Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0D029203.499ON25825812491e-176
CAGL0I10406g3.499ON25725710371e-143
KAFR0C020203.499ON25825810251e-141
TPHA0A057003.499ON25625710081e-139
SAKL0F02530g3.499ON25225310001e-138
NCAS0E007603.499ON2592499981e-137
KNAG0B007603.499ON2592609971e-137
NDAI0G008903.499ON2542529901e-136
TDEL0D056703.499ON2552539901e-136
Skud_7.4463.499ON2582599901e-136
Kpol_480.103.499ON2592489871e-136
Smik_6.2313.499ON2582489851e-135
YGR135W (PRE9)3.499ON2582489851e-135
Kwal_47.188983.499ON2512539821e-135
Suva_7.4233.499ON2582489781e-134
ZYRO0D09746g3.499ON2532569781e-134
KLTH0G02376g3.499ON2512539691e-133
Ecym_12303.499ON2512509571e-131
AFR318W3.499ON2512549491e-130
KLLA0E03917g3.499ON2492519431e-129
CAGL0F01199g7.120ON2541973952e-46
TPHA0I020707.120ON2561963874e-45
NCAS0F010307.120ON2531963866e-45
Kwal_YGOB_Anc_7.1207.120ON2541963866e-45
KLTH0F13574g7.120ON2541963841e-44
KLLA0B11836g7.120ON2541963841e-44
ZYRO0G04136g7.120ON2541793813e-44
KLTH0E16324g8.871ON2502113813e-44
KNAG0J001808.871ON2501993813e-44
SAKL0F04224g7.120ON2521963804e-44
TBLA0J019807.120ON2541963804e-44
AAR012C7.120ON2511963804e-44
NDAI0H015207.120ON2521963805e-44
ADL354W8.871ON2501993789e-44
Ecym_81518.871ON2501993771e-43
KLLA0D10373g8.871ON2502113761e-43
Smik_15.1297.120ON2541963762e-43
Kpol_1023.1087.120ON2541963753e-43
Suva_15.1317.120ON2541963743e-43
Ecym_12727.120ON2511763734e-43
YOL038W (PRE6)7.120ON2541963734e-43
KAFR0G030307.120ON2541963735e-43
Skud_15.1197.120ON2541963735e-43
KAFR0L020808.871ON2501993719e-43
CAGL0H07007g8.871ON2501993719e-43
Smik_13.438.871ON2502113711e-42
NDAI0E001608.871ON2502113701e-42
NDAI0C034005.64ON2632033711e-42
Suva_13.568.871ON2502113692e-42
TPHA0H011905.64ON2602033702e-42
Kpol_1062.25.64ON2602033683e-42
Skud_13.518.871ON2502113673e-42
TDEL0H033007.120ON2561983674e-42
Kwal_56.247805.64ON2622153674e-42
YML092C (PRE8)8.871ON2502113664e-42
KNAG0K004505.64ON2672033667e-42
NCAS0D013405.64ON2612033658e-42
TBLA0C066205.64ON2622153641e-41
TPHA0C049308.871ON2502123612e-41
Ecym_51005.64ON2612033623e-41
SAKL0H02068g5.64ON2612033623e-41
NCAS0B001508.871ON2501993604e-41
KLLA0A05093g5.64ON2622033614e-41
Kpol_455.58.871ON2492123604e-41
AER296W5.64ON2602033597e-41
KLTH0H00528g5.64ON2612033589e-41
KNAG0L010207.120ON2661813599e-41
ZYRO0A00616g8.871ON2502113571e-40
TDEL0B004008.871ON2502113562e-40
TDEL0G008805.64ON2602033562e-40
CAGL0I02442g5.64ON2602033553e-40
SAKL0D00440g8.871ON2502113543e-40
KAFR0B044405.64ON2602033535e-40
ZYRO0C11770g5.64ON2602033474e-39
YGR253C (PUP2)5.64ON2602033465e-39
Suva_7.5495.64ON2602033466e-39
Skud_7.5865.64ON2602033458e-39
Smik_16.545.64ON2602033458e-39
TBLA0C063408.871ON2562053396e-38
ADR401C7.20ON2792123233e-35
ZYRO0C00792g7.20ON2901953182e-34
Ecym_72334.110ON2461823108e-34
AGL089W4.110ON2461823101e-33
KLLA0A05027g4.110ON2462053082e-33
CAGL0H06105g7.20ON2901943102e-33
TBLA0E006907.20ON2781953084e-33
CAGL0M14003g5.1ON2332173037e-33
KLTH0D00902g7.20ON2771723067e-33
NCAS0I002507.20ON2921723061e-32
Kpol_538.407.20ON2741723051e-32
Ecym_50197.20ON2851723051e-32
KLTH0B09504g5.1ON2331923011e-32
KNAG0E011805.1ON2332102993e-32
KNAG0E002307.20ON2791883014e-32
Smik_15.5467.20ON2881723007e-32
KLLA0A03487g7.20ON2751812998e-32
NDAI0A087707.20ON2921952991e-31
TBLA0C040804.110ON2531922961e-31
KAFR0C050007.20ON2811722962e-31
Skud_15.5307.20ON2881722963e-31
TDEL0H043107.20ON2741722943e-31
Kwal_26.94835.1ON2331922914e-31
ZYRO0G10164g4.110ON2532172924e-31
YOR362C (PRE10)7.20ON2881722945e-31
NCAS0D023105.1ON2332172905e-31
TPHA0N002407.20ON2771722936e-31
Suva_8.4197.20ON2921722946e-31
Kwal_47.174934.110ON2461822916e-31
KLTH0E07788g4.110ON2462022908e-31
YGL011C (SCL1)4.110ON2521772891e-30
Suva_7.2704.110ON2521772891e-30
NDAI0I026405.1ON2332172862e-30
SAKL0D14476g7.20ON2811882875e-30
Smik_7.2794.110ON2521772855e-30
Kpol_1061.454.110ON2561772856e-30
Skud_7.2764.110ON2521772847e-30
SAKL0H21956g4.110ON2481922847e-30
TDEL0F023604.110ON2532002847e-30
YMR314W (PRE5)5.1ON2342182828e-30
ZYRO0C01144g5.1ON2332102828e-30
CAGL0A00407g4.110ON2541772821e-29
Skud_13.4885.1ON2342182802e-29
Smik_13.5315.1ON2342182792e-29
NCAS0A016404.110ON2531772803e-29
TPHA0F006704.110ON2571812803e-29
Suva_13.5075.1ON2342182783e-29
SAKL0H00946g5.1ON2332102741e-28
KAFR0I027205.1ON2351772723e-28
KLLA0A10153g5.1ON2331922713e-28
KNAG0D035404.110ON2521772715e-28
