Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0D029403.496ON71713681e-47
TPHA0D033003.496ON196441897e-19
Kpol_1017.43.496ON184571887e-19
ZYRO0D09812g3.496ON185531801e-17
Ecym_12333.496ON87431687e-17
TDEL0D056403.496ON124441691e-16
KLTH0F14938g3.496ON229561723e-16
KNAG0A079603.496ON177471686e-16
Kwal_55.212483.496ON222511706e-16
Suva_16.4793.496ON212461671e-15
Smik_16.4033.496ON203461662e-15
YPR151C (SUE1)3.496ON206461662e-15
Skud_16.4453.496ON215421644e-15
KAFR0G037103.496ON79541555e-15
NCAS0F035703.496ON230601567e-14
NDAI0B058903.496ON278531552e-13
SAKL0F02618g3.496ON253561542e-13
CAGL0L08426g3.496ON140481335e-11
KLLA0E03983g3.496ON191401302e-10
AFR315C3.496ON77411131e-08
KLLA0D06061g8.682ON24957936e-05
SAKL0H06380g8.682ON21928874e-04
Skud_16.1238.682ON25527867e-04
TDEL0E007103.62ON47628867e-04
Suva_16.1518.682ON25327858e-04
TPHA0G015708.682ON25541830.001
YPL159C (PET20)8.682ON25327810.003
ZYRO0F07480g8.682ON23628780.006
Smik_6.3568.682ON25328770.009
KNAG0J017608.682ON25827760.011
YNL295W3.62ON52428760.013
KAFR0H023808.682ON22034730.030
Kpol_1072.128.682ON22227720.042
Kpol_1013.98.682ON26127720.043
Kwal_26.88288.682ON22334710.070
Smik_14.363.62ON52427710.077
KLTH0D11396g8.682ON22528700.078
NCAS0A099403.62ON49428690.13
Kpol_1066.443.62ON47928690.15
ZYRO0C02244g3.62ON46028680.17
Ecym_23908.682ON22727670.25
SAKL0C12342g3.62ON55234660.31
TBLA0B038008.682ON32427650.38
TDEL0A062708.682ON24228650.42
KLLA0A07447g3.62ON48628650.48
TDEL0B016608.470ON54940640.53
Skud_14.423.62ON52428640.57
TPHA0D012908.682ON21837640.58
CAGL0M02101g8.682ON26741640.67
TPHA0I007208.777ON135655630.95
NCAS0C013108.682ON25733611.3
Suva_13.2492.535ON18369611.3
CAGL0I09922g8.798ON50154611.3
NCAS0C008008.777ON135947611.5
NDAI0K008308.777ON126450611.7
ZYRO0F12298g8.777ON136247611.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0D02940
         (71 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0D02940 Chr4 (720446..720661) [216 bp, 71 aa] {ON} Anc_3.496...   146   1e-47
TPHA0D03300 Chr4 complement(678395..678985) [591 bp, 196 aa] {ON...    77   7e-19
Kpol_1017.4 s1017 (17411..17965) [555 bp, 184 aa] {ON} (17411..1...    77   7e-19
ZYRO0D09812g Chr4 (833123..833680) [558 bp, 185 aa] {ON} similar...    74   1e-17
Ecym_1233 Chr1 (481548..481811) [264 bp, 87 aa] {ON} similar to ...    69   7e-17
TDEL0D05640 Chr4 complement(1013767..1014141) [375 bp, 124 aa] {...    70   1e-16
KLTH0F14938g Chr6 complement(1220898..1221587) [690 bp, 229 aa] ...    71   3e-16
KNAG0A07960 Chr1 complement(1270134..1270667) [534 bp, 177 aa] {...    69   6e-16
Kwal_55.21248 s55 complement(748370..749038) [669 bp, 222 aa] {O...    70   6e-16
Suva_16.479 Chr16 complement(827450..828088) [639 bp, 212 aa] {O...    69   1e-15
Smik_16.403 Chr16 complement(702998..703609) [612 bp, 203 aa] {O...    69   2e-15
YPR151C Chr16 complement(831055..831675) [621 bp, 206 aa] {ON}  ...    69   2e-15
Skud_16.445 Chr16 complement(784636..785283) [648 bp, 215 aa] {O...    68   4e-15
KAFR0G03710 Chr7 complement(764660..764899) [240 bp, 79 aa] {ON}...    64   5e-15
NCAS0F03570 Chr6 complement(711238..711930) [693 bp, 230 aa] {ON...    65   7e-14
NDAI0B05890 Chr2 complement(1423733..1424569) [837 bp, 278 aa] {...    64   2e-13
