Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0D029303.498ON27627613040.0
CAGL0L08404g3.498ON4102162148e-19
Kwal_47.188953.498ON4431732103e-18
Kpol_480.113.498ON4632352079e-18
TDEL0D056603.498ON4421622061e-17
Smik_16.4043.498ON4601592042e-17
KAFR0G037203.498ON4091472033e-17
TPHA0A056903.498ON4782302033e-17
AFR317C3.498ON3281701995e-17
KLLA0E03939g3.498ON4351612007e-17
KLTH0G02398g3.498ON4621601999e-17
YPR152C (URN1)3.498ON4651701927e-16
ZYRO0D09768g3.498ON4602321857e-15
Suva_16.4803.498ON4522431821e-14
KNAG0A079703.498ON3881681812e-14
Skud_16.4463.498ON4561451812e-14
Ecym_12313.498ON3292181713e-13
SAKL0F02552g3.498ON4782231697e-13
NDAI0B059003.498ON522691555e-11
NCAS0F035803.498ON4131041403e-09
TDEL0B072702.633ON64444750.66
TDEL0H041907.32ON778122730.97
TPHA0G014108.727ON750105721.4
KLLA0E18239g2.649ON57164693.3
CAGL0E05280gsingletonON35168675.3
Smik_7.247na 1ON34653666.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0D02930
         (276 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0D02930 Chr4 (719542..720372) [831 bp, 276 aa] {ON} Anc_3.49...   506   0.0  
CAGL0L08404g Chr12 (924898..926130) [1233 bp, 410 aa] {ON} simil...    87   8e-19
Kwal_47.18895 s47 complement(1018177..1019508) [1332 bp, 443 aa]...    86   3e-18
Kpol_480.11 s480 (21829..23220) [1392 bp, 463 aa] {ON} (21829..2...    84   9e-18
TDEL0D05660 Chr4 complement(1018928..1020256) [1329 bp, 442 aa] ...    84   1e-17
Smik_16.404 Chr16 complement(704003..705385) [1383 bp, 460 aa] {...    83   2e-17
KAFR0G03720 Chr7 complement(765353..766582) [1230 bp, 409 aa] {O...    83   3e-17
TPHA0A05690 Chr1 complement(1289284..1290720) [1437 bp, 478 aa] ...    83   3e-17
AFR317C Chr6 complement(1011817..1012803) [987 bp, 328 aa] {ON} ...    81   5e-17
KLLA0E03939g Chr5 (357695..359002) [1308 bp, 435 aa] {ON} simila...    82   7e-17
KLTH0G02398g Chr7 (186986..188374) [1389 bp, 462 aa] {ON} simila...    81   9e-17
YPR152C Chr16 complement(832061..833458) [1398 bp, 465 aa] {ON} ...    79   7e-16
ZYRO0D09768g Chr4 (826977..828359) [1383 bp, 460 aa] {ON} simila...    76   7e-15
Suva_16.480 Chr16 complement(828461..829819) [1359 bp, 452 aa] {...    75   1e-14
KNAG0A07970 Chr1 complement(1270860..1272026) [1167 bp, 388 aa] ...    74   2e-14
Skud_16.446 Chr16 complement(785650..787020) [1371 bp, 456 aa] {...    74   2e-14
Ecym_1231 Chr1 (476386..477375) [990 bp, 329 aa] {ON} similar to...    70   3e-13
SAKL0F02552g Chr6 (219380..220816) [1437 bp, 478 aa] {ON} simila...    70   7e-13
NDAI0B05900 Chr2 complement(1425195..1426763) [1569 bp, 522 aa] ...    64   5e-11
NCAS0F03580 Chr6 complement(712074..713315) [1242 bp, 413 aa] {O...    59   3e-09
TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa] ...    33   0.66 
TDEL0H04190 Chr8 complement(723994..726330) [2337 bp, 778 aa] {O...    33   0.97 
TPHA0G01410 Chr7 (286508..288760) [2253 bp, 750 aa] {ON} Anc_8.7...    32   1.4  
KLLA0E18239g Chr5 (1627093..1628808) [1716 bp, 571 aa] {ON} simi...    31   3.3  
CAGL0E05280g Chr5 complement(512208..513263) [1056 bp, 351 aa] {...    30   5.3  
Smik_7.247 Chr7 (415227..416267) [1041 bp, 346 aa] {ON} YGL039W ...    30   6.7  

>TBLA0D02930 Chr4 (719542..720372) [831 bp, 276 aa] {ON} Anc_3.498
           YPR152C
          Length = 276

 Score =  506 bits (1304), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/276 (91%), Positives = 253/276 (91%)

Query: 1   MKRKRDEEEQVMPNTRTKFEKSNLVEGYXXXXXXXXXXXXXXXXXXXXXXXDVLKELLED 60
           MKRKRDEEEQVMPNTRTKFEKSNLVEGY                       DVLKELLED
Sbjct: 1   MKRKRDEEEQVMPNTRTKFEKSNLVEGYSSSEEESKTESEIEIKSDSENEDDVLKELLED 60

