++ L  IY+ LG DYDERVLPSIGNEVLK+IVAQF
Sbjct: 77  NIATNTGTKDLQMVSLTLRVLHRPDVMALSRIYRELGPDYDERVLPSIGNEVLKAIVAQF 136

Query: 136 DAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAE 195
           +A+ELITQRE+VSQ+IR EL  RA+EF IRLEDVSITHMTFG EFTKAVEQKQIAQQ+++
Sbjct: 137 NASELITQRELVSQQIRNELARRASEFNIRLEDVSITHMTFGQEFTKAVEQKQIAQQESD 196

Query: 196 RAKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIAETLAGS 255
           RAKF+VE+AEQER+A+VIRAEGEAE+AE IS+ALQKAGDGLL+IRRLE SK IAETLA S
Sbjct: 197 RAKFVVERAEQERRAAVIRAEGEAEAAEHISKALQKAGDGLLMIRRLEASKGIAETLANS 256

Query: 256 PHVTYLPGGGNQAEDASKNSLLLNLGR 282
           P+VTYLP  G  A+  + NSLLLNLGR
Sbjct: 257 PNVTYLPSKGQAADSGAPNSLLLNLGR 283

>KLLA0D16302g Chr4 complement(1372447..1373127) [681 bp, 226 aa]
           {ON} similar to uniprot|P40961 Saccharomyces cerevisiae
           YGR132C
          Length = 226

 Score =  362 bits (929), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 169/201 (84%), Positives = 191/201 (95%)

Query: 16  PLGVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFDIRTKPK 75
           P+G+ VS + YSMYDV+GG RAVIFDR+QGV+QAV+GEGTHFLVPWLQKS++FD+RTKPK
Sbjct: 14  PVGLTVSAIQYSMYDVRGGHRAVIFDRLQGVQQAVIGEGTHFLVPWLQKSILFDVRTKPK 73

Query: 76  NITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQF 135
           NI TNTGT+DLQMVSLTLR+LHRPD++QLP IYQNLG+DYDERVLPSIGNEVLK+IVAQF
Sbjct: 74  NIATNTGTKDLQMVSLTLRVLHRPDVMQLPKIYQNLGIDYDERVLPSIGNEVLKAIVAQF 133

Query: 136 DAAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAE 195
           DAAELITQREIVSQRIR EL+ RA+EF I+LEDVSITHMTFG EFTKAVEQKQIAQQDAE
Sbjct: 134 DAAELITQREIVSQRIRAELSKRADEFHIKLEDVSITHMTFGQEFTKAVEQKQIAQQDAE 193

Query: 196 RAKFLVEKAEQERQASVIRAE 216
           RA+FLVEKAEQER+A+VIRAE
Sbjct: 194 RARFLVEKAEQERKAAVIRAE 214

>ADL141W Chr4 (444592..445515) [924 bp, 307 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR231C (PHB2)
          Length = 307

 Score =  298 bits (763), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 136/235 (57%), Positives = 193/235 (82%), Gaps = 1/235 (0%)

Query: 23  FMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFDIRTKPKNITTNTG 82
           F++ S+++V GG RA+++ R+ GV+Q+V GEGTHF++PWL+  V++D+R+KP+ +++ TG
Sbjct: 53  FLNASLFNVDGGHRAIVYSRLSGVQQSVYGEGTHFVIPWLETPVLYDVRSKPRTVSSLTG 112

Query: 83  TRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELIT 142
           T DLQMV++T R+L RPD+  LP+IY+ LG DYDERVLPSI NEVLK++VAQF+A++LIT
Sbjct: 113 TNDLQMVNITCRVLSRPDVQHLPLIYRTLGTDYDERVLPSIVNEVLKAVVAQFNASQLIT 172

Query: 143 QREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVE 202
           QRE VS+ IR  L  RA+ F I L+DVSIT+MTF PEFT AVE KQ+AQQDA+RA F VE
Sbjct: 173 QRESVSRLIRDNLVRRASRFNIMLDDVSITYMTFSPEFTSAVEAKQVAQQDAQRASFYVE 232

Query: 203 KAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIAETLAGSPH 257
           KA+QE+Q+ +++A+GEA+SAE+I  A++K+ D + L +RL+T++EIA  LA SP+
Sbjct: 233 KAKQEKQSMIVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIAGILAASPN 286

>Smik_16.75 Chr16 (143216..144148) [933 bp, 310 aa] {ON} YGR231C
           (REAL)
          Length = 310

 Score =  294 bits (752), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 190/235 (80%), Gaps = 1/235 (0%)