SAKL0F02618g Chr6 (225795..226556) [762 bp, 253 aa] {ON} similar...    64   2e-13
CAGL0L08426g Chr12 (926880..927302) [423 bp, 140 aa] {ON} simila...    56   5e-11
KLLA0E03983g Chr5 (363400..363975) [576 bp, 191 aa] {ON} similar...    55   2e-10
AFR315C Chr6 complement(1006937..1007170) [234 bp, 77 aa] {ON} S...    48   1e-08
KLLA0D06061g Chr4 (520082..520831) [750 bp, 249 aa] {ON} weakly ...    40   6e-05
SAKL0H06380g Chr8 complement(563753..564412) [660 bp, 219 aa] {O...    38   4e-04
Skud_16.123 Chr16 complement(222359..223126) [768 bp, 255 aa] {O...    38   7e-04
TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.6...    38   7e-04
Suva_16.151 Chr16 complement(260210..260971) [762 bp, 253 aa] {O...    37   8e-04
TPHA0G01570 Chr7 complement(319949..320716) [768 bp, 255 aa] {ON...    37   0.001
YPL159C Chr16 complement(250907..251668) [762 bp, 253 aa] {ON}  ...    36   0.003
ZYRO0F07480g Chr6 (607194..607904) [711 bp, 236 aa] {ON} similar...    35   0.006
Smik_6.356 Chr6 (572523..573284) [762 bp, 253 aa] {ON} YPL159C (...    34   0.009
KNAG0J01760 Chr10 (320758..321534) [777 bp, 258 aa] {ON} Anc_8.6...    34   0.011
YNL295W Chr14 (76946..78520) [1575 bp, 524 aa] {ON} Putative pro...    34   0.013
KAFR0H02380 Chr8 complement(455996..456658) [663 bp, 220 aa] {ON...    33   0.030
Kpol_1072.12 s1072 complement(24362..25030) [669 bp, 222 aa] {ON...    32   0.042
Kpol_1013.9 s1013 (15300..16085) [786 bp, 261 aa] {ON} (15300..1...    32   0.043
Kwal_26.8828 s26 (960466..961137) [672 bp, 223 aa] {ON} YPL159C ...    32   0.070
Smik_14.36 Chr14 (61288..62862) [1575 bp, 524 aa] {ON} YNL295W (...    32   0.077
KLTH0D11396g Chr4 (931339..932016) [678 bp, 225 aa] {ON} similar...    32   0.078
NCAS0A09940 Chr1 complement(1986687..1988171) [1485 bp, 494 aa] ...    31   0.13 
Kpol_1066.44 s1066 complement(74670..76109) [1440 bp, 479 aa] {O...    31   0.15 
ZYRO0C02244g Chr3 complement(174640..176022) [1383 bp, 460 aa] {...    31   0.17 
Ecym_2390 Chr2 complement(757433..758116) [684 bp, 227 aa] {ON} ...    30   0.25 
SAKL0C12342g Chr3 complement(1099949..1101607) [1659 bp, 552 aa]...    30   0.31 
TBLA0B03800 Chr2 complement(873861..874835) [975 bp, 324 aa] {ON...    30   0.38 
TDEL0A06270 Chr1 (1098704..1099432) [729 bp, 242 aa] {ON} Anc_8....    30   0.42 
KLLA0A07447g Chr1 (669272..670732) [1461 bp, 486 aa] {ON} simila...    30   0.48 
TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {O...    29   0.53 
Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W (...    29   0.57 
TPHA0D01290 Chr4 (268062..268718) [657 bp, 218 aa] {ON} Anc_8.68...    29   0.58 
CAGL0M02101g Chr13 complement(254024..254827) [804 bp, 267 aa] {...    29   0.67 
TPHA0I00720 Chr9 complement(145599..149669) [4071 bp, 1356 aa] {...    29   0.95 
NCAS0C01310 Chr3 complement(241103..241876) [774 bp, 257 aa] {ON...    28   1.3  
Suva_13.249 Chr13 (392810..393361) [552 bp, 183 aa] {ON} YMR072W...    28   1.3  
CAGL0I09922g Chr9 complement(947782..949287) [1506 bp, 501 aa] {...    28   1.3  
NCAS0C00800 Chr3 complement(140171..144250) [4080 bp, 1359 aa] {...    28   1.5  
NDAI0K00830 Chr11 complement(185833..189627) [3795 bp, 1264 aa] ...    28   1.7  
ZYRO0F12298g Chr6 (997873..1001961) [4089 bp, 1362 aa] {ON} cons...    28   1.9  