Query: 61  IDASEDEIGNKETQFFELLDRSNIDCYSCWRLEAKKISDDPIFYNIPTDVEREKLFEQWC 120
           IDASEDEIGNKETQFFELLDRSNIDCYSCWRLEAKKISDDPIFYNIPTDVEREKLFEQWC
Sbjct: 61  IDASEDEIGNKETQFFELLDRSNIDCYSCWRLEAKKISDDPIFYNIPTDVEREKLFEQWC 120

Query: 121 YGKLHSREEETTQPQLALALPYHDLAEMICCFDIQSNTIYKDIRKANKKMVRQIDEKISK 180
           YGKLHSREEETTQPQLALALPYHDLAEMICCFDIQSNTIYKDIRKANKKMVRQIDEKISK
Sbjct: 121 YGKLHSREEETTQPQLALALPYHDLAEMICCFDIQSNTIYKDIRKANKKMVRQIDEKISK 180

Query: 181 NEQEKFGTKLLGILKYHDDASCQGLFEQVLEENGVDRVDVNTSFETLADLVDLERRMGIT 240
           NEQEKFGTKLLGILKYHDDASCQGLFEQVLEENGVDRVDVNTSFETLADLVDLERRMGIT
Sbjct: 181 NEQEKFGTKLLGILKYHDDASCQGLFEQVLEENGVDRVDVNTSFETLADLVDLERRMGIT 240

Query: 241 TENSVSRDARYFCLRNASRRFAGLERWVKGGEGGQV 276
           TENSVSRDARYFCLRNASRRFAGLERWVKGGEGGQV
Sbjct: 241 TENSVSRDARYFCLRNASRRFAGLERWVKGGEGGQV 276

>CAGL0L08404g Chr12 (924898..926130) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152c
          Length = 410

 Score = 87.0 bits (214), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 65/216 (30%), Positives = 116/216 (53%), Gaps = 21/216 (9%)

Query: 52  DVLKELLEDIDASEDEIGNKETQFFELLDRSNIDCYSCWRLEAKKISDDPIFYNIPTDVE 111
           D+ +EL +DI  S          +F L  +  ++ YS WR+E++K+S DP FY I  D  
Sbjct: 195 DITQELGQDIKDS----------YFALFAKHELNKYSTWRIESEKVSQDPEFYKIIDDAV 244

Query: 112 REKLFEQWCYGKLHSREEETTQPQLALALP--YHDLAEMICCFDIQSNTIYKDIRKANKK 169
           RE +FE+WC        EE+  P      P  YH L++++  +D++ +TI +DI K  K 
Sbjct: 245 RENIFEEWCNAGSVESNEESGDPGDDQFEPTKYHYLSQLVANYDLKPDTIPEDIIKDKKL 304

Query: 170 MVR-QIDEKISKNEQEKFGTKLLGILKYHDDASCQGLFEQVLEENGVDR---VDVNTSFE 225
           + + +I +  +K+EQ +F +K+L   K+      + +F+  ++   V +   +D +   +
Sbjct: 305 IKKYRIKDYTTKSEQRQFLSKMLAWYKHMSLEDRKQMFQTYIDRIPVGKYTDIDSDAQED 364

Query: 226 TLADLVDLERRMGI-TTENSVSRDARYFCLRNASRR 260
             + L++LE ++GI T+EN    D  Y+C+   S+R
Sbjct: 365 VESQLLELENQLGIPTSEN----DLEYYCIDLRSKR 396

>Kwal_47.18895 s47 complement(1018177..1019508) [1332 bp, 443 aa]
           {ON} YPR152C - Hypothetical ORF [contig 189] FULL
          Length = 443

 Score = 85.5 bits (210), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 88/173 (50%), Gaps = 23/173 (13%)

Query: 62  DASEDEIG--------NKETQFFELLDRSNIDCYSCWRLEAKKISDDPIFYNIPTDVERE 113
           DA  D++G        + + +F  L  +  +D YS W ++++KI DDP+FY I  D +R+
Sbjct: 193 DADVDDLGTVLPEHDYSNDAEFISLFSKYAVDPYSTWNMQSRKIRDDPLFYKITNDADRK 252

Query: 114 KLFEQWCYGKLHSREE-----------ETTQPQLALALP--YHDLAEMICCFDIQSNTIY 160
           +LFE WC  +  ++ E           +   P +    P  YH LA ++    I S+T+ 
Sbjct: 253 ELFENWCMNECSNQSEVPAIDEQIISSDDEDPAIDSLEPSRYHYLAHIVSKSKITSSTLP 312

Query: 161 KDIRKANKKMVRQ--IDEKISKNEQEKFGTKLLGILKYHDDASCQGLFEQVLE 211
           KDIR   K++ +Q  I + +SK EQ+ F +KLL   K         +F++ LE
Sbjct: 313 KDIRTDQKELFKQFRIKDSLSKREQDAFLSKLLFYYKRMTPEQRIAIFKRFLE 365

>Kpol_480.11 s480 (21829..23220) [1392 bp, 463 aa] {ON}
           (21829..23220) [1392 nt, 464 aa]
          Length = 463

 Score = 84.3 bits (207), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 67/235 (28%), Positives = 110/235 (46%), Gaps = 48/235 (20%)