Query: 23  FMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFDIRTKPKNITTNTG 82
           F++ ++++V GG RA+++ RI GV   +  EGTHF+ PWL   +++D+R KP+N+ + TG
Sbjct: 53  FINNALFNVDGGHRAIVYSRIHGVSTKIFNEGTHFIFPWLDTPIVYDVRAKPRNVASLTG 112

Query: 83  TRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELIT 142
           T+DLQMV++T R+L RPD+VQLP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LIT
Sbjct: 113 TKDLQMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLIT 172

Query: 143 QREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVE 202
           QRE VS+ IR+ L  RA++F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+
Sbjct: 173 QREKVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVD 232

Query: 203 KAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIAETLAGSPH 257
           KA QE+Q  V++A+GEA+SAE+I  A++K+ D + L +RL+T+++IA+ LA SP+
Sbjct: 233 KARQEKQGMVVKAQGEAKSAELIGEAIKKSRDYVEL-KRLDTARDIAKILASSPN 286

>YGR231C Chr7 complement(952548..953480) [933 bp, 310 aa] {ON}
           PHB2Subunit of the prohibitin complex (Phb1p-Phb2p), a
           1.2 MDa ring-shaped inner mitochondrial membrane
           chaperone that stabilizes newly synthesized proteins;
           determinant of replicative life span; involved in
           mitochondrial segregation
          Length = 310

 Score =  292 bits (748), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 136/234 (58%), Positives = 189/234 (80%), Gaps = 1/234 (0%)

Query: 24  MDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFDIRTKPKNITTNTGT 83
           ++ ++++V GG RA+++ RI GV   +  EGTHF+ PWL   +I+D+R KP+N+ + TGT
Sbjct: 54  INNALFNVDGGHRAIVYSRIHGVSSRIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGT 113

Query: 84  RDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQ 143
           +DLQMV++T R+L RPD+VQLP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQ
Sbjct: 114 KDLQMVNITCRVLSRPDVVQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 173

Query: 144 REIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEK 203
           RE VS+ IR+ L  RA++F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+K
Sbjct: 174 REKVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 233

Query: 204 AEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIAETLAGSPH 257
           A QE+Q  V+RA+GEA+SAE+I  A++K+ D + L +RL+T+++IA+ LA SP+
Sbjct: 234 ARQEKQGMVVRAQGEAKSAELIGEAIKKSRDYVEL-KRLDTARDIAKILASSPN 286

>Skud_7.565 Chr7 complement(927426..928358) [933 bp, 310 aa] {ON}
           YGR231C (REAL)
          Length = 310

 Score =  291 bits (744), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 135/234 (57%), Positives = 187/234 (79%), Gaps = 1/234 (0%)

Query: 24  MDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFDIRTKPKNITTNTGT 83
           ++ ++++V GG RA+++ RI GV   +  EGTHF+ PWL   +I+D+R KP+N+ + TGT
Sbjct: 54  VNNALFNVDGGHRAIVYSRIHGVSSKIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTGT 113

Query: 84  RDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQ 143
           +DLQMV++T R+L RPD+ QLP+IY+ LG DYDERVLPSI NEVLKS+VAQF+A++LITQ
Sbjct: 114 KDLQMVNITCRVLSRPDVAQLPIIYRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQ 173

Query: 144 REIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEK 203
           RE VS+ IR+ L  RA  F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+K
Sbjct: 174 REKVSRLIRENLVRRATRFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 233

Query: 204 AEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIAETLAGSPH 257
           A QE+Q  V++A+GEA+SAE+I  A++K+ D + L +RL+T+++IA+ LA SP+
Sbjct: 234 ARQEKQGMVVKAQGEAKSAELIGEAIKKSRDYVEL-KRLDTARDIAKILANSPN 286

>Kpol_1050.61 s1050 complement(135758..136690) [933 bp, 310 aa] {ON}
           complement(135758..136690) [933 nt, 311 aa]
          Length = 310

 Score =  290 bits (742), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 140/253 (55%), Positives = 194/253 (76%), Gaps = 11/253 (4%)

Query: 27  SMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFDIRTKPKNITTNTGTRDL 86
           ++++V GG RA+++ RI GV   +  EGTHF++PWL+  V++D+R KP+N+ + TGT+DL
Sbjct: 60  ALFNVDGGHRAIVYSRIGGVSSKIYNEGTHFVLPWLETPVVYDVRAKPRNVASLTGTKDL 119

Query: 87  QMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 146
           QMV++T R+L RPD+ QLP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 120 QMVNITCRVLSRPDVSQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQREK 179

Query: 147 VSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 206
           VS+ IR+ L +RA  F + L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA+Q
Sbjct: 180 VSRLIRENLVNRAGRFNLILDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKAKQ 239