>TBLA0D02940 Chr4 (720446..720661) [216 bp, 71 aa] {ON} Anc_3.496
          YPR151C
          Length = 71

 Score =  146 bits (368), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 71/71 (100%), Positives = 71/71 (100%)

Query: 1  MQALKQVVVRNSKSVLRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFRNGEL 60
          MQALKQVVVRNSKSVLRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFRNGEL
Sbjct: 1  MQALKQVVVRNSKSVLRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFRNGEL 60

Query: 61 KKKWEEQLRQD 71
          KKKWEEQLRQD
Sbjct: 61 KKKWEEQLRQD 71

>TPHA0D03300 Chr4 complement(678395..678985) [591 bp, 196 aa] {ON}
          Anc_3.496 YPR151C
          Length = 196

 Score = 77.4 bits (189), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 39/44 (88%)

Query: 14 SVLRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFRN 57
          S+ ++LPRVPTT YLE+T+L NDI FSGYRP+ YPVKENPLFRN
Sbjct: 49 SIFKNLPRVPTTRYLESTKLTNDILFSGYRPITYPVKENPLFRN 92

>Kpol_1017.4 s1017 (17411..17965) [555 bp, 184 aa] {ON}
          (17411..17965) [555 nt, 185 aa]
          Length = 184

 Score = 77.0 bits (188), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 33/57 (57%), Positives = 46/57 (80%)

Query: 1  MQALKQVVVRNSKSVLRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFRN 57
          ++ +K+ +  +++ + R LPRVPTT++LE+T L NDI FSGYRP+ YPVKENPLFRN
Sbjct: 21 IRFMKRKMSSDTEHIFRSLPRVPTTQFLESTTLTNDILFSGYRPITYPVKENPLFRN 77

>ZYRO0D09812g Chr4 (833123..833680) [558 bp, 185 aa] {ON} similar
          to gnl|GLV|CAGL0L08426g Candida glabrata CAGL0L08426g
          and weakly similar to YPR151C uniprot|Q06524
          Saccharomyces cerevisiae YPR151C SUE1 Mitochondrial
          protein required for degradation of unstable forms of
          cytochrome c
          Length = 185

 Score = 73.9 bits (180), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 40/53 (75%), Gaps = 4/53 (7%)

Query: 12 SKSVLRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLF----RNGEL 60
          S  + R +PRVPTT++LE+  L  DI FSGYRPVMYPVKENPLF    RNGEL
Sbjct: 21 SSDIFRSMPRVPTTQFLESRELTRDILFSGYRPVMYPVKENPLFKERTRNGEL 73

>Ecym_1233 Chr1 (481548..481811) [264 bp, 87 aa] {ON} similar to
          Ashbya gossypii AFR315C
          Length = 87

 Score = 69.3 bits (168), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 30/43 (69%), Positives = 36/43 (83%)

Query: 15 VLRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFRN 57
          +LR LPRVPTT+YL    L  DIFFSGYRP++YPVK+NPLFR+
Sbjct: 9  ILRHLPRVPTTQYLSLEELRTDIFFSGYRPMVYPVKQNPLFRS 51

>TDEL0D05640 Chr4 complement(1013767..1014141) [375 bp, 124 aa]
          {ON} Anc_3.496 YPR151C
          Length = 124

 Score = 69.7 bits (169), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 35/44 (79%)

Query: 15 VLRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFRNG 58
          + R LPRVPTT +LE  RL +DI FSGYRPVMYPV+ENPLF  G
Sbjct: 30 LFRTLPRVPTTRFLETQRLSSDILFSGYRPVMYPVRENPLFGRG 73

>KLTH0F14938g Chr6 complement(1220898..1221587) [690 bp, 229 aa]
          {ON} weakly similar to uniprot|Q06524 Saccharomyces
          cerevisiae YPR151C SUE1 Mitochondrial protein required
          for degradation of unstable forms of cytochrome c
          Length = 229

 Score = 70.9 bits (172), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 40/56 (71%)

Query: 6  QVVVRNSKSVLRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFRNGELK 61
          +++ R S  + R LP+VPTT+YLE   L  DI +SGYRPV+YPVKENPLF+    K
Sbjct: 13 KMLKRKSSEIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFKEAGWK 68

>KNAG0A07960 Chr1 complement(1270134..1270667) [534 bp, 177 aa]
          {ON} Anc_3.496 YPR151C
          Length = 177

 Score = 69.3 bits (168), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 30/47 (63%), Positives = 37/47 (78%)

Query: 11 NSKSVLRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFRN 57
          + +S+ R LP+VP T+YLE   L  DI +SGYRPVMYPV+ENPLFRN
Sbjct: 27 DGRSMFRRLPKVPMTKYLETRELAKDILYSGYRPVMYPVRENPLFRN 73

>Kwal_55.21248 s55 complement(748370..749038) [669 bp, 222 aa]
          {ON} YPR151C - Hypothetical ORF [contig 130] FULL
          Length = 222

 Score = 70.1 bits (170), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 30/51 (58%), Positives = 39/51 (76%)

Query: 6  QVVVRNSKSVLRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFR 56
          +++ R S  + R LP+VPTT+YLE   L  DI +SGYRPV+YPVKENPLF+
Sbjct: 13 KMLKRRSSDIFRSLPKVPTTQYLEPAELTRDILYSGYRPVIYPVKENPLFK 63

>Suva_16.479 Chr16 complement(827450..828088) [639 bp, 212 aa] {ON}
           YPR151C (REAL)
          Length = 212

 Score = 68.9 bits (167), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 36/46 (78%)

Query: 16  LRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFRNGELK 61
            R LP+VPTT+YLE   L  DI +SGYRPVMYPVKENPLFR+ + K
Sbjct: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKK 107

>Smik_16.403 Chr16 complement(702998..703609) [612 bp, 203 aa]
          {ON} YPR151C (REAL)
          Length = 203