AGL336W5.1ON3061842745e-28
Kpol_1060.15.1ON2331922697e-28
Ecym_56505.1ON2331922697e-28
TBLA0C071905.1ON2332102681e-27
KAFR0F034304.110ON2521792682e-27
TPHA0A056705.1ON2332172662e-27
Kwal_27.97208.871ON1731362612e-27
TDEL0G002405.1ON2382222436e-24
NDAI0D035604.110ON172801591e-12
Kwal_26.68197.20ON1961341504e-11
TBLA0D017505.507ON2591821279e-08
SAKL0G04290g5.507ON2611811251e-07
Suva_8.2085.507ON2611821242e-07
TPHA0E020505.507ON2611701224e-07
Smik_15.3375.507ON2611601224e-07
KAFR0C053005.507ON2611811216e-07
NDAI0C011705.507ON2631641199e-07
Skud_15.3215.507ON2611601181e-06
Kwal_47.187485.507ON2631681172e-06
KNAG0B038005.507ON2611821172e-06
YOR157C (PUP1)5.507ON2611601162e-06
TDEL0A037105.507ON2611811153e-06
Ecym_54585.507ON2581671144e-06
ZYRO0D12034g5.507ON2611701127e-06
Kpol_534.575.216ON2151721109e-06
CAGL0L04312g5.507ON2611671111e-05
Kpol_2002.1095.216ON2151721101e-05
Kpol_218.15.507ON2611591101e-05
NCAS0H024805.507ON2641881102e-05
KLLA0A02233g5.507ON2621591073e-05
KLLA0F12936g5.216ON2151721063e-05
AAR119W5.507ON2591751074e-05
KLTH0G03168g5.507ON2631661074e-05
KAFR0B006507.480ON2411731031e-04
AGL324W7.480ON2431531002e-04
AAL172C5.216ON215168992e-04
Skud_16.3883.417ON2871691003e-04
KNAG0A075203.417ON2871731003e-04
Smik_16.3433.417ON2871691003e-04
Suva_16.4293.417ON2871691003e-04
CAGL0F04477g7.480ON242158993e-04
NCAS0A148807.480ON241173984e-04
NDAI0J006007.480ON241175984e-04
YPR103W (PRE2)3.417ON287169985e-04
AEL326C3.417ON285169985e-04
TBLA0F017603.417ON287173986e-04
KLLA0E05633g7.480ON240145976e-04
NCAS0A114403.417ON287169976e-04
TDEL0C055403.417ON287173978e-04
KLTH0D03058g3.417ON287173968e-04
TDEL0C034407.480ON241180968e-04
ZYRO0B10142g5.216ON215171940.001
TBLA0F026807.480ON241153940.001
TPHA0M017503.417ON286169940.002
Kwal_33.151935.216ON193167920.002
Ecym_82765.216ON215168930.002
Suva_2.777.480ON241159930.002
KLLA0F08228g3.417ON285169930.002
SAKL0F15092g7.480ON261178930.002
Smik_10.2785.216ON216171910.003
NDAI0A048603.417ON287169920.003
SAKL0B09262g3.417ON287169910.004
CAGL0G01804g3.417ON286169910.004
Kwal_26.72733.417ON287169910.005
ZYRO0G17842g7.480ON244151900.005
KNAG0F035907.480ON248158900.005
NDAI0C024205.216ON216170890.005
Skud_10.2225.216ON215171890.005
TDEL0E041305.216ON219168890.006
YBL041W (PRE7)7.480ON241177890.007
KLTH0B03102g5.216ON215171880.007
Smik_2.737.480ON241177890.007
TPHA0N007405.216ON216172880.008
YJL001W (PRE3)5.216ON215171880.008
ZYRO0C17688g3.417ON287173880.009
Suva_12.805.216ON215171870.009
Kwal_55.198827.480ON242153870.010
Ecym_26143.417ON285169870.012
TBLA0C062005.216ON216170860.013
Kpol_1018.1443.417ON288169870.013
Ecym_71717.480ON242153860.013
Kpol_1028.927.480ON242158860.013
KLTH0E01826g7.480ON242158860.016
KAFR0D042103.417ON287169860.018
TPHA0E029905.216ON216172850.019
Skud_2.617.480ON241159850.022
SAKL0G12584g5.216ON21573830.030
TPHA0E004207.480ON241153830.037
NCAS0A014805.216ON21672820.041
KNAG0H024505.216ON216169800.071
CAGL0D03058g5.216ON21573780.13
KAFR0C063505.216ON21672780.14
Kwal_23.29492.191ON161769750.52
Smik_7.1736.159ON34942721.2
TPHA0C015707.162ON195166663.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0D02920
         (258 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0D02920 Chr4 complement(718377..719153) [777 bp, 258 aa] {ON...   485   e-176
CAGL0I10406g Chr9 complement(1030282..1031055) [774 bp, 257 aa] ...   404   e-143
KAFR0C02020 Chr3 (400697..401473) [777 bp, 258 aa] {ON} Anc_3.49...   399   e-141
TPHA0A05700 Chr1 (1291206..1291976) [771 bp, 256 aa] {ON} Anc_3....   392   e-139
SAKL0F02530g Chr6 complement(218391..219149) [759 bp, 252 aa] {O...   389   e-138
NCAS0E00760 Chr5 (139964..140743) [780 bp, 259 aa] {ON} Anc_3.499     389   e-137
KNAG0B00760 Chr2 complement(141533..142312) [780 bp, 259 aa] {ON...   388   e-137
NDAI0G00890 Chr7 complement(186538..187302) [765 bp, 254 aa] {ON...   385   e-136
TDEL0D05670 Chr4 (1020517..1021284) [768 bp, 255 aa] {ON} Anc_3....   385   e-136
Skud_7.446 Chr7 (740583..741359) [777 bp, 258 aa] {ON} YGR135W (...   385   e-136
Kpol_480.10 s480 complement(20212..20991) [780 bp, 259 aa] {ON} ...   384   e-136
Smik_6.231 Chr6 (379282..380058) [777 bp, 258 aa] {ON} YGR135W (...   384   e-135
YGR135W Chr7 (761392..762168) [777 bp, 258 aa] {ON}  PRE9Alpha 3...   384   e-135
Kwal_47.18898 s47 (1019765..1020520) [756 bp, 251 aa] {ON} YGR13...   382   e-135