Query: 207 ERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIAETLAGSPHVTYLPGGGN 266
           E+Q  V++A+GEA+SAE+I  A++K+ D + L +RL+T++EIA+ LA SP+   L     
Sbjct: 240 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIADILAKSPNRVVL----- 293

Query: 267 QAEDASKNSLLLN 279
                   SLLLN
Sbjct: 294 -----DNESLLLN 301

>CAGL0L06490g Chr12 (735080..736021) [942 bp, 313 aa] {ON} highly
           similar to uniprot|P50085 Saccharomyces cerevisiae
           YGR231c PHB2 or uniprot|P40961 Saccharomyces cerevisiae
           YGR132c PHB1
          Length = 313

 Score =  290 bits (742), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 135/241 (56%), Positives = 191/241 (79%), Gaps = 1/241 (0%)

Query: 17  LGVCVSFMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFDIRTKPKN 76
           LG    F + ++++V GG RA+++ RI GV Q +  EGTH ++PW++  +++D+R KP+N
Sbjct: 49  LGAGALFFNNALFNVDGGHRAIVYSRIGGVSQKIFSEGTHIIIPWIETPIVYDVRAKPRN 108

Query: 77  ITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQFD 136
           + + TGT+DLQMV++T R+L RP++ QLP IY+ LG DYDERVLPSI NEVLK++VAQF+
Sbjct: 109 VASLTGTKDLQMVNITCRVLSRPNVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFN 168

Query: 137 AAELITQREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAER 196
           A++LITQRE VS+ IR  L  RA+ F I L+DVSIT+MTF PEFT+AVE KQIAQQDA+R
Sbjct: 169 ASQLITQREKVSRLIRDNLVRRASGFNILLDDVSITYMTFSPEFTQAVEAKQIAQQDAQR 228

Query: 197 AKFLVEKAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIAETLAGSP 256
           A F+V+KA QE+Q  V++A+GEA+SAE+I  A++K+ D + L +RL+T+K+IA+ LA SP
Sbjct: 229 AAFIVDKARQEKQGMVVKAQGEAKSAELIGDAIKKSRDYVEL-KRLDTAKDIAKILANSP 287

Query: 257 H 257
           +
Sbjct: 288 N 288

>KAFR0B04250 Chr2 complement(882694..883626) [933 bp, 310 aa] {ON}
           Anc_5.98 YGR231C
          Length = 310

 Score =  290 bits (742), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 140/257 (54%), Positives = 194/257 (75%), Gaps = 11/257 (4%)

Query: 23  FMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFDIRTKPKNITTNTG 82
            +  S+++V GG RA+++ RI GV   +  EGTHF++PWL+  +++D+R KP+N+ + TG
Sbjct: 52  LLQQSLFNVDGGHRAIVYSRINGVSSRIYNEGTHFILPWLETPIVYDVRAKPRNVASLTG 111

Query: 83  TRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELIT 142
           T+DLQMV++T R+L RPD+  LP+IY+ LG DYDERVLPSI NEVLK++VAQF+A++LIT
Sbjct: 112 TKDLQMVNITCRVLSRPDVRSLPIIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLIT 171

Query: 143 QREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVE 202
           QRE VS+ IR+ L  RA++F I L+DVSIT MTF PEFT+AVE KQIAQQDA+RA F+V+
Sbjct: 172 QREKVSKLIRENLVRRASKFNIMLDDVSITFMTFSPEFTQAVEAKQIAQQDAQRAAFIVD 231

Query: 203 KAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIAETLAGSPHVTYLP 262
           KA QE+Q  V++A+GEA+SAE+I  A++K+ D + L +RL+T++EIA  LA SP+   L 
Sbjct: 232 KARQEKQGMVVKAQGEAKSAELIGEAIKKSRDYVEL-KRLDTAREIARILANSPNRVVL- 289

Query: 263 GGGNQAEDASKNSLLLN 279
                       SLLLN
Sbjct: 290 ---------DNESLLLN 297

>SAKL0G15510g Chr7 complement(1334598..1335524) [927 bp, 308 aa]
           {ON} highly similar to uniprot|P50085 Saccharomyces
           cerevisiae YGR231C PHB2 Possible role in aging
           mitochondrial protein prohibitin homolog homolog of
           mammalian BAP37 and S. cerevisiae Phb1p
          Length = 308

 Score =  290 bits (741), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 133/235 (56%), Positives = 191/235 (81%), Gaps = 1/235 (0%)

Query: 23  FMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFDIRTKPKNITTNTG 82
            ++ ++++V GG RA+++ R+ G++Q +  EGTHF VPWL+  +++D+R KP+N+ + TG
Sbjct: 54  LVNSALFNVDGGHRAILYSRVGGIQQRIYNEGTHFAVPWLETPIVYDVRAKPRNVASLTG 113