 Score = 68.6 bits (166), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 36/46 (78%)

Query: 16 LRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFRNGELK 61
           R LP+VPTT+YLE   L  DI +SGYRPVMYPVKENPLFR+ + K
Sbjct: 53 FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKKK 98

>YPR151C Chr16 complement(831055..831675) [621 bp, 206 aa] {ON}
           SUE1Mitochondrial protein required for degradation of
           unstable forms of cytochrome c
          Length = 206

 Score = 68.6 bits (166), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 36/46 (78%)

Query: 16  LRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFRNGELK 61
            R LP+VPTT+YLE   L  DI +SGYRPVMYPVKENPLFR+ + K
Sbjct: 55  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRDKKRK 100

>Skud_16.445 Chr16 complement(784636..785283) [648 bp, 215 aa] {ON}
           YPR151C (REAL)
          Length = 215

 Score = 67.8 bits (164), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 34/42 (80%)

Query: 16  LRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFRN 57
            R LP+VPTT+YLE   L  DI +SGYRPVMYPVKENPLFR+
Sbjct: 62  FRSLPKVPTTQYLEARELTRDILYSGYRPVMYPVKENPLFRD 103

>KAFR0G03710 Chr7 complement(764660..764899) [240 bp, 79 aa] {ON}
          Anc_3.496 YPR151C
          Length = 79

 Score = 64.3 bits (155), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 29/54 (53%), Positives = 42/54 (77%), Gaps = 2/54 (3%)

Query: 9  VRNSKSVLRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLF--RNGEL 60
          +R    + ++LPRVPTT+YL+ ++L  DI ++GYRPV+YP+KENPL   +NGEL
Sbjct: 1  MRGGSILCKNLPRVPTTKYLDKSKLKIDILYNGYRPVLYPMKENPLLYRQNGEL 54

>NCAS0F03570 Chr6 complement(711238..711930) [693 bp, 230 aa] {ON}
           Anc_3.496 YPR151C
          Length = 230

 Score = 64.7 bits (156), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 43/60 (71%), Gaps = 3/60 (5%)

Query: 12  SKSVLRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFRNGELKKKWEEQLRQD 71
           S ++ R LP+VP T YLE  +L  +I F+GY+P+MYPV+ENPLF+   LK K E+  R++
Sbjct: 114 SNNIFRKLPKVPMTRYLETKQLSKEILFAGYKPIMYPVRENPLFK---LKIKQEDAKREN 170

>NDAI0B05890 Chr2 complement(1423733..1424569) [837 bp, 278 aa] {ON}
           Anc_3.496 YPR151C
          Length = 278

 Score = 64.3 bits (155), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 28/53 (52%), Positives = 39/53 (73%), Gaps = 2/53 (3%)

Query: 4   LKQVVVRNSKSVLRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFR 56
           L   +++N+  + R +P+VP T+YLE   L  D+ +SGYRP+MYPVKENPLFR
Sbjct: 119 LAPCILQNN--IFRTMPKVPMTKYLETKELSQDMLYSGYRPIMYPVKENPLFR 169

>SAKL0F02618g Chr6 (225795..226556) [762 bp, 253 aa] {ON} similar
          to uniprot|Q06524 Saccharomyces cerevisiae YPR151C SUE1
          Mitochondrial protein required for degradation of
          unstable forms of cytochrome c
          Length = 253

 Score = 63.9 bits (154), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 38/56 (67%)

Query: 7  VVVRNSKSVLRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFRNGELKK 62
          ++ + +  + R LP+VPTT++LE   L  DI FSGYRPV YPVKENP F  G  +K
Sbjct: 14 MIKKKNSDIFRLLPKVPTTQFLEPRELTRDILFSGYRPVTYPVKENPFFNIGTQRK 69

>CAGL0L08426g Chr12 (926880..927302) [423 bp, 140 aa] {ON} similar
          to uniprot|Q06524 Saccharomyces cerevisiae YPR151c
          Length = 140

 Score = 55.8 bits (133), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 35/48 (72%)

Query: 15 VLRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFRNGELKK 62
          + R LP+VP T YLEN  L  D+ ++GYRP++YP++ENPL  +  +++
Sbjct: 7  IFRKLPKVPMTRYLENRLLSEDMLYNGYRPILYPMRENPLLCHSNVRE 54

>KLLA0E03983g Chr5 (363400..363975) [576 bp, 191 aa] {ON} similar
          to gnl|GLV|CAGL0L08426g Candida glabrata CAGL0L08426g
          and weakly similar to YPR151C uniprot|Q06524
          Saccharomyces cerevisiae YPR151C SUE1 Mitochondrial
          protein required for degradation of unstable forms of
          cytochrome c
          Length = 191

 Score = 54.7 bits (130), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 23/40 (57%), Positives = 30/40 (75%)

Query: 17 RDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFR 56
          R LPRVPTT +L    L  DI FSGYRP++ P+++NPLF+
Sbjct: 13 RQLPRVPTTRFLAPQELTADILFSGYRPIVSPLRDNPLFQ 52