Suva_7.423 Chr7 (731573..732349) [777 bp, 258 aa] {ON} YGR135W (...   381   e-134
ZYRO0D09746g Chr4 complement(825992..826753) [762 bp, 253 aa] {O...   381   e-134
KLTH0G02376g Chr7 complement(185961..186716) [756 bp, 251 aa] {O...   377   e-133
Ecym_1230 Chr1 complement(475398..476153) [756 bp, 251 aa] {ON} ...   373   e-131
AFR318W Chr6 (1013015..1013770) [756 bp, 251 aa] {ON} Syntenic h...   370   e-130
KLLA0E03917g Chr5 complement(356540..357289) [750 bp, 249 aa] {O...   367   e-129
CAGL0F01199g Chr6 complement(124304..125068) [765 bp, 254 aa] {O...   156   2e-46
TPHA0I02070 Chr9 (460632..461402) [771 bp, 256 aa] {ON} Anc_7.12...   153   4e-45
NCAS0F01030 Chr6 (202937..203698) [762 bp, 253 aa] {ON} Anc_7.120     153   6e-45
Kwal_YGOB_Anc_7.120 s55 complement(642281..643010,643097..643131...   153   6e-45
KLTH0F13574g Chr6 complement(1116049..1116778,1116859..1116893) ...   152   1e-44
KLLA0B11836g Chr2 (1034800..1035564) [765 bp, 254 aa] {ON} highl...   152   1e-44
ZYRO0G04136g Chr7 complement(335007..335771) [765 bp, 254 aa] {O...   151   3e-44
KLTH0E16324g Chr5 (1450336..1450379,1450467..1451175) [753 bp, 2...   151   3e-44
KNAG0J00180 Chr10 (20275..21027) [753 bp, 250 aa] {ON} Anc_8.871...   151   3e-44
SAKL0F04224g Chr6 (335860..335894,335967..336690) [759 bp, 252 a...   150   4e-44
TBLA0J01980 Chr10 (468588..469352) [765 bp, 254 aa] {ON} Anc_7.1...   150   4e-44
AAR012C Chr1 complement(364905..365625,365693..365727) [756 bp, ...   150   4e-44
NDAI0H01520 Chr8 (363987..364745) [759 bp, 252 aa] {ON} Anc_7.120     150   5e-44
ADL354W Chr4 (85188..85231,85297..86005) [753 bp, 250 aa] {ON} S...   150   9e-44
Ecym_8151 Chr8 (318925..318968,319052..319760) [753 bp, 250 aa] ...   149   1e-43
KLLA0D10373g Chr4 complement(876175..876927) [753 bp, 250 aa] {O...   149   1e-43
Smik_15.129 Chr15 (221503..222267) [765 bp, 254 aa] {ON} YOL038W...   149   2e-43
Kpol_1023.108 s1023 (252377..253141) [765 bp, 254 aa] {ON} (2523...   149   3e-43
Suva_15.131 Chr15 (227798..228562) [765 bp, 254 aa] {ON} YOL038W...   148   3e-43
Ecym_1272 Chr1 (552861..552895,553024..553744) [756 bp, 251 aa] ...   148   4e-43
YOL038W Chr15 (255337..256101) [765 bp, 254 aa] {ON}  PRE6Alpha ...   148   4e-43
KAFR0G03030 Chr7 complement(630616..631380) [765 bp, 254 aa] {ON...   148   5e-43
Skud_15.119 Chr15 (214242..215006) [765 bp, 254 aa] {ON} YOL038W...   148   5e-43
KAFR0L02080 Chr12 (395922..396674) [753 bp, 250 aa] {ON} Anc_8.8...   147   9e-43
CAGL0H07007g Chr8 complement(694778..695530) [753 bp, 250 aa] {O...   147   9e-43
Smik_13.43 Chr13 complement(83092..83844) [753 bp, 250 aa] {ON} ...   147   1e-42
NDAI0E00160 Chr5 complement(10576..11328) [753 bp, 250 aa] {ON} ...   147   1e-42
NDAI0C03400 Chr3 complement(779360..780151) [792 bp, 263 aa] {ON...   147   1e-42
Suva_13.56 Chr13 complement(87087..87839) [753 bp, 250 aa] {ON} ...   146   2e-42
TPHA0H01190 Chr8 complement(263603..264385) [783 bp, 260 aa] {ON...   147   2e-42
Kpol_1062.2 s1062 (5124..5906) [783 bp, 260 aa] {ON} (5124..5906...   146   3e-42
Skud_13.51 Chr13 complement(85368..86120) [753 bp, 250 aa] {ON} ...   145   3e-42
TDEL0H03300 Chr8 complement(552725..553495) [771 bp, 256 aa] {ON...   145   4e-42
Kwal_56.24780 s56 complement(1144302..1145090) [789 bp, 262 aa] ...   145   4e-42
YML092C Chr13 complement(85987..86739) [753 bp, 250 aa] {ON}  PR...   145   4e-42
KNAG0K00450 Chr11 complement(75675..76478) [804 bp, 267 aa] {ON}...   145   7e-42
NCAS0D01340 Chr4 (244060..244845) [786 bp, 261 aa] {ON} Anc_5.64      145   8e-42
TBLA0C06620 Chr3 complement(1598566..1599354) [789 bp, 262 aa] {...   144   1e-41
TPHA0C04930 Chr3 (1064804..1065556) [753 bp, 250 aa] {ON} Anc_8....   143   2e-41
Ecym_5100 Chr5 complement(221199..221984) [786 bp, 261 aa] {ON} ...   144   3e-41
SAKL0H02068g Chr8 (202802..203587) [786 bp, 261 aa] {ON} highly ...   144   3e-41
NCAS0B00150 Chr2 complement(10879..11631) [753 bp, 250 aa] {ON} ...   143   4e-41
KLLA0A05093g Chr1 (454423..455211) [789 bp, 262 aa] {ON} highly ...   143   4e-41
Kpol_455.5 s455 (4683..5432) [750 bp, 249 aa] {ON} (4683..5432) ...   143   4e-41
AER296W Chr5 (1181448..1182230) [783 bp, 260 aa] {ON} Syntenic h...   142   7e-41
KLTH0H00528g Chr8 (57753..58538) [786 bp, 261 aa] {ON} highly si...   142   9e-41
KNAG0L01020 Chr12 complement(188232..189032) [801 bp, 266 aa] {O...   142   9e-41