Query: 83  TRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELIT 142
           T+DLQMV++T R+L RP++ QLP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LIT
Sbjct: 114 TKDLQMVNITCRVLSRPEVSQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLIT 173

Query: 143 QREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVE 202
           QRE VS+ IR+ L  RA++F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+
Sbjct: 174 QRERVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVD 233

Query: 203 KAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIAETLAGSPH 257
           KA QE+Q  V++A+GEA+SAE+I  A++K+ D + L +RL+T++EIAE L+ SP+
Sbjct: 234 KARQEKQGMVVKAQGEAQSAELIGEAIKKSKDYVEL-KRLDTAREIAEILSKSPN 287

>Kwal_27.12747 s27 complement(1358872..1359795) [924 bp, 307 aa]
           {ON} YGR231C (PHB2) - mitochondrial protein, prohibitin
           homolog; homolog of mammalian BAP37 and S. cerevisiae
           Phb1p [contig 260] FULL
          Length = 307

 Score =  290 bits (741), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 132/237 (55%), Positives = 189/237 (79%), Gaps = 1/237 (0%)

Query: 25  DYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFDIRTKPKNITTNTGTR 84
           + S+++V GG RA+++ R+ GV+  +  EGTHF +PWL+  +++D+R KP+N+ + TGT+
Sbjct: 55  NASLFNVDGGHRAIVYSRLNGVQSRIFAEGTHFAIPWLETPIVYDVRAKPRNVASLTGTK 114

Query: 85  DLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQR 144
           DLQMV++T R+L RPD+ QLP +++ LG DYDERVLPSI NEVLKS+VAQF+A++LITQR
Sbjct: 115 DLQMVNITCRVLSRPDVTQLPTVFRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQR 174

Query: 145 EIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKA 204
           E VS+ IR+ L  RA++F + L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA
Sbjct: 175 EKVSRLIRENLVRRASKFNVLLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKA 234

Query: 205 EQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIAETLAGSPHVTYL 261
            QE+Q  V++A+GEA+SAE+I  A++K+ D + L +RL+T++EIA  L+ SP+   L
Sbjct: 235 RQEKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIATILSSSPNKVIL 290

>NDAI0D02530 Chr4 complement(583429..584379) [951 bp, 316 aa] {ON}
           Anc_5.98
          Length = 316

 Score =  288 bits (737), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 141/257 (54%), Positives = 192/257 (74%), Gaps = 11/257 (4%)

Query: 23  FMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFDIRTKPKNITTNTG 82
            ++ ++++V GG RA+++ RI GV   +  EGTHF +PW++  +I+D+R KP+N+ + TG
Sbjct: 58  LLNSALFNVDGGHRAIVYSRISGVSPRIYPEGTHFAIPWIETPIIYDVRAKPRNVASLTG 117

Query: 83  TRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELIT 142
           T+DLQMV++T R+L RP++ QLP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LIT
Sbjct: 118 TKDLQMVNITCRVLSRPNVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLIT 177

Query: 143 QREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVE 202
           QRE VS+ IR+ L  RAN F I L+DVSIT MTF PEFT AVE KQIAQQDA+RA F+V+
Sbjct: 178 QREKVSKLIRENLMGRANRFNILLDDVSITFMTFSPEFTNAVEAKQIAQQDAQRAAFVVD 237

Query: 203 KAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIAETLAGSPHVTYLP 262
           KA QE+Q  V+RA+GEA+SAE+I  A++K+ D + L +RL+T++EIA  LA SP+   L 
Sbjct: 238 KARQEKQGMVVRAQGEAKSAELIGDAIKKSKDYVEL-KRLDTAREIARILAKSPNRVVL- 295

Query: 263 GGGNQAEDASKNSLLLN 279
                       SLLLN
Sbjct: 296 ---------DNESLLLN 303

>KNAG0A01580 Chr1 (79208..80074) [867 bp, 288 aa] {ON} Anc_5.98
           YGR231C
          Length = 288

 Score =  287 bits (734), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 140/253 (55%), Positives = 191/253 (75%), Gaps = 11/253 (4%)

Query: 27  SMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFDIRTKPKNITTNTGTRDL 86
           ++++V GG RA+++ RI GV   +  EGTHF++PWL+  +++D+R KP+N+ + TGT+DL
Sbjct: 35  ALFNVDGGHRAIVYSRIGGVLPRIYNEGTHFVLPWLETPIVYDVRAKPRNVASLTGTKDL 94

Query: 87  QMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 146
           QMV++T R+L RPD+ QLP +Y+ LG DYD+RVLPSI NEVLKS+VAQF+A++LITQRE 
Sbjct: 95  QMVNITCRVLSRPDVTQLPTLYRTLGQDYDDRVLPSIVNEVLKSVVAQFNASQLITQREK 154