>AFR315C Chr6 complement(1006937..1007170) [234 bp, 77 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YPR151C
          (SUE1)
          Length = 77

 Score = 48.1 bits (113), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (70%)

Query: 16 LRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFR 56
           R LPRVP+T++L   ++  DI FS +RP+ YPV +NPL R
Sbjct: 7  FRMLPRVPSTQHLPADKVRLDILFSRHRPLTYPVSQNPLIR 47

>KLLA0D06061g Chr4 (520082..520831) [750 bp, 249 aa] {ON} weakly
           similar to uniprot|Q99373 Saccharomyces cerevisiae
           YPL159C PET20 Protein required for respiratory growth
           and stability of the mitochondrial genome
          Length = 249

 Score = 40.4 bits (93), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 34/57 (59%), Gaps = 6/57 (10%)

Query: 6   QVVVRNSKSVLRD---LPRVPTTEYLENTRLYNDIFFSGYRPVMYP---VKENPLFR 56
           +++   +K + RD   LPRVPTTE++      +D+ +SGYRP++      KEN L +
Sbjct: 96  KIIKMATKKLSRDYSWLPRVPTTEHILREEFNSDMLYSGYRPIVVGDKNAKENKLMQ 152

>SAKL0H06380g Chr8 complement(563753..564412) [660 bp, 219 aa] {ON}
           similar to uniprot|Q99373 Saccharomyces cerevisiae
           YPL159C PET20 Protein required for respiratory growth
           and stability of the mitochondrial genome
          Length = 219

 Score = 38.1 bits (87), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 21/28 (75%)

Query: 19  LPRVPTTEYLENTRLYNDIFFSGYRPVM 46
           LP+ P+TE+L+   +  D+F+SGYRP+ 
Sbjct: 83  LPKAPSTEHLKLREISTDVFYSGYRPIF 110

>Skud_16.123 Chr16 complement(222359..223126) [768 bp, 255 aa] {ON}
           YPL159C (REAL)
          Length = 255

 Score = 37.7 bits (86), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 22/27 (81%)

Query: 19  LPRVPTTEYLENTRLYNDIFFSGYRPV 45
           LPRVP+T +L++T +  ++ +SGYRP+
Sbjct: 103 LPRVPSTSHLKHTDMTTNVLYSGYRPL 129

>TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.62
           YNL295W
          Length = 476

 Score = 37.7 bits (86), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 21/28 (75%)

Query: 19  LPRVPTTEYLENTRLYNDIFFSGYRPVM 46
           LPRVP+T+Y+ NT +  +  F+GYRP+ 
Sbjct: 75  LPRVPSTDYIPNTEVQTEGLFAGYRPLF 102

>Suva_16.151 Chr16 complement(260210..260971) [762 bp, 253 aa] {ON}
           YPL159C (REAL)
          Length = 253

 Score = 37.4 bits (85), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 22/27 (81%)

Query: 19  LPRVPTTEYLENTRLYNDIFFSGYRPV 45
           LPRVP+T +L+++ +  ++ +SGYRP+
Sbjct: 103 LPRVPSTSHLKHSDMTTNVLYSGYRPI 129

>TPHA0G01570 Chr7 complement(319949..320716) [768 bp, 255 aa] {ON}
           Anc_8.682 YPL159C
          Length = 255

 Score = 36.6 bits (83), Expect = 0.001,   Method: Composition-based stats.
 Identities = 17/41 (41%), Positives = 25/41 (60%), Gaps = 6/41 (14%)

Query: 19  LPRVPTTEYLENTRLYNDIFFSGYRPVMYPV------KENP 53
           LP+ PTT +L ++    D+F+SGYRP+   V      +ENP
Sbjct: 106 LPKAPTTHHLHSSEFNTDLFYSGYRPLSIDVNQLASEQENP 146

>YPL159C Chr16 complement(250907..251668) [762 bp, 253 aa] {ON}
           PET20Mitochondrial protein, required for respiratory
           growth under some conditions and for stability of the
           mitochondrial genome
          Length = 253

 Score = 35.8 bits (81), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 21/27 (77%)

Query: 19  LPRVPTTEYLENTRLYNDIFFSGYRPV 45
           LPRVP+T +L+ + +  ++ +SGYRP+
Sbjct: 103 LPRVPSTSHLKQSDMTTNVLYSGYRPL 129

>ZYRO0F07480g Chr6 (607194..607904) [711 bp, 236 aa] {ON} similar to
           uniprot|Q99373 Saccharomyces cerevisiae YPL159C PET20
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 236

 Score = 34.7 bits (78), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 19/28 (67%)

Query: 19  LPRVPTTEYLENTRLYNDIFFSGYRPVM 46
           LPRVP+T YL    + + I +SGYRP+ 
Sbjct: 88  LPRVPSTNYLRPRDMSSKILYSGYRPLF 115

>Smik_6.356 Chr6 (572523..573284) [762 bp, 253 aa] {ON} YPL159C
           (REAL)
          Length = 253