ZYRO0A00616g Chr1 complement(41163..41915) [753 bp, 250 aa] {ON}...   142   1e-40
TDEL0B00400 Chr2 (73242..73994) [753 bp, 250 aa] {ON} Anc_8.871 ...   141   2e-40
TDEL0G00880 Chr7 (179880..180662) [783 bp, 260 aa] {ON} Anc_5.64...   141   2e-40
CAGL0I02442g Chr9 complement(216120..216902) [783 bp, 260 aa] {O...   141   3e-40
SAKL0D00440g Chr4 complement(37327..38035,38098..38141) [753 bp,...   140   3e-40
KAFR0B04440 Chr2 (923770..924552) [783 bp, 260 aa] {ON} Anc_5.64...   140   5e-40
ZYRO0C11770g Chr3 complement(920017..920799) [783 bp, 260 aa] {O...   138   4e-39
YGR253C Chr7 complement(998358..999140) [783 bp, 260 aa] {ON}  P...   137   5e-39
Suva_7.549 Chr7 complement(953986..954768) [783 bp, 260 aa] {ON}...   137   6e-39
Skud_7.586 Chr7 complement(972832..973614) [783 bp, 260 aa] {ON}...   137   8e-39
Smik_16.54 Chr16 (97704..98486) [783 bp, 260 aa] {ON} YGR253C (R...   137   8e-39
TBLA0C06340 Chr3 complement(1530163..1530933) [771 bp, 256 aa] {...   135   6e-38
ADR401C Chr4 complement(1425757..1426593,1426655..1426657) [840 ...   129   3e-35
ZYRO0C00792g Chr3 (60472..61344) [873 bp, 290 aa] {ON} highly si...   127   2e-34
Ecym_7233 Chr7 (485803..486543) [741 bp, 246 aa] {ON} similar to...   124   8e-34
AGL089W Chr7 (539399..540139) [741 bp, 246 aa] {ON} Syntenic hom...   124   1e-33
KLLA0A05027g Chr1 (450398..451138) [741 bp, 246 aa] {ON} highly ...   123   2e-33
CAGL0H06105g Chr8 (596149..597021) [873 bp, 290 aa] {ON} highly ...   124   2e-33
TBLA0E00690 Chr5 complement(136929..137765) [837 bp, 278 aa] {ON...   123   4e-33
CAGL0M14003g Chr13 (1383750..1384451) [702 bp, 233 aa] {ON} high...   121   7e-33
KLTH0D00902g Chr4 (86268..86270,86342..87172) [834 bp, 277 aa] {...   122   7e-33
NCAS0I00250 Chr9 complement(31100..31978) [879 bp, 292 aa] {ON} ...   122   1e-32
Kpol_538.40 s538 complement(86524..87348) [825 bp, 274 aa] {ON} ...   122   1e-32
Ecym_5019 Chr5 (42044..42046,42100..42954) [858 bp, 285 aa] {ON}...   122   1e-32
KLTH0B09504g Chr2 complement(779619..780320) [702 bp, 233 aa] {O...   120   1e-32
KNAG0E01180 Chr5 complement(232483..233184) [702 bp, 233 aa] {ON...   119   3e-32
KNAG0E00230 Chr5 (29197..30036) [840 bp, 279 aa] {ON} Anc_7.20 Y...   120   4e-32
Smik_15.546 Chr15 complement(963345..964211) [867 bp, 288 aa] {O...   120   7e-32
KLLA0A03487g Chr1 (316951..316953,317116..317940) [828 bp, 275 a...   119   8e-32
NDAI0A08770 Chr1 complement(2020318..2021196) [879 bp, 292 aa] {...   119   1e-31
TBLA0C04080 Chr3 complement(987028..987789) [762 bp, 253 aa] {ON...   118   1e-31
KAFR0C05000 Chr3 (992380..993225) [846 bp, 281 aa] {ON} Anc_7.20...   118   2e-31
Skud_15.530 Chr15 complement(955569..956435) [867 bp, 288 aa] {O...   118   3e-31
TDEL0H04310 Chr8 complement(742283..743107) [825 bp, 274 aa] {ON...   117   3e-31
Kwal_26.9483 s26 complement(1238526..1239227) [702 bp, 233 aa] {...   116   4e-31
ZYRO0G10164g Chr7 (814364..815125) [762 bp, 253 aa] {ON} highly ...   117   4e-31
YOR362C Chr15 complement(1017880..1018746) [867 bp, 288 aa] {ON}...   117   5e-31
NCAS0D02310 Chr4 complement(433672..434373) [702 bp, 233 aa] {ON...   116   5e-31
TPHA0N00240 Chr14 (44110..44943) [834 bp, 277 aa] {ON} Anc_7.20 ...   117   6e-31
Suva_8.419 Chr8 complement(753633..754511) [879 bp, 292 aa] {ON}...   117   6e-31
Kwal_47.17493 s47 (426759..427499) [741 bp, 246 aa] {ON} YGL011C...   116   6e-31
KLTH0E07788g Chr5 (715745..716485) [741 bp, 246 aa] {ON} highly ...   116   8e-31
YGL011C Chr7 complement(474489..475247) [759 bp, 252 aa] {ON}  S...   115   1e-30
Suva_7.270 Chr7 complement(465865..466623) [759 bp, 252 aa] {ON}...   115   1e-30
NDAI0I02640 Chr9 (613923..614624) [702 bp, 233 aa] {ON} Anc_5.1       114   2e-30
SAKL0D14476g Chr4 complement(1189461..1190303,1190367..1190369) ...   115   5e-30
Smik_7.279 Chr7 complement(466525..467283) [759 bp, 252 aa] {ON}...   114   5e-30
Kpol_1061.45 s1061 complement(125355..126125) [771 bp, 256 aa] {...   114   6e-30
Skud_7.276 Chr7 complement(477638..478396) [759 bp, 252 aa] {ON}...   114   7e-30
SAKL0H21956g Chr8 (1918407..1919153) [747 bp, 248 aa] {ON} highl...   114   7e-30
TDEL0F02360 Chr6 complement(436203..436964) [762 bp, 253 aa] {ON...   114   7e-30
YMR314W Chr13 (901709..902413) [705 bp, 234 aa] {ON}  PRE5Alpha ...   113   8e-30
ZYRO0C01144g Chr3 complement(78422..79123) [702 bp, 233 aa] {ON}...   113   8e-30