Query: 58  LEDIDASEDEIGNKETQFFELLDRSNIDCYSCWRLEAKKISDDPIFYNIPTDVEREKLFE 117
           L+DID  +      ++ F  L +   +D YS WRL+ KKI + P ++ I  +  RE+LFE
Sbjct: 222 LDDIDLEK-----SKSLFTRLFEEFQLDPYSSWRLQLKKIQNHPDYFQITDNSTREELFE 276

Query: 118 QWCYGK------------------LHSREEETTQPQLALALPYHDLAEMICCFDIQSNTI 159
            WC  K                  L S EE+  +P       +H LA +I   DI ++TI
Sbjct: 277 SWCSSKFNGGKSNVTNFEGEDEETLTSDEEDDFEPT-----KFHYLAHIISKADIAADTI 331

Query: 160 YKDIRKANKKMVRQIDEK---ISKNEQEKFGTKLLGILKYHDDASCQGLFEQVLEEN--- 213
           + DI++ NK + ++   K    SK +QE F +KLL   K       + LF Q+L+EN   
Sbjct: 332 FLDIKENNKSLFKEFKIKDFIKSKKDQEAFSSKLLFFYKKFQLNERKNLFLQLLKENENL 391

Query: 214 -------------GVDRVDVNTSFETLADLVDLERRMGITTE-NSVSRDARYFCL 254
                         + + DV+ ++E    L+ +E+ +G+      ++ D +Y+ L
Sbjct: 392 IIPNINSNIEIVRHIIKNDVDEAYEIETQLLQIEKIIGLQNMLVDLANDPKYYIL 446

>TDEL0D05660 Chr4 complement(1018928..1020256) [1329 bp, 442 aa]
           {ON} Anc_3.498 YPR152C
          Length = 442

 Score = 84.0 bits (206), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 53/162 (32%), Positives = 80/162 (49%), Gaps = 26/162 (16%)

Query: 75  FFELLDRSNIDCYSCWRLEAKKISDDPIFYNIPTDVEREKLFEQWCYGKLHSREEETTQP 134
           FF+LL R   D YS W ++A+KI +DP+FY I  D  RE +FE+WC   ++     TT P
Sbjct: 209 FFQLLQRHQCDPYSTWSIQARKIQEDPLFYRITDDSIRESMFEEWCEKAIN----RTTNP 264

Query: 135 Q-------------------LALALPYHDLAEMICCFDIQSNTIYKDIRKANKKMVRQID 175
           Q                       LP+H LA ++   +I  +TI++DI+  NK   ++  
Sbjct: 265 QDLVDEDNLDDDSREEEEEDELEPLPFHYLAHIVSKANITPSTIFQDIKDQNKADFKKYK 324

Query: 176 EK---ISKNEQEKFGTKLLGILKYHDDASCQGLFEQVLEENG 214
            K    SK++QE F +KLL   K       + +F  +LE + 
Sbjct: 325 IKQFVKSKSQQETFVSKLLFYYKKFTLDERKEIFHDLLESHS 366

>Smik_16.404 Chr16 complement(704003..705385) [1383 bp, 460 aa] {ON}
           YPR152C (REAL)
          Length = 460

 Score = 83.2 bits (204), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 56/159 (35%), Positives = 91/159 (57%), Gaps = 8/159 (5%)

Query: 58  LEDIDASEDEIGNKETQFFELLDRSNIDCYSCWRLEAKKISDDPIFYNIPTDVEREKLFE 117
           L  IDA + + G + + FF+L DR  +D +S W L++KKI +DP FY I  D  RE LFE
Sbjct: 205 LNHIDADDIDEGRERSLFFQLCDRYKLDKFSTWSLQSKKIENDPEFYKIRDDTVREGLFE 264

Query: 118 QWCYGKLHSREEETTQPQLALALP--YHDLAEMIC-CFDIQSNTIYKDIRKANKKMVR-- 172
           +WC  + HS +E  ++ +  +  P  YH LA+++    +I  + I +DIRK  K + +  
Sbjct: 265 EWC--EKHSAKESDSEDESNVLEPTKYHYLAQIVAKAGNIAPDAIPQDIRKRQKALYKAY 322

Query: 173 QIDEKIS-KNEQEKFGTKLLGILKYHDDASCQGLFEQVL 210
           +I E +  K EQ++F ++LL   K  +    + +F+  L
Sbjct: 323 RIKEYVPLKREQDRFVSQLLFYYKTFNLEQRKTIFQDCL 361

>KAFR0G03720 Chr7 complement(765353..766582) [1230 bp, 409 aa] {ON}
           Anc_3.498 YPR152C
          Length = 409

 Score = 82.8 bits (203), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 48/147 (32%), Positives = 82/147 (55%), Gaps = 13/147 (8%)

Query: 62  DASEDEIGNKETQFFELLDRSNIDCYSCWRLEAKKISDDPIFYNIPTDVEREKLFEQWCY 121
           + +++ +   + +F EL DR  +D +S W +E  K+S DP FY +  D ERE LFE+WC 
Sbjct: 177 NVADEGLSGDKAKFMELFDRYGLDKFSEWSMEMNKVSKDPDFYLVTDDQEREDLFERWCS 236