 Score = 34.3 bits (77), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 21/28 (75%)

Query: 19  LPRVPTTEYLENTRLYNDIFFSGYRPVM 46
           LP+VP+T +L+ + +  ++ +SGYRP+ 
Sbjct: 103 LPKVPSTSHLKQSDMTTNVLYSGYRPLF 130

>KNAG0J01760 Chr10 (320758..321534) [777 bp, 258 aa] {ON} Anc_8.682
           YPL159C
          Length = 258

 Score = 33.9 bits (76), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 20/27 (74%)

Query: 19  LPRVPTTEYLENTRLYNDIFFSGYRPV 45
           LP VP+T+++E   +  ++ +SGYRP+
Sbjct: 96  LPSVPSTQHIEANDMCTELLYSGYRPL 122

>YNL295W Chr14 (76946..78520) [1575 bp, 524 aa] {ON} Putative
           protein of unknown function
          Length = 524

 Score = 33.9 bits (76), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 20/28 (71%)

Query: 19  LPRVPTTEYLENTRLYNDIFFSGYRPVM 46
           +PRV +T+Y+ N  ++ +  F+GYRP+ 
Sbjct: 111 VPRVASTDYISNKEVHTEGLFAGYRPLF 138

>KAFR0H02380 Chr8 complement(455996..456658) [663 bp, 220 aa] {ON}
           Anc_8.682 YPL159C
          Length = 220

 Score = 32.7 bits (73), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (64%)

Query: 19  LPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKEN 52
           LPRVP+T  ++  +L  ++ FS YRP+   +K +
Sbjct: 91  LPRVPSTSNMDRKQLNTELLFSAYRPLSMDLKSD 124

>Kpol_1072.12 s1072 complement(24362..25030) [669 bp, 222 aa] {ON}
           complement(24362..25030) [669 nt, 223 aa]
          Length = 222

 Score = 32.3 bits (72), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 20/27 (74%)

Query: 19  LPRVPTTEYLENTRLYNDIFFSGYRPV 45
           LP+VP+ + L +  +  DIF+SG+RP+
Sbjct: 97  LPKVPSNKRLTHQDITTDIFYSGFRPL 123

>Kpol_1013.9 s1013 (15300..16085) [786 bp, 261 aa] {ON}
           (15300..16085) [786 nt, 262 aa]
          Length = 261

 Score = 32.3 bits (72), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 18/27 (66%)

Query: 19  LPRVPTTEYLENTRLYNDIFFSGYRPV 45
           LP+VP+TE L +  +     +SGYRP+
Sbjct: 112 LPKVPSTENLNHREIRTSALYSGYRPI 138

>Kwal_26.8828 s26 (960466..961137) [672 bp, 223 aa] {ON} YPL159C -
           Hypothetical ORF [contig 68] FULL
          Length = 223

 Score = 32.0 bits (71), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 22/34 (64%), Gaps = 1/34 (2%)

Query: 19  LPRVPTTEYLENTRLYNDIFFSGYRP-VMYPVKE 51
           LP+ P+T++L+   +   + +SGYRP V+ P  +
Sbjct: 85  LPKAPSTDHLKQRDVSTTLLYSGYRPFVLAPADQ 118

>Smik_14.36 Chr14 (61288..62862) [1575 bp, 524 aa] {ON} YNL295W
           (REAL)
          Length = 524

 Score = 32.0 bits (71), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 9/27 (33%), Positives = 21/27 (77%)

Query: 19  LPRVPTTEYLENTRLYNDIFFSGYRPV 45
           +P+V +T++++N  ++ +  F+GYRP+
Sbjct: 111 VPKVASTDHIQNKEVHTEGLFAGYRPL 137

>KLTH0D11396g Chr4 (931339..932016) [678 bp, 225 aa] {ON} similar to
           uniprot|Q99373 Saccharomyces cerevisiae YPL159C PET20
           Protein required for respiratory growth and stability of
           the mitochondrial genome
          Length = 225

 Score = 31.6 bits (70), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 20/28 (71%)

Query: 19  LPRVPTTEYLENTRLYNDIFFSGYRPVM 46
           LP+ P+T++L++  +   + +SGYRP +
Sbjct: 85  LPKAPSTDHLKHRDVSTTLLYSGYRPFV 112

>NCAS0A09940 Chr1 complement(1986687..1988171) [1485 bp, 494 aa]
          {ON} Anc_3.62 YNL295W
          Length = 494

 Score = 31.2 bits (69), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 20/28 (71%)

Query: 19 LPRVPTTEYLENTRLYNDIFFSGYRPVM 46
          +P+VPTT+Y+ +  +  +  F+GY+P+ 
Sbjct: 70 VPKVPTTDYIPSLEMQTEGLFAGYKPLF 97

>Kpol_1066.44 s1066 complement(74670..76109) [1440 bp, 479 aa] {ON}
           complement(74670..76109) [1440 nt, 480 aa]
          Length = 479

 Score = 31.2 bits (69), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 18/28 (64%)