CAGL0A00407g Chr1 (41556..42320) [765 bp, 254 aa] {ON} highly si...   113   1e-29
Skud_13.488 Chr13 (875208..875912) [705 bp, 234 aa] {ON} YMR314W...   112   2e-29
Smik_13.531 Chr13 (884471..885172) [702 bp, 234 aa] {ON} YMR314W...   112   2e-29
NCAS0A01640 Chr1 complement(320645..321406) [762 bp, 253 aa] {ON...   112   3e-29
TPHA0F00670 Chr6 (153895..154668) [774 bp, 257 aa] {ON} Anc_4.11...   112   3e-29
Suva_13.507 Chr13 (884695..885399) [705 bp, 234 aa] {ON} YMR314W...   111   3e-29
SAKL0H00946g Chr8 (106740..107441) [702 bp, 233 aa] {ON} highly ...   110   1e-28
KAFR0I02720 Chr9 (551846..552553) [708 bp, 235 aa] {ON} Anc_5.1 ...   109   3e-28
KLLA0A10153g Chr1 complement(892398..893099) [702 bp, 233 aa] {O...   108   3e-28
KNAG0D03540 Chr4 complement(648200..648958) [759 bp, 252 aa] {ON...   108   5e-28
AGL336W Chr7 (81511..82431) [921 bp, 306 aa] {ON} Syntenic homol...   110   5e-28
Kpol_1060.1 s1060 complement(1850..2551) [702 bp, 233 aa] {ON} c...   108   7e-28
Ecym_5650 Chr5 complement(1313015..1313716) [702 bp, 233 aa] {ON...   108   7e-28
TBLA0C07190 Chr3 (1742456..1743157) [702 bp, 233 aa] {ON} Anc_5....   107   1e-27
KAFR0F03430 Chr6 complement(682440..683198) [759 bp, 252 aa] {ON...   107   2e-27
TPHA0A05670 Chr1 (1284623..1285324) [702 bp, 233 aa] {ON}             107   2e-27
Kwal_27.9720 s27 complement(34522..35043) [522 bp, 173 aa] {ON} ...   105   2e-27
TDEL0G00240 Chr7 complement(46296..47012) [717 bp, 238 aa] {ON} ...    98   6e-24
NDAI0D03560 Chr4 complement(848282..848800) [519 bp, 172 aa] {ON...    66   1e-12
Kwal_26.6819 s26 (77152..77742) [591 bp, 196 aa] {ON} YOR362C (P...    62   4e-11
TBLA0D01750 Chr4 complement(430768..431547) [780 bp, 259 aa] {ON...    54   9e-08
SAKL0G04290g Chr7 (354481..355266) [786 bp, 261 aa] {ON} highly ...    53   1e-07
Suva_8.208 Chr8 complement(380119..380904) [786 bp, 261 aa] {ON}...    52   2e-07
TPHA0E02050 Chr5 complement(426185..426970) [786 bp, 261 aa] {ON...    52   4e-07
Smik_15.337 Chr15 complement(586945..587730) [786 bp, 261 aa] {O...    52   4e-07
KAFR0C05300 Chr3 (1062416..1063201) [786 bp, 261 aa] {ON} Anc_5....    51   6e-07
NDAI0C01170 Chr3 complement(235314..236105) [792 bp, 263 aa] {ON...    50   9e-07
Skud_15.321 Chr15 complement(579715..580500) [786 bp, 261 aa] {O...    50   1e-06
Kwal_47.18748 s47 complement(955252..956043) [792 bp, 263 aa] {O...    50   2e-06
KNAG0B03800 Chr2 complement(729075..729860) [786 bp, 261 aa] {ON...    50   2e-06
YOR157C Chr15 complement(630966..631751) [786 bp, 261 aa] {ON}  ...    49   2e-06
TDEL0A03710 Chr1 (663138..663923) [786 bp, 261 aa] {ON} Anc_5.50...    49   3e-06
Ecym_5458 Chr5 (940918..941694) [777 bp, 258 aa] {ON} similar to...    49   4e-06
ZYRO0D12034g Chr4 (1020703..1021488) [786 bp, 261 aa] {ON} highl...    48   7e-06
Kpol_534.57 s534 (145742..146389) [648 bp, 215 aa] {ON} (145742....    47   9e-06
CAGL0L04312g Chr12 complement(504465..505250) [786 bp, 261 aa] {...    47   1e-05
Kpol_2002.109 s2002 (258951..259598) [648 bp, 215 aa] {ON} (2589...    47   1e-05
Kpol_218.1 s218 complement(238..1023) [786 bp, 261 aa] {ON} comp...    47   1e-05
NCAS0H02480 Chr8 (491249..492043) [795 bp, 264 aa] {ON} Anc_5.507      47   2e-05
KLLA0A02233g Chr1 complement(198766..199554) [789 bp, 262 aa] {O...    46   3e-05
KLLA0F12936g Chr6 complement(1191839..1192421,1192526..1192590) ...    45   3e-05
AAR119W Chr1 (557434..558213) [780 bp, 259 aa] {ON} Syntenic hom...    46   4e-05
KLTH0G03168g Chr7 (249621..250412) [792 bp, 263 aa] {ON} highly ...    46   4e-05
KAFR0B00650 Chr2 (129107..129832) [726 bp, 241 aa] {ON} Anc_7.48...    44   1e-04
AGL324W Chr7 (102113..102844) [732 bp, 243 aa] {ON} Syntenic hom...    43   2e-04
AAL172C Chr1 complement(39647..40229,40286..40350) [648 bp, 215 ...    43   2e-04
Skud_16.388 Chr16 (696682..697545) [864 bp, 287 aa] {ON} YPR103W...    43   3e-04
KNAG0A07520 Chr1 (1176893..1177756) [864 bp, 287 aa] {ON} Anc_3....    43   3e-04
Smik_16.343 Chr16 (609756..610619) [864 bp, 287 aa] {ON} YPR103W...    43   3e-04
Suva_16.429 Chr16 (739867..740730) [864 bp, 287 aa] {ON} YPR103W...    43   3e-04
CAGL0F04477g Chr6 complement(446420..447148) [729 bp, 242 aa] {O...    43   3e-04
NCAS0A14880 Chr1 complement(2932325..2933050) [726 bp, 241 aa] {...    42   4e-04