Query: 122 GK-LHSREEETTQ---------PQLALALPYHDLAEMICCFDIQSNTIYKDIRKANKKMV 171
           G+ +HS  +E  +          +      +H L++++   +I+  TI++DI++ NK++ 
Sbjct: 237 GQGIHSTSDEEAKEGGEPEEHEERPLEPTKFHYLSQIVSKSEIRRTTIFQDIKRQNKRLF 296

Query: 172 RQIDEKI---SKNEQEKFGTKLLGILK 195
           ++   K    S  EQEKF +KLL   K
Sbjct: 297 KEYKIKDFIESSKEQEKFVSKLLFYYK 323

>TPHA0A05690 Chr1 complement(1289284..1290720) [1437 bp, 478 aa]
           {ON} Anc_3.498 YPR152C
          Length = 478

 Score = 82.8 bits (203), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 64/230 (27%), Positives = 109/230 (47%), Gaps = 49/230 (21%)

Query: 74  QFFELLDRSNIDCYSCWRLEAKKISDDPIFYNIPTDVEREKLFEQWCYGK---------- 123
           ++F+L ++  ++ +S W  ++K + DDP FY I  +  RE +FE+WC  K          
Sbjct: 232 KYFQLFEKYQLNSFSTWSNQSKVVMDDPDFYLITDNSLREDIFEEWCSRKHSHHNSITSV 291

Query: 124 ----------LHSREEETTQPQLA---------LALPYHDLAEMICCFDIQSNTIYKDIR 164
                      HS  E+     +A             YH L+ +I   +I  +TI++DI+
Sbjct: 292 DKDDQTDSSGAHSSAEDNLDDNVADQNEEEENLEPTKYHYLSHIISKANISPDTIFQDIK 351

Query: 165 KANKKMVRQ--IDEKI-SKNEQEKFGTKLLGILKYHDDASCQGLFEQVLEENGV------ 215
           K NKK+ +Q  I++ I SK + E F +KL+   K  D +  + +FE +LE+N        
Sbjct: 352 KDNKKLFKQFKINKFITSKRDLESFSSKLIFYYKKFDQSQRRDIFEGILEQNKTAINKHV 411

Query: 216 ----DRV------DVNTSFETLADLVDLERRMGIT-TENSVSRDARYFCL 254
               D+V       VN  FE    L+ LE  +G++ +   ++ D +Y+ L
Sbjct: 412 VEHSDKVLETLNTSVNEDFEKETQLLKLEDILGLSGSLEKLANDPKYYIL 461

>AFR317C Chr6 complement(1011817..1012803) [987 bp, 328 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR152C
          Length = 328

 Score = 81.3 bits (199), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 85/170 (50%), Gaps = 10/170 (5%)

Query: 62  DASEDEIGNKETQFFELLDRSNIDCYSCWRLEAKKISDDPIFYNIPTDVEREKLFEQWCY 121
           D   DE   K+ + + L +R+ +D YS W  E+ KIS D  FY +  D  R++LFEQWC 
Sbjct: 87  DRGNDETDGKKAELWALFERAELDPYSAWVFESAKISGDAAFYAVGDDEARQELFEQWCA 146

Query: 122 GKLHSR------EEETTQPQLALALPYHDLAEMICCFDIQSNTIYKDIRKANKKMVRQID 175
            K+         + E  +    +   +H LA ++    ++ +T+Y D+R+ +K++  Q++
Sbjct: 147 RKIADEGNAVLEDGEEAEEVELVPTRFHYLAHIVSKSTVRPDTVYSDVRREHKELFDQLE 206

Query: 176 EKI-SKNEQEKFGTKLLGILKYHDDASCQGLFEQVLEENGVDRVDVNTSF 224
             I  K EQ +F   LL   K  D A    +F ++L  +   R  +  +F
Sbjct: 207 VDILDKKEQRRFVAGLLFYYKKMDAALRGEVFRKLLHAH---RAAITAAF 253

>KLLA0E03939g Chr5 (357695..359002) [1308 bp, 435 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 435

 Score = 81.6 bits (200), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 48/161 (29%), Positives = 90/161 (55%), Gaps = 26/161 (16%)

Query: 72  ETQFFELLDRSNIDCYSCWRLEAKKISDDPIFYNIPTDVEREKLFEQWCYGKL------- 124
           E++F +LL+   +D YS W ++AK+I  DP +Y I ++ +R++LF+ WC  +L       
Sbjct: 203 ESKFIQLLNEIQLDPYSTWSIQAKRIMHDPRYYLITSNDKRDELFQTWCSQQLNNSNNDN 262

Query: 125 ---------HSREEE---TTQPQLALALPYHDLAEMICCFDIQSNTIYKDIRKANKKMVR 172
                    +S EE+   T +P       YH LA +I   +I   T++ +I+K NK + +
Sbjct: 263 ENNAQDSAENSDEEDSDVTLEPT-----KYHYLAHIISKANITPETLFSNIKKENKSLFK 317