Query: 19  LPRVPTTEYLENTRLYNDIFFSGYRPVM 46
           LPRVP+TE +    +  D  F+GYRP+ 
Sbjct: 74  LPRVPSTENIPVEEVQTDGLFAGYRPLF 101

>ZYRO0C02244g Chr3 complement(174640..176022) [1383 bp, 460 aa]
          {ON} similar to gnl|GLV|KLLA0A07447g Kluyveromyces
          lactis KLLA0A07447g and weakly similar to YNL295W
          uniprot|P48564 Saccharomyces cerevisiae YNL295W
          Hypothetical ORF
          Length = 460

 Score = 30.8 bits (68), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 18/28 (64%)

Query: 19 LPRVPTTEYLENTRLYNDIFFSGYRPVM 46
          +PRVP T+Y+    +  +  F+GYRP+ 
Sbjct: 58 VPRVPPTDYISAPEIQTEGLFAGYRPLF 85

>Ecym_2390 Chr2 complement(757433..758116) [684 bp, 227 aa] {ON}
           similar to Ashbya gossypii AAL087C
          Length = 227

 Score = 30.4 bits (67), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 17/27 (62%)

Query: 19  LPRVPTTEYLENTRLYNDIFFSGYRPV 45
            P  P TE+L+   +  D+ +SGYRP+
Sbjct: 89  FPVAPKTEHLKEGDIAVDLLYSGYRPL 115

>SAKL0C12342g Chr3 complement(1099949..1101607) [1659 bp, 552 aa]
           {ON} similar to uniprot|P48564 Saccharomyces cerevisiae
           YNL295W Hypothetical ORF
          Length = 552

 Score = 30.0 bits (66), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 23/34 (67%), Gaps = 2/34 (5%)

Query: 13  KSVLRDLPRVPTTEYLENTRLYNDIFFSGYRPVM 46
           KS+L  +P VP T+Y+ ++ +  +  F+GY+P+ 
Sbjct: 157 KSLL--VPHVPNTDYIPHSEIQTEGLFAGYKPLF 188

>TBLA0B03800 Chr2 complement(873861..874835) [975 bp, 324 aa] {ON}
           Anc_8.682 YPL159C
          Length = 324

 Score = 29.6 bits (65), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 19/27 (70%)

Query: 19  LPRVPTTEYLENTRLYNDIFFSGYRPV 45
           LP+VPT + L+   +  ++ +SGYRP+
Sbjct: 167 LPKVPTLKNLKQRDVMTNVLYSGYRPL 193

>TDEL0A06270 Chr1 (1098704..1099432) [729 bp, 242 aa] {ON} Anc_8.682
           YPL159C
          Length = 242

 Score = 29.6 bits (65), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 18/28 (64%)

Query: 19  LPRVPTTEYLENTRLYNDIFFSGYRPVM 46
           LPRVP+T  L+   +   + +SGYRP+ 
Sbjct: 96  LPRVPSTGNLKPRDMSMKVLYSGYRPLF 123

>KLLA0A07447g Chr1 (669272..670732) [1461 bp, 486 aa] {ON} similar
           to uniprot|P48564 Saccharomyces cerevisiae YNL295W
          Length = 486

 Score = 29.6 bits (65), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 11/28 (39%), Positives = 19/28 (67%)

Query: 19  LPRVPTTEYLENTRLYNDIFFSGYRPVM 46
           +P+VP+T+YL    L  +  F+GY+P+ 
Sbjct: 90  VPQVPSTDYLPREDLETEGLFAGYKPLF 117

>TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {ON}
           Anc_8.470 YDR244W
          Length = 549

 Score = 29.3 bits (64), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 21/40 (52%), Gaps = 3/40 (7%)

Query: 34  YNDIFFSGYRPVMYPVKENPLFR---NGELKKKWEEQLRQ 70
           YN    SG R +M P     + R   +GE+K  W+EQ ++
Sbjct: 118 YNTHMLSGPRMMMRPTNGASMMRQQQHGEVKTSWDEQFKE 157

>Skud_14.42 Chr14 (70507..72081) [1575 bp, 524 aa] {ON} YNL295W
           (REAL)
          Length = 524

 Score = 29.3 bits (64), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 19/28 (67%)

Query: 19  LPRVPTTEYLENTRLYNDIFFSGYRPVM 46
           +P+V +TEY+    ++ +  F+GYRP+ 
Sbjct: 111 VPKVASTEYIPIKEVHTEGLFAGYRPLF 138

>TPHA0D01290 Chr4 (268062..268718) [657 bp, 218 aa] {ON} Anc_8.682
           YPL159C
          Length = 218

 Score = 29.3 bits (64), Expect = 0.58,   Method: Composition-based stats.
 Identities = 12/37 (32%), Positives = 20/37 (54%)

Query: 19  LPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLF 55
           LP+VP T  + +  +  +  +SGYRP+    K+  L 
Sbjct: 95  LPKVPQTSSITHREITTNSLYSGYRPLFIDNKKGTLL 131