NDAI0J00600 Chr10 (125252..125977) [726 bp, 241 aa] {ON} Anc_7.4...    42   4e-04
YPR103W Chr16 (732349..733212) [864 bp, 287 aa] {ON}  PRE2Beta 5...    42   5e-04
AEL326C Chr5 complement(37422..38279) [858 bp, 285 aa] {ON} Synt...    42   5e-04
TBLA0F01760 Chr6 complement(439214..440077) [864 bp, 287 aa] {ON...    42   6e-04
KLLA0E05633g Chr5 complement(502868..503590) [723 bp, 240 aa] {O...    42   6e-04
NCAS0A11440 Chr1 (2263605..2264468) [864 bp, 287 aa] {ON} Anc_3....    42   6e-04
TDEL0C05540 Chr3 (988954..989817) [864 bp, 287 aa] {ON} Anc_3.41...    42   8e-04
KLTH0D03058g Chr4 complement(293867..294730) [864 bp, 287 aa] {O...    42   8e-04
TDEL0C03440 Chr3 complement(603757..604482) [726 bp, 241 aa] {ON...    42   8e-04
ZYRO0B10142g Chr2 complement(793497..794079,794163..794227) [648...    41   0.001
TBLA0F02680 Chr6 complement(643543..644268) [726 bp, 241 aa] {ON...    41   0.001
TPHA0M01750 Chr13 (361278..362138) [861 bp, 286 aa] {ON} Anc_3.4...    41   0.002
Kwal_33.15193 s33 (1004538..1005119) [582 bp, 193 aa] {ON} YJL00...    40   0.002
Ecym_8276 Chr8 complement(558691..559273,559391..559455) [648 bp...    40   0.002
Suva_2.77 Chr2 (141199..141924) [726 bp, 241 aa] {ON} YBL041W (R...    40   0.002
KLLA0F08228g Chr6 complement(770578..771435) [858 bp, 285 aa] {O...    40   0.002
SAKL0F15092g Chr6 (1215605..1216390) [786 bp, 261 aa] {ON} highl...    40   0.002
Smik_10.278 Chr10 (432298..432362,432479..433064) [651 bp, 216 a...    40   0.003
NDAI0A04860 Chr1 complement(1110021..1110884) [864 bp, 287 aa] {...    40   0.003
SAKL0B09262g Chr2 (784068..784931) [864 bp, 287 aa] {ON} highly ...    40   0.004
CAGL0G01804g Chr7 complement(166048..166908) [861 bp, 286 aa] {O...    40   0.004
Kwal_26.7273 s26 complement(291172..292035) [864 bp, 287 aa] {ON...    40   0.005
ZYRO0G17842g Chr7 complement(1467229..1467963) [735 bp, 244 aa] ...    39   0.005
KNAG0F03590 Chr6 complement(674528..675274) [747 bp, 248 aa] {ON...    39   0.005
NDAI0C02420 Chr3 complement(555130..555780) [651 bp, 216 aa] {ON...    39   0.005
Skud_10.222 Chr10 (402675..402739,402859..403441) [648 bp, 215 a...    39   0.005
TDEL0E04130 Chr5 complement(771594..772188,772248..772312) [660 ...    39   0.006
YBL041W Chr2 (141247..141972) [726 bp, 241 aa] {ON}  PRE7Beta 6 ...    39   0.007
KLTH0B03102g Chr2 complement(242293..242875,242960..243024) [648...    39   0.007
Smik_2.73 Chr2 (135009..135734) [726 bp, 241 aa] {ON} YBL041W (R...    39   0.007
TPHA0N00740 Chr14 (164750..165400) [651 bp, 216 aa] {ON} Anc_5.2...    39   0.008
YJL001W Chr10 (435163..435227,435344..435926) [648 bp, 215 aa] {...    39   0.008
ZYRO0C17688g Chr3 (1375873..1376736) [864 bp, 287 aa] {ON} highl...    39   0.009
Suva_12.80 Chr12 (117572..117636,117754..118336) [648 bp, 215 aa...    38   0.009
Kwal_55.19882 s55 (163845..164573) [729 bp, 242 aa] {ON} YBL041W...    38   0.010
Ecym_2614 Chr2 (1185603..1186460) [858 bp, 285 aa] {ON} similar ...    38   0.012
TBLA0C06200 Chr3 (1503862..1504512) [651 bp, 216 aa] {ON} Anc_5....    38   0.013
Kpol_1018.144 s1018 complement(382038..382904) [867 bp, 288 aa] ...    38   0.013
Ecym_7171 Chr7 complement(353212..353940) [729 bp, 242 aa] {ON} ...    38   0.013
Kpol_1028.92 s1028 (211095..211823) [729 bp, 242 aa] {ON} (21109...    38   0.013
KLTH0E01826g Chr5 (173841..174569) [729 bp, 242 aa] {ON} highly ...    38   0.016
KAFR0D04210 Chr4 (829098..829961) [864 bp, 287 aa] {ON} Anc_3.41...    38   0.018
TPHA0E02990 Chr5 complement(628441..629091) [651 bp, 216 aa] {ON...    37   0.019
Skud_2.61 Chr2 (125091..125816) [726 bp, 241 aa] {ON} YBL041W (R...    37   0.022
SAKL0G12584g Chr7 complement(1072410..1072992,1073073..1073137) ...    37   0.030
TPHA0E00420 Chr5 (71900..72625) [726 bp, 241 aa] {ON} Anc_7.480 ...    37   0.037
NCAS0A01480 Chr1 complement(288201..288851) [651 bp, 216 aa] {ON...    36   0.041
KNAG0H02450 Chr8 complement(449110..449695,449971..450035) [651 ...    35   0.071
CAGL0D03058g Chr4 complement(317022..317669) [648 bp, 215 aa] {O...    35   0.13 
KAFR0C06350 Chr3 complement(1270967..1271552,1271634..1271698) [...    35   0.14 
Kwal_23.2949 s23 (85646..90499) [4854 bp, 1617 aa] {ON} YOR093C ...    33   0.52 
Smik_7.173 Chr7 (308539..309588) [1050 bp, 349 aa] {ON} YGL100W ...    32   1.2  
TPHA0C01570 Chr3 complement(360745..361332) [588 bp, 195 aa] {ON...    30   3.9  