Query: 147 VSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 206
           VS+ IR+ L  RA+ F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 155 VSRLIRENLVRRASRFNIMLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFIVDKARQ 214

Query: 207 ERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIAETLAGSPHVTYLPGGGN 266
           E+Q  V++A GEA+SAE+I  A++K+ D + L +RL+T+KEIA  LA SP+   L     
Sbjct: 215 EKQGMVVKAVGEAKSAELIGEAIKKSKDYVEL-KRLDTAKEIATILAASPNRVVL----- 268

Query: 267 QAEDASKNSLLLN 279
                   SLLLN
Sbjct: 269 -----DNESLLLN 276

>TPHA0A05090 Chr1 complement(1146837..1147769) [933 bp, 310 aa] {ON}
           Anc_5.98 YGR231C
          Length = 310

 Score =  287 bits (734), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 133/231 (57%), Positives = 186/231 (80%), Gaps = 1/231 (0%)

Query: 27  SMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFDIRTKPKNITTNTGTRDL 86
           ++++V GG RA+++ RI GV   +  EGTHF++PW++  VI+D+R KP+N+ + TGT+DL
Sbjct: 58  ALFNVDGGHRAIVYSRIGGVSNKIYTEGTHFVIPWIETPVIYDVRAKPRNVASLTGTKDL 117

Query: 87  QMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 146
           QMV++T R+L RP++ QLP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQR+ 
Sbjct: 118 QMVNITCRVLSRPNVTQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQRDK 177

Query: 147 VSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 206
           VS+ IR  L  RA +F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 178 VSRLIRDNLVLRAQKFNITLDDVSITYMTFSPEFTTAVEAKQIAQQDAQRAAFVVDKARQ 237

Query: 207 ERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIAETLAGSPH 257
           E+Q  V++A+GEA+SAE+I  A++K+ D + L +RL+T+K+IA+ LA SP+
Sbjct: 238 EKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAKDIADILAKSPN 287

>TBLA0H02220 Chr8 (537650..538573) [924 bp, 307 aa] {ON} Anc_5.98
           YGR231C
          Length = 307

 Score =  286 bits (732), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 134/234 (57%), Positives = 185/234 (79%), Gaps = 1/234 (0%)

Query: 24  MDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFDIRTKPKNITTNTGT 83
            + S+++V GG RA+++ R+ GV   +  EGTHF++PWLQ  +I+D+R KP+N+ + TGT
Sbjct: 52  FNSSLFNVDGGHRAILYSRLSGVSSKIYNEGTHFVIPWLQTPIIYDVRAKPRNVASLTGT 111

Query: 84  RDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQ 143
           +DLQMV++T R+L RPDI  LP+IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQ
Sbjct: 112 KDLQMVNITCRVLSRPDIPSLPLIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 171

Query: 144 REIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEK 203
           R+ VS+ IR+ L  RA +F I L+DVSIT MTF PEFT AVE KQIAQQDA+RA FLV++
Sbjct: 172 RDKVSRLIRENLVRRAGKFNIALDDVSITFMTFSPEFTNAVESKQIAQQDAQRAAFLVDR 231

Query: 204 AEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIAETLAGSPH 257
           A QE+Q  V++A+GEA+SAE+I  A++K+ D + L +RL+ SK+IA+ LA S +
Sbjct: 232 ARQEKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDISKDIAKILATSSN 284

>ZYRO0B15136g Chr2 (1233955..1234887) [933 bp, 310 aa] {ON} similar
           to uniprot|P50085 Saccharomyces cerevisiae YGR231C PHB2
           Possible role in aging mitochondrial protein prohibitin
           homolog homolog of mammalian BAP37 and S. cerevisiae
           Phb1p
          Length = 310

 Score =  286 bits (732), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 133/235 (56%), Positives = 189/235 (80%), Gaps = 1/235 (0%)

Query: 23  FMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFDIRTKPKNITTNTG 82
           F + ++++V GG RA+++ RI GV   +  EGTH L+PW +  V++D+R KP+N+ + TG
Sbjct: 56  FFNNALFNVDGGHRAIVYSRIGGVSSRIYPEGTHLLLPWFETPVVYDVRAKPRNVASLTG 115

Query: 83  TRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELIT 142
           T+DLQMV++T R+L RPD+ QLP+IY+ LGLDYDERVLPSI NEVLK++VAQF+A++LIT
Sbjct: 116 TKDLQMVNITCRVLSRPDVGQLPVIYRTLGLDYDERVLPSIVNEVLKAVVAQFNASQLIT 175