Query: 173 --QIDEKISKNEQEKFGTKLLGILKYHDDASCQGLFEQVLE 211
             +I++ ++K EQE+F +K++   K  D+     LF+++++
Sbjct: 318 ELEINKTLTKKEQEQFASKVIAYYKRMDNLQRTELFKKMMK 358

>KLTH0G02398g Chr7 (186986..188374) [1389 bp, 462 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 462

 Score = 81.3 bits (199), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 83/160 (51%), Gaps = 24/160 (15%)

Query: 58  LEDIDASEDEIGNKETQFF-ELLDRSNIDCYSCWRLEAKKISDDPIFYNIPTDVEREKLF 116
           +ED++A+  +      Q F  L D  ++D YS W +++KKI D+P+FY + +D ER +LF
Sbjct: 208 IEDLNAASHQYNEATKQMFTSLFDEYDLDPYSTWNMQSKKICDNPLFYQVASDAERRELF 267

Query: 117 EQWCYGKLHSREEETTQPQLALALP-------------------YHDLAEMICCFDIQSN 157
           E WC  K+  + E+  +     A+                    YH LA ++   ++  +
Sbjct: 268 EDWCVAKV--KLEDVIEDPAHQAVSSDGDGDDDDTSTDELEPTRYHYLAHIVSKAEVAPS 325

Query: 158 TIYKDIRKANKKMVRQ--IDEKISKNEQEKFGTKLLGILK 195
           T+ +D+R   K++ +Q  I E + K +Q++F +KLL   K
Sbjct: 326 TLPRDLRSEQKQLFKQFKIKESLGKKQQDEFLSKLLFYYK 365

>YPR152C Chr16 complement(832061..833458) [1398 bp, 465 aa] {ON}
           URN1Putative protein of unknown function containing WW
           and FF domains; overexpression causes accumulation of
           cells in G1 phase
          Length = 465

 Score = 78.6 bits (192), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 60/170 (35%), Positives = 89/170 (52%), Gaps = 12/170 (7%)

Query: 75  FFELLDRSNIDCYSCWRLEAKKISDDPIFYNIPTDVEREKLFEQWC---YGKLHSRE--- 128
           FFEL DR  +D +S W L++KKI +DP FY I  D  RE LFE+WC    G   + E   
Sbjct: 219 FFELFDRYKLDKFSTWSLQSKKIENDPDFYKIRDDTVRESLFEEWCGERSGNATAEESDS 278

Query: 129 EETTQPQLALALP--YHDLAEMIC-CFDIQSNTIYKDIRKANKKMVR--QIDEKI-SKNE 182
           E+ ++    +  P  YH LA+++     I  +TI +DIRK  K + +  +I E I SK +
Sbjct: 279 EDNSEDDSEVLEPTKYHYLAQIVANAGTIAPDTIPQDIRKQQKALYKAYKIKEYIPSKRD 338

Query: 183 QEKFGTKLLGILKYHDDASCQGLFEQVLEENGVDRVDVNTSFETLADLVD 232
           Q+KF ++LL   K  D    + +F   L ++  D      S     +L+D
Sbjct: 339 QDKFVSQLLFYYKTFDLEQRKEIFCDCLRDHERDFTGAVESLRQDKELID 388

>ZYRO0D09768g Chr4 (826977..828359) [1383 bp, 460 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
          Length = 460

 Score = 75.9 bits (185), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 63/232 (27%), Positives = 105/232 (45%), Gaps = 38/232 (16%)

Query: 57  LLEDIDASEDEIGNKETQFFELLDRSNIDCYSCWRLEAKKISDDPIFYNIPTDVEREKLF 116
           + E ++   D  G+K+   ++L  R +++ YS W  E KKI DDP F  +  D  RE +F
Sbjct: 216 ITESVEEPVDISGDKKA-LWDLFTRYDLNPYSAWPFEMKKIRDDPDFLRVLDDSVREDVF 274

Query: 117 EQWCYGKLHSREEETTQP------------QLALALPYHDLAEMICCFDIQSNTIYKDIR 164
           E+WC    H+   +  +P            +      YH LA ++   +I   TI+ DI+
Sbjct: 275 EEWC---AHAISGDQVEPVDEIKSEDFDEEEDLEPTKYHYLAHIVSKSNITPTTIFMDIK 331

Query: 165 KANKKMVRQIDEK---ISKNEQEKFGTKLLGILKYHDDASCQGLFEQVLEENG------- 214
             NK   ++ + K    SK +QE F +KLL   K       + +F Q+L++NG       
Sbjct: 332 NDNKSSFKKYNIKDFLTSKKDQESFVSKLLFYYKRMKLEERKEVFVQLLKQNGKTIEENL 391

Query: 215 ---VDRV--------DVNTSFETLADLVDLERRMGITTENS-VSRDARYFCL 254
              +D+V        D N  +     L  +E+ MG+    S +  + +Y+ L
Sbjct: 392 SNDMDKVRHCLAQEIDSNDPYAVETKLFKMEKFMGLWGNLSDLVEEPKYYIL 443

>Suva_16.480 Chr16 complement(828461..829819) [1359 bp, 452 aa] {ON}
           YPR152C (REAL)
          Length = 452