>CAGL0M02101g Chr13 complement(254024..254827) [804 bp, 267 aa] {ON}
           some similarities with uniprot|Q99373 Saccharomyces
           cerevisiae YPL159c
          Length = 267

 Score = 29.3 bits (64), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 24/41 (58%), Gaps = 3/41 (7%)

Query: 12  SKSVLRDLPRVPTTEYLENTRLYN---DIFFSGYRPVMYPV 49
           +K  + D   +P  E + +T+L N   ++ +SGYRP+ + V
Sbjct: 106 TKKKVYDYSTLPRVEQISDTKLKNMSTEVLYSGYRPLFFDV 146

>TPHA0I00720 Chr9 complement(145599..149669) [4071 bp, 1356 aa]
          {ON} Anc_8.777
          Length = 1356

 Score = 28.9 bits (63), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 31/55 (56%), Gaps = 4/55 (7%)

Query: 17 RDLPRVPT-TEYLENTR---LYNDIFFSGYRPVMYPVKENPLFRNGELKKKWEEQ 67
          RDL    + ++Y+EN +   +Y+  F SGY P+   +K     R  +L KKW+++
Sbjct: 19 RDLSYFKSYSQYIENLKDINVYSADFESGYTPLHITLKRGYFKRAFQLFKKWKDE 73

>NCAS0C01310 Chr3 complement(241103..241876) [774 bp, 257 aa] {ON}
           Anc_8.682
          Length = 257

 Score = 28.1 bits (61), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 18/33 (54%)

Query: 19  LPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKE 51
           LP+V     L +  +  DI +SGYRP+    K+
Sbjct: 90  LPKVEPITNLRHNEISTDILYSGYRPLFLNFKD 122

>Suva_13.249 Chr13 (392810..393361) [552 bp, 183 aa] {ON} YMR072W
          (REAL)
          Length = 183

 Score = 28.1 bits (61), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 34/69 (49%), Gaps = 16/69 (23%)

Query: 1  MQALKQVVVRNSKSVLRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFRNGEL 60
          ++A K+  +RN   +++  P+ PT+ Y         ++   YR  +  VKENP  R  E+
Sbjct: 26 LKASKRTQIRNE--LIKQGPKRPTSAYF--------LYLHDYRDQL--VKENPTLRPAEI 73

Query: 61 K----KKWE 65
               KKW+
Sbjct: 74 SKVAGKKWQ 82

>CAGL0I09922g Chr9 complement(947782..949287) [1506 bp, 501 aa] {ON}
           similar to uniprot|Q12096 Saccharomyces cerevisiae
           YOR320c
          Length = 501

 Score = 28.1 bits (61), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 7/54 (12%)

Query: 9   VRNSKSVLRDLPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFRNGELKK 62
           +RN K +   LP +P + YL + R+  +I  S           +PLF    LKK
Sbjct: 259 IRNGKEIYNHLPALPQSLYLNSDRVAKEILDSTSSA-------SPLFDADSLKK 305

>NCAS0C00800 Chr3 complement(140171..144250) [4080 bp, 1359 aa]
          {ON} Anc_8.777
          Length = 1359

 Score = 28.1 bits (61), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/47 (27%), Positives = 27/47 (57%)

Query: 22 VPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFRNGELKKKWEEQL 68
          +P  + L +  LY+    SGY P+   ++E  L ++ +L K W++++
Sbjct: 26 LPNLDNLRSIDLYSHELESGYSPLHVTLREGHLRKSFQLFKIWQDEM 72

>NDAI0K00830 Chr11 complement(185833..189627) [3795 bp, 1264 aa]
          {ON} Anc_8.777
          Length = 1264

 Score = 28.1 bits (61), Expect = 1.7,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 27/50 (54%)

Query: 19 LPRVPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFRNGELKKKWEEQL 68
          L  +PT  +L+    Y+    SGY P    ++E  L ++ +L K W+E++
Sbjct: 22 LSSLPTLSHLKAIDPYSQELESGYTPFHIILREGYLQKSFKLFKHWKEEI 71

>ZYRO0F12298g Chr6 (997873..1001961) [4089 bp, 1362 aa] {ON}
          conserved hypothetical protein
          Length = 1362

 Score = 28.1 bits (61), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 25/47 (53%)

Query: 22 VPTTEYLENTRLYNDIFFSGYRPVMYPVKENPLFRNGELKKKWEEQL 68
          +P    LE   LY+    SGY P+   +K+  L  + +L K W++++
Sbjct: 27 LPHMGELETIDLYSHDLESGYTPLHVTLKQGHLQNSFKLYKHWKDEV 73

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,184,658
Number of extensions: 306384
Number of successful extensions: 784
Number of sequences better than 10.0: 58
Number of HSP's gapped: 784
Number of HSP's successfully gapped: 58
Length of query: 71
Length of database: 53,481,399
Length adjustment: 44
Effective length of query: 27
Effective length of database: 48,436,095
Effective search space: 1307774565
Effective search space used: 1307774565
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)