Query: 143 QREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVE 202
           QRE VS+ IR+ L  RA+ F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+
Sbjct: 176 QREKVSRLIRENLVRRASRFNILLDDVSITYMTFSPEFTAAVESKQIAQQDAQRAAFVVD 235

Query: 203 KAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIAETLAGSPH 257
           +A QE+Q  V++A+G+A+SAE+I  A++K+ D + L +RL+T++EIA+ L+ SP+
Sbjct: 236 RALQEKQGLVVKAQGDAKSAELIGEAIRKSKDYVEL-KRLDTAREIAQILSRSPN 289

>TDEL0G01210 Chr7 (248098..249027) [930 bp, 309 aa] {ON} Anc_5.98
           YGR231C
          Length = 309

 Score =  286 bits (731), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 133/235 (56%), Positives = 188/235 (80%), Gaps = 1/235 (0%)

Query: 23  FMDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFDIRTKPKNITTNTG 82
           F++ ++++V GG RA+++ RI GV   +  EGTH ++PWL+  V++D+R KP+N+ + TG
Sbjct: 55  FLNSALFNVDGGHRAIVYSRIGGVSSRIYNEGTHVIIPWLETPVVYDVRAKPRNVASLTG 114

Query: 83  TRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELIT 142
           T+DLQMV++T R+L RP++ QLP IY+ LG DY ERVLPSI NEVLK++VAQF+A++LIT
Sbjct: 115 TKDLQMVNITCRVLSRPNVEQLPTIYRTLGQDYGERVLPSIVNEVLKAVVAQFNASQLIT 174

Query: 143 QREIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVE 202
           QRE VS+ IR+ L  RA+ F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+
Sbjct: 175 QREKVSRLIRENLVRRASNFSILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVD 234

Query: 203 KAEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIAETLAGSPH 257
           KA QE+Q  V++A+GEA+SAE+I  A++K+ D + L +RL+T++EIA+ LA SP+
Sbjct: 235 KARQEKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIAQILARSPN 288

>Suva_7.523 Chr7 complement(907005..907937) [933 bp, 310 aa] {ON}
           YGR231C (REAL)
          Length = 310

 Score =  286 bits (731), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 133/238 (55%), Positives = 188/238 (78%), Gaps = 1/238 (0%)

Query: 24  MDYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFDIRTKPKNITTNTGT 83
           ++ ++++V GG RA+++ R+ GV   +  EGTHF+ PW+   +I+D+R KP+N+ + TGT
Sbjct: 54  VNNALFNVDGGHRAIVYSRLNGVSARIFNEGTHFIFPWIDTPIIYDVRAKPRNVASLTGT 113

Query: 84  RDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQ 143
           +DLQMV++T R+L RPD+ QLP IY+ LG DYDERVLPSI NEVLK++VAQF+A++LITQ
Sbjct: 114 KDLQMVNITCRVLSRPDVGQLPTIYRTLGQDYDERVLPSIVNEVLKAVVAQFNASQLITQ 173

Query: 144 REIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEK 203
           RE VS+ IR+ L  RA+ F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+K
Sbjct: 174 REKVSRLIRENLVRRASRFSILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDK 233

Query: 204 AEQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIAETLAGSPHVTYL 261
           A QE+Q  V++A+GEA+SAE+I  A++K+ D + L +RL+T+++IA+ LA SP+   L
Sbjct: 234 ARQEKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTARDIAKILANSPNRVVL 290

>NCAS0F00600 Chr6 (117964..118905) [942 bp, 313 aa] {ON} Anc_5.98
           YGR231C
          Length = 313

 Score =  286 bits (731), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 140/253 (55%), Positives = 190/253 (75%), Gaps = 11/253 (4%)

Query: 27  SMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFDIRTKPKNITTNTGTRDL 86
           S+++V GG RA+++ RI GV   +  EGTHF++PW++  +I+D+R KP+N+ + TGT+DL
Sbjct: 59  SLFNVDGGHRAIVYSRISGVSPKIYPEGTHFIIPWIETPIIYDVRAKPRNVASLTGTKDL 118

Query: 87  QMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 146
           QMV++T R+L RP++  LP IY+ LG DYDERVLPSI NEVLKS+VAQF+A++LITQRE 
Sbjct: 119 QMVNITCRVLSRPNVENLPNIYRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQREK 178

Query: 147 VSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 206
           VS+ IR+ L  R++ F I L+DVSIT MTF PEFT AVE KQIAQQDA+RA F+V+KA Q
Sbjct: 179 VSKLIRENLMGRSSRFNILLDDVSITFMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQ 238

Query: 207 ERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIAETLAGSPHVTYLPGGGN 266
           E+Q  V+RA+GEA+SAE+I  A++K+ D + L +RL+T++EIA  LA SP+   L     
Sbjct: 239 EKQGMVVRAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIATILAKSPNRVVL----- 292