 Score = 74.7 bits (182), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 67/243 (27%), Positives = 111/243 (45%), Gaps = 32/243 (13%)

Query: 57  LLEDIDASEDEIGNKETQFFELLDRSNIDCYSCWRLEAKKISDDPIFYNIPTDVEREKLF 116
           +++D++  +    N+   FF+L DR  +D +S W L+ KKI +DP FY +     RE LF
Sbjct: 195 IIDDLNQIDSGDVNERGLFFQLCDRYELDKFSTWSLQCKKIENDPDFYKVGDAAVRESLF 254

Query: 117 EQWCYGKLH----SREEETTQPQLALALPYHDLAEMICCFDIQSNTIYKDIRKANKKMVR 172
           E+WC         +  E+     L     +H LA+++   +I  + I +DIRK  K + +
Sbjct: 255 EEWCASASASASGNESEDEDDADLLEPTKFHYLAQIVAKAEIAPDCIPQDIRKQQKALFK 314

Query: 173 --QIDEKI-SKNEQEKFGTKLLGILKYHDDASCQGLFEQVLEENGVD--------RVDVN 221
             +I E + SK +Q++F ++LL   K       + +F++ L ++  D        R DV 
Sbjct: 315 AYRIKEYVPSKRDQDRFVSQLLFYYKTFSLEQRKEIFQECLRDHERDFACAVQSLRQDVG 374

Query: 222 TSF-------ETLAD-------LVDLERRMGITTENSVSRDARYFCLRNASRRFAGLERW 267
                      T AD       L+ +E R G+        D RY+ L     + AG  RW
Sbjct: 375 LISRWQAILRPTAADGASVEDALLSIEHRCGVGA--IALADPRYYVL-GILDKTAGWVRW 431

Query: 268 VKG 270
           +  
Sbjct: 432 LAA 434

>KNAG0A07970 Chr1 complement(1270860..1272026) [1167 bp, 388 aa]
           {ON} Anc_3.498 YPR152C
          Length = 388

 Score = 74.3 bits (181), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/168 (30%), Positives = 85/168 (50%), Gaps = 5/168 (2%)

Query: 75  FFELLDRSNIDCYSCWRLEAKKISDDPIFYNIPTDVEREKLFEQW-CYGKLHSREEETTQ 133
           +F L     +D YS W +E+ KIS+DP F+ I  D +RE++FE+W C G +   E+E   
Sbjct: 185 YFNLFSEYGLDKYSVWSIESLKISNDPRFHIISDDRQREEIFEEWCCSGVVDDSEDEGYS 244

Query: 134 PQLALALP--YHDLAEMICCFDIQSNTIYKDIRKANKKMVRQ--IDEKISKNEQEKFGTK 189
                  P  YH L++++    +   TI++DI++    + +Q  I + +SK EQE+F ++
Sbjct: 245 SGDDDLSPTKYHYLSQIVAKSTVTPTTIFQDIKQEKASLFKQYGIKQFLSKREQEQFVSQ 304

Query: 190 LLGILKYHDDASCQGLFEQVLEENGVDRVDVNTSFETLADLVDLERRM 237
           LL   K         LF + + E+    V   TS    A   D+E  +
Sbjct: 305 LLFYYKKFTLEERVQLFTKFIAESRTGTVPSPTSPADSATPEDIETNL 352

>Skud_16.446 Chr16 complement(785650..787020) [1371 bp, 456 aa] {ON}
           YPR152C (REAL)
          Length = 456

 Score = 74.3 bits (181), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 80/145 (55%), Gaps = 11/145 (7%)

Query: 57  LLEDIDASEDEIGNKETQFFELLDRSNIDCYSCWRLEAKKISDDPIFYNIPTDVEREKLF 116
           +++D++  +    ++   FF L DR  +D +S W L++KKI +DP FY I  D  RE  F
Sbjct: 197 IIDDLNQIDTGDADERGLFFRLFDRYELDKFSTWSLQSKKIENDPDFYTIGDDAVREGFF 256

Query: 117 EQWCYGKLHS---REEETTQPQLALAL---PYHDLAEMIC-CFDIQSNTIYKDIRKANKK 169
           E+WC G  HS     E +    +   L    YH LA+++     I  + + +DIRK  K+
Sbjct: 257 EEWC-GHEHSDSAAAEASGSEDVGDVLEPTKYHYLAQILAKAGTIPPDAVPQDIRKQQKE 315

Query: 170 MVR--QIDEKI-SKNEQEKFGTKLL 191
           + +  +I E + SK EQ+KF ++LL
Sbjct: 316 LYKAYRIKEYVPSKREQDKFVSQLL 340

>Ecym_1231 Chr1 (476386..477375) [990 bp, 329 aa] {ON} similar to
           Ashbya gossypii AFR317C
          Length = 329

 Score = 70.5 bits (171), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 97/218 (44%), Gaps = 33/218 (15%)