>TBLA0D02920 Chr4 complement(718377..719153) [777 bp, 258 aa] {ON}
           Anc_3.499 YGR135W
          Length = 258

 Score =  485 bits (1249), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 242/258 (93%), Positives = 242/258 (93%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60

Query: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120
           ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ
Sbjct: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120

Query: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180
           SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY
Sbjct: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180

Query: 181 KDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELSXXXXXXXXXXXXXXXXYNPAEIKQLL 240
           KDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELS                YNPAEIKQLL
Sbjct: 181 KDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELSIIKIDKENDNKIIQKIYNPAEIKQLL 240

Query: 241 IKFGINKKNDEDEDVEMK 258
           IKFGINKKNDEDEDVEMK
Sbjct: 241 IKFGINKKNDEDEDVEMK 258

>CAGL0I10406g Chr9 complement(1030282..1031055) [774 bp, 257 aa]
           {ON} highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135w proteasome subunit Y13
          Length = 257

 Score =  404 bits (1037), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 200/257 (77%), Positives = 221/257 (85%), Gaps = 1/257 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT+IGIM+ +GIVL AERK+TS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMTSEGIVLAAERKVTSTLLEQD 60

Query: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120
              EKLYKL+D+ T+AVAGLTADAEILIN AR  AQNYL TYNEEIPVE+LV+KLSDIKQ
Sbjct: 61  TSTEKLYKLNDRTTVAVAGLTADAEILINTARIHAQNYLKTYNEEIPVEMLVRKLSDIKQ 120