Query: 267 QAEDASKNSLLLN 279
                   SLLLN
Sbjct: 293 -----DNESLLLN 300

>KLLA0E15731g Chr5 (1407793..1408719) [927 bp, 308 aa] {ON} similar
           to uniprot|P50085 Saccharomyces cerevisiae YGR231C PHB2
           Possible role in aging mitochondrial protein prohibitin
           homolog homolog of mammalian BAP37 and S. cerevisiae
           Phb1p
          Length = 308

 Score =  285 bits (729), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 130/235 (55%), Positives = 189/235 (80%), Gaps = 1/235 (0%)

Query: 27  SMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFDIRTKPKNITTNTGTRDL 86
           ++++V GG RA+++ RI GV+  +  EGTHF++PW++  V++D+R KP+N+++ TGT+DL
Sbjct: 58  ALFNVDGGHRAIVYSRINGVQPRIYPEGTHFIIPWVENPVVYDVRAKPRNVSSLTGTKDL 117

Query: 87  QMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQREI 146
           QMV++T R+L RP++  LPMIY+ LG+DYDERVLPSI NEVLK++VAQF+A++LITQRE 
Sbjct: 118 QMVNITCRVLSRPNVENLPMIYRTLGVDYDERVLPSIVNEVLKAVVAQFNASQLITQRER 177

Query: 147 VSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKAEQ 206
           VS+ IR+ L  RA  F I L+DVSIT+MTF PEFT +VE KQIAQQDA++A F+V+KA Q
Sbjct: 178 VSRLIRENLVRRAKHFNIMLDDVSITYMTFSPEFTNSVEAKQIAQQDAQKAAFVVDKATQ 237

Query: 207 ERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIAETLAGSPHVTYL 261
           E+Q  +++A+GEA+SAE+I  A++K+ D + L +RL+T++EIA  L+ SP+   L
Sbjct: 238 EKQGMIVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIASILSRSPNKVIL 291

>KLTH0C01672g Chr3 (147893..148816) [924 bp, 307 aa] {ON} highly
           similar to uniprot|P50085 Saccharomyces cerevisiae
           YGR231C PHB2 Possible role in aging mitochondrial
           protein prohibitin homolog homolog of mammalian BAP37
           and S. cerevisiae Phb1p
          Length = 307

 Score =  285 bits (728), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 131/233 (56%), Positives = 187/233 (80%), Gaps = 1/233 (0%)

Query: 25  DYSMYDVKGGSRAVIFDRIQGVKQAVVGEGTHFLVPWLQKSVIFDIRTKPKNITTNTGTR 84
           + S+++V GG RA+I+ R+ GV+  +  EGTHF +PW +  +++D+R KP+N+ + TGT+
Sbjct: 55  NSSLFNVDGGHRAIIYSRLNGVQSRIFAEGTHFAIPWFETPIVYDVRAKPRNVASLTGTK 114

Query: 85  DLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQR 144
           DLQMV++T R+L RP++ QLP +++ LG DYDERVLPSI NEVLKS+VAQF+A++LITQR
Sbjct: 115 DLQMVNITCRVLSRPNVSQLPTVFRTLGQDYDERVLPSIVNEVLKSVVAQFNASQLITQR 174

Query: 145 EIVSQRIRKELNHRANEFGIRLEDVSITHMTFGPEFTKAVEQKQIAQQDAERAKFLVEKA 204
           E VS+ IR+ L  RA++F I L+DVSIT+MTF PEFT AVE KQIAQQDA+RA F+V+KA
Sbjct: 175 EKVSRLIRENLVRRASKFNILLDDVSITYMTFSPEFTYAVEAKQIAQQDAQRAAFVVDKA 234

Query: 205 EQERQASVIRAEGEAESAEVISRALQKAGDGLLLIRRLETSKEIAETLAGSPH 257
            QE+Q  V++A+GEA+SAE+I  A++K+ D + L +RL+T++EIA  L+ SP+
Sbjct: 235 RQEKQGMVVKAQGEAKSAELIGEAIKKSKDYVEL-KRLDTAREIATILSQSPN 286

>TDEL0B03290 Chr2 complement(581901..587393) [5493 bp, 1830 aa] {ON}
            Anc_8.520 YBR208C
          Length = 1830

 Score = 33.9 bits (76), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 52/253 (20%), Positives = 97/253 (38%), Gaps = 35/253 (13%)