Query: 70  NKETQFFELLDRSNIDCYSCWRLEAKKISDDPIFYNIPTDVEREKLFEQWCYGKLHSREE 129
           ++  +F  L DR  ++ YS W L+++K+  DP FY +  D  R +LFE WC  KL     
Sbjct: 85  SEHARFIALFDRYELNPYSSWSLQSRKVQSDPEFYTLLDDETRRELFEDWCTMKLAKAGG 144

Query: 130 ETTQPQLAL----------------ALPYHDLAEMICCFDIQSNTIYKDIRKANKKMVR- 172
           +++                       + +H L+ ++    I+  T++ D++  NK + + 
Sbjct: 145 DSSASLTGEEEEEEDDDDDEDESLEPVKFHYLSHIVSKSTIKPQTVFSDVKTENKLLFKN 204

Query: 173 -QIDEKISKNEQEKFGTKLLGILKYHDDASCQGLFEQVL------EENGVDRVD------ 219
             IDE   K EQ +F + LL   K         +F+ +L      E N  D++       
Sbjct: 205 FNIDETHPKQEQRQFVSSLLFYYKKKSSKERVEIFKNLLDTKVKHEINNEDQLQQILDQE 264

Query: 220 --VNTSFETLADLVDLERRMGIT-TENSVSRDARYFCL 254
              N ++E  + L+ +E+ +G+  +   +  D +Y+ +
Sbjct: 265 NLPNDAYEIESQLITMEKYIGMHDSLRQLQEDIKYYVV 302

>SAKL0F02552g Chr6 (219380..220816) [1437 bp, 478 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 478

 Score = 69.7 bits (169), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 60/223 (26%), Positives = 101/223 (45%), Gaps = 46/223 (20%)

Query: 64  SEDEIGNKETQFFELLDRSNIDCYSCWRLEAKKISDDPIFYNIPTDVEREKLFEQWCYGK 123
           SE    + + +F  L D+ N+D YS W  +++KI+ DP FY +     R+ LFEQWC   
Sbjct: 216 SEPPQLDAKNRFTILFDKYNLDPYSMWEFQSRKINKDPDFYLVTNGSSRKDLFEQWCTET 275

Query: 124 LHS------------------REEETT---------------QPQLALALP--YHDLAEM 148
           + +                  +E E T               +P      P  +H L+ +
Sbjct: 276 IANSKDAISDANINENDADQRQESEATQKEEQEEKKEVEEDGEPDDENLEPTRFHYLSHI 335

Query: 149 ICCFDIQSNTIYKDIRKANKKMVR--QIDEKISKNEQEKFGTKLLGILKYHDDASCQGLF 206
           I    I+  TI+ DI+K NK + +  +I   + K +QE F +KLL   K  D    + +F
Sbjct: 336 ISKSSIEQTTIFLDIKKENKALFKTFRIKSSLKKKDQEDFASKLLFYYKRMDLEQRKLIF 395

Query: 207 EQVLEENGVDRVDVNTSFETLADLVDLERRMGITTENSVSRDA 249
           +++L    + ++D+  S     +L ++E+   I TE S   D+
Sbjct: 396 QKLL----LSKLDIIRS-----NLRNVEKLRDIATEQSTPADS 429

>NDAI0B05900 Chr2 complement(1425195..1426763) [1569 bp, 522 aa]
           {ON} Anc_3.498 YPR152C
          Length = 522

 Score = 64.3 bits (155), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 49/69 (71%), Gaps = 4/69 (5%)

Query: 59  EDIDASEDEIGNKETQFFELLDRSNIDCYSCWRLEAKKISDDP-IFYNIPTDVEREKLFE 117
           ++I+AS  ++   +  FFELLD++ +D YS W +++++I + P IFY+I  D ERE++FE
Sbjct: 246 DNINASVQKV---KQAFFELLDKNKLDMYSTWSVQSRRIIERPTIFYSISNDSEREEIFE 302

Query: 118 QWCYGKLHS 126
            WC  ++HS
Sbjct: 303 DWCRNRVHS 311

>NCAS0F03580 Chr6 complement(712074..713315) [1242 bp, 413 aa] {ON}
           Anc_3.498 YPR152C
          Length = 413

 Score = 58.5 bits (140), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 60/104 (57%), Gaps = 4/104 (3%)

Query: 74  QFFELLDRSNIDCYSCWRLEAKKISDDPIFYNIPTDVEREKLFEQWCYGKLHSREEETTQ 133
           + F L +  N+D YS W L+++KIS+   ++ +  D +RE++FE WC  K+    E+ ++
Sbjct: 189 RLFHLFESFNLDVYSTWSLQSRKISNQADYFLVHDDTQREEMFEDWCAMKVAQLPEDESE 248

Query: 134 PQLALALP--YHDLAEMICCF--DIQSNTIYKDIRKANKKMVRQ 173
            +     P  YH L+E++     +I ++T+  DI + ++ + +Q
Sbjct: 249 AEDDDYEPTKYHYLSEIMYQLRDEINADTVADDILRGHRPLFKQ 292

>TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa]
           {ON} Anc_2.633 YKL079W
          Length = 644

 Score = 33.5 bits (75), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (54%)