Query: 30   DVKGGSRAVIFDRIQGVKQAVVGEGTHFL-----VPWLQKSVIFDIRTKPKNITTNTGTR 84
            DV G  R  + D +   K  V+G G  FL     VP   +  +   +  P    T  G  
Sbjct: 1562 DVNGIKREEVRDMMYTAKFMVLGLGDVFLGSPCAVPLDPRQRLLGSKYNPSRTYTERGVV 1621

Query: 85   DLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQFDAAELITQR 144
             L  + + +     P   QL  + + + + +D+  L S        ++  FD  E     
Sbjct: 1622 GLGGMYMCIYATSSPGGYQL--VGRTVPI-WDKLTLASSSKHPW--LLTPFDQVEFYPVS 1676

Query: 145  EIVSQRIRKELNHRANEFGIRLEDVSITHMTF------GPEFTKAVEQKQIAQQDAERAK 198
            E   ++  +E    + +F   +ED   +H  +        +  +A ++ QI ++ AE AK
Sbjct: 1677 EKELEKFTEEC--ESGKFEFEIEDSVFSHKEYLGWIQENIDSIEAFKKSQIGEKSAEFAK 1734

Query: 199  FLVEKAEQERQASVIRAEGE---AESAEVISRALQ--------------KAGDGLLLIRR 241
             +       + +  I+ + E    E AE++                   KAG GL+++  
Sbjct: 1735 LIQAANSDLKSSETIKVQSEETYPEDAELVYSEHSGRFWKPIVSVGDEVKAGQGLIIVEA 1794

Query: 242  LETSKEIAETLAG 254
            ++T   ++ T  G
Sbjct: 1795 MKTEMTVSATRDG 1807

>TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.117
           YHR129C
          Length = 379

 Score = 33.1 bits (74), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 24/41 (58%)

Query: 91  LTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSI 131
           +  + L R DI   PM+Y++L L+    VLP  GN +LK +
Sbjct: 283 IVFQTLSRVDIDLRPMLYKSLVLNGGTTVLPGFGNRILKEL 323

>NDAI0A02230 Chr1 (502448..504898) [2451 bp, 816 aa] {ON} Anc_7.296
          Length = 816

 Score = 33.1 bits (74), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 55/119 (46%), Gaps = 14/119 (11%)

Query: 75  KNITTNTGTRDLQMVSLTLRLLHRPDIVQLPMIYQNLGLDYDERVLPSIGNEVLKSIVAQ 134
           KN TT   +RD Q +S    L+ R D + LP    NL + Y E+ +   G E +  ++A 
Sbjct: 299 KNFTTLLDSRDHQKISALFTLMQR-DFMLLP----NLSVAY-EQYIKQTGEEAISELIAS 352

Query: 135 FDAAELITQREIVSQRIRKELNH-RANEFGIRLEDV-----SITHMTFGPE--FTKAVE 185
             AA + +  E + +     +N     E+  +L D+     SIT   F  +  F KA++
Sbjct: 353 HKAAVMNSSNENIKKNPNAAINSLPPKEYIKKLLDIYAIFRSITTECFKNDSIFAKALD 411

>TBLA0D04070 Chr4 complement(1012284..1014269) [1986 bp, 661 aa]
           {ON} Anc_7.240 YIL050W
          Length = 661

 Score = 30.0 bits (66), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 49/106 (46%), Gaps = 14/106 (13%)

Query: 62  LQKSVIFDIRTKPKNITTNTGTRDLQMVS-LTLRLLHRPDIVQLPMIYQNLGLDYDERVL 120
           +Q   + ++ T P+N+TTN G     + S L+ R  H P I  L   +Q +     ++  
Sbjct: 412 IQPDALTNVNTPPQNLTTNNGEVPNYLSSILSFRGKHIPQIT-LFQYFQRI-----QKYC 465

Query: 121 PSIGNEVLKSIVAQFD----AAELITQREIVSQRIRKELNHRANEF 162
           P I N+V  S++  FD        I+  ++  +    E N + N+F
Sbjct: 466 P-ISNDVFLSLLVYFDRISKRCNTISSNDV--ETTNNENNDKFNDF 508

>KNAG0A07470 Chr1 (1173486..1174043) [558 bp, 185 aa] {ON} Anc_3.410
           YGR082W
          Length = 185

 Score = 29.3 bits (64), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 13/17 (76%), Positives = 16/17 (94%)

Query: 182 KAVEQKQIAQQDAERAK 198
           KAV+QK++AQQDA RAK
Sbjct: 43  KAVKQKKLAQQDAARAK 59

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,095,011
Number of extensions: 910620
Number of successful extensions: 3281
Number of sequences better than 10.0: 69
Number of HSP's gapped: 3382
Number of HSP's successfully gapped: 69
Length of query: 282
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 174
Effective length of database: 41,097,471
Effective search space: 7150959954
Effective search space used: 7150959954
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)