Query: 228 ADLVDLERRMGITTENSVSRDARYFCLRNASRRFAGLERWVKGG 271
           +D +D +  +GI+ EN+   +     L N +R  AG E+ VK G
Sbjct: 251 SDKIDKQNNLGISPENTKKINQSMVTLENVARSLAGTEQSVKNG 294

>TDEL0H04190 Chr8 complement(723994..726330) [2337 bp, 778 aa] {ON}
           Anc_7.32 YAL041W
          Length = 778

 Score = 32.7 bits (73), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 54/122 (44%), Gaps = 6/122 (4%)

Query: 159 IYKDIRKANKKMVRQIDEKISKNEQEKFGTKLLGI-LKY-HDDASCQGLFEQVLEENGVD 216
           I+       ++++R++      +EQ K   +L+    KY HD    +   +Q+LE N + 
Sbjct: 261 IFSTTHDIEEQLLRELQHVPINSEQSKIMKELVATERKYVHDLEILERYRKQLLESNLIT 320

Query: 217 RVDVNTSFETLADLVDLERRMGITTENSVSRDA---RYFCLRNASRRFAGL-ERWVKGGE 272
             ++   F  L+D +D +RR  I+ E +   DA   R   L   S+ F  L E W  G  
Sbjct: 321 TEELYMLFPNLSDAIDFQRRFLISLEINALIDAPKQRIGALFMHSKHFFKLYEPWSIGQN 380

Query: 273 GG 274
             
Sbjct: 381 AA 382

>TPHA0G01410 Chr7 (286508..288760) [2253 bp, 750 aa] {ON} Anc_8.727
           YMR212C
          Length = 750

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 50/105 (47%), Gaps = 8/105 (7%)

Query: 133 QPQLALALPYHDLAEMICCFDIQSNTIYKDIRKANKKMVRQIDEK--ISKNEQEKFGTKL 190
           QP +A  L + + A  +   D +  T YK   K NK +  + D K   S +   KF  + 
Sbjct: 490 QPSIAYYLYHENAAHFLGLSDYERQTEYK---KNNKVIFTKDDLKNFYSDSGSNKFSKRG 546

Query: 191 LGILKYHDDASCQGLFEQVLEENGVDRVDV-NTSFETLADLVDLE 234
           L IL  HD++S   L  Q    N   ++D+ NTS  + AD  +L+
Sbjct: 547 LQILMSHDNSSSVDLLSQSNFSNS--KLDIANTSMASDADTSNLQ 589

>KLLA0E18239g Chr5 (1627093..1628808) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33203 Saccharomyces cerevisiae YKL012W PRP40
           U1 snRNP protein involved in splicing interacts with the
           branchpoint-binding protein during the formation of the
           second commitment complex
          Length = 571

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 38/64 (59%), Gaps = 2/64 (3%)

Query: 72  ETQFFELLDR-SNIDCYSCWRLEAKKISDDPIF-YNIPTDVEREKLFEQWCYGKLHSREE 129
           E  F E+L++  NI  YS W+   ++I ++PI+ +++  + ++++ F+++     H  E 
Sbjct: 212 EQAFIEMLEKLPNIRYYSRWKTIKRQIMNEPIYKHSVIDEKQKKRTFQRYISSLQHEHEA 271

Query: 130 ETTQ 133
           + T+
Sbjct: 272 QHTK 275

>CAGL0E05280g Chr5 complement(512208..513263) [1056 bp, 351 aa] {ON}
           similar to uniprot|Q12068 Saccharomyces cerevisiae
           YOL151w GRE2 or uniprot|P53111 Saccharomyces cerevisiae
           YGL157w or uniprot|P53183 Saccharomyces cerevisiae
           YGL039w
          Length = 351

 Score = 30.4 bits (67), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 35/68 (51%), Gaps = 2/68 (2%)

Query: 202 CQGLFEQV--LEENGVDRVDVNTSFETLADLVDLERRMGITTENSVSRDARYFCLRNASR 259
            +G+ E +       V+RV V +SF +    VD+    G  TE+S ++D+   C  +A R
Sbjct: 111 TKGILESIKKYAAQTVERVVVTSSFASHTSTVDMCNTKGKITEDSWNQDSWENCQTDAVR 170

Query: 260 RFAGLERW 267
            + G +++
Sbjct: 171 AYFGSKKF 178

>Smik_7.247 Chr7 (415227..416267) [1041 bp, 346 aa] {ON} YGL039W
           (REAL)
          Length = 346

 Score = 30.0 bits (66), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 28/53 (52%)

Query: 215 VDRVDVNTSFETLADLVDLERRMGITTENSVSRDARYFCLRNASRRFAGLERW 267
           V++V + +S   LA   D++    + TE+S +RD    C  NA   + G +++
Sbjct: 124 VEKVVITSSVAALAAPADMQDVSSVVTEDSWNRDTWESCQTNAISAYCGSKKF 176

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 28,203,407
Number of extensions: 1195265
Number of successful extensions: 4096
Number of sequences better than 10.0: 37
Number of HSP's gapped: 4204
Number of HSP's successfully gapped: 39
Length of query: 276
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 168
Effective length of database: 41,097,471
Effective search space: 6904375128
Effective search space used: 6904375128
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)