Query: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180
            YTQ+GGLRP+GVSFIYAGYDD  G QLYTSNPSGNYTGWKAIS+GANTSAAQTLLQMDY
Sbjct: 121 GYTQYGGLRPYGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELSXXXXXXXXXXXXXXXXYNPAEIKQLL 240
           KD+M L+DA+EL LKTLSKTTDSS+LTYDR+E +                + PAEIKQLL
Sbjct: 181 KDEMTLDDAVELALKTLSKTTDSSSLTYDRLEFA-TLKKKGETEEFEQKIFKPAEIKQLL 239

Query: 241 IKFGINKKNDEDEDVEM 257
           IK GI+KK+DEDEDVEM
Sbjct: 240 IKTGISKKSDEDEDVEM 256

>KAFR0C02020 Chr3 (400697..401473) [777 bp, 258 aa] {ON} Anc_3.499
           YGR135W
          Length = 258

 Score =  399 bits (1025), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 199/258 (77%), Positives = 218/258 (84%), Gaps = 1/258 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT+IGIM+KDGIVL AERK+TS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60

Query: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120
              EKLYKL+DKIT+AVAGLTADAEILIN AR  AQNYL TYNE+IPVEILV++LSDIKQ
Sbjct: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180
            YTQHGGLRPFGVSFIYAGYD+  G QLYTSNPSGNYTGWKAIS+GANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELSXXXXXXXXXXXXXXXXYNPAEIKQLL 240
           KD++ L+DAMEL LKTLSK TDSS LTYDR+E +                + P EIK LL
Sbjct: 181 KDEITLDDAMELALKTLSKVTDSSTLTYDRLEFA-TIKKGKTNDKIYQKIFTPDEIKSLL 239

Query: 241 IKFGINKKNDEDEDVEMK 258
           +K GI+KK +EDED EMK
Sbjct: 240 VKTGISKKENEDEDTEMK 257

>TPHA0A05700 Chr1 (1291206..1291976) [771 bp, 256 aa] {ON} Anc_3.499
           YGR135W
          Length = 256

 Score =  392 bits (1008), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 195/257 (75%), Positives = 215/257 (83%), Gaps = 2/257 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT+IGIM++DGIVL AERK+TS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60

Query: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120
              EKLYKL+D IT+AVAGLTADAEILIN AR FAQNYL TYNE+IPVE+LV+KLSDIKQ
Sbjct: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120

Query: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180
            YTQHGGLRPFGVSFIYAGYD+ LG QL+TSNPSGNYTGWKAIS+GANTSAAQTLLQM++
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180

Query: 181 KDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELSXXXXXXXXXXXXXXXXYNPAEIKQLL 240
           KDD+ L  A+EL LKTLSKTTDSS LTYDRVE +                Y P EIKQLL
Sbjct: 181 KDDIKLEGAIELALKTLSKTTDSSALTYDRVEFA--TIKKGENNKVYQKIYKPEEIKQLL 238

Query: 241 IKFGINKKNDEDEDVEM 257
            K GI KK+++ ED  M
Sbjct: 239 SKAGITKKSEDGEDTAM 255

>SAKL0F02530g Chr6 complement(218391..219149) [759 bp, 252 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 252

 Score =  389 bits (1000), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 194/253 (76%), Positives = 214/253 (84%), Gaps = 2/253 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT+IGIM+ DGIVL AERK+TSKLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSKLLEQD 60

Query: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120
             +EKLYKL+D IT+AVAGLTADAEILIN AR +AQNYL TYNEEIPVEILV++LSDIKQ
Sbjct: 61  TSSEKLYKLNDNITVAVAGLTADAEILINTARVYAQNYLQTYNEEIPVEILVRRLSDIKQ 120

Query: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180
            YTQHGGLRPFGVSFIYAGYD+  G QLYTSNPSGNY+GWKAIS+GANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELSXXXXXXXXXXXXXXXXYNPAEIKQLL 240
           KD +NL+ A+EL LKTLSKTTDSS LT+DR+E +                Y P EI+ LL
Sbjct: 181 KDGINLDGAIELALKTLSKTTDSSALTHDRIEFA--TIKKGSNGQLYQKIYKPQEIQTLL 238

Query: 241 IKFGINKKNDEDE 253
            K GI KK+DEDE
Sbjct: 239 SKTGITKKDDEDE 251

>NCAS0E00760 Chr5 (139964..140743) [780 bp, 259 aa] {ON} Anc_3.499
          Length = 259

 Score =  389 bits (998), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 192/249 (77%), Positives = 214/249 (85%), Gaps = 1/249 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT+IGIM+ DG+VL AERK+TS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60

Query: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120
              EKLYKL+DKIT+AVAGLTADAEILIN AR +AQ+YL TYNEEIPVEILV++LSDIKQ
Sbjct: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120

Query: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180
            YTQHGGLRPFGVSFIYAGYDD  G QLYTSNPSGNYTGWKAIS+GANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELSXXXXXXXXXXXXXXXXYNPAEIKQLL 240
           KD+M L+DA+EL LKTLSKTTDSS+LTYD++EL+                Y P E+K+LL
Sbjct: 181 KDNMKLDDAIELALKTLSKTTDSSSLTYDKLELA-TIKKGTTTDEVYQKIYKPEELKELL 239

Query: 241 IKFGINKKN 249
           +K GI KK+
Sbjct: 240 LKTGITKKS 248

>KNAG0B00760 Chr2 complement(141533..142312) [780 bp, 259 aa] {ON}
           Anc_3.499 YGR135W
          Length = 259

 Score =  388 bits (997), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 194/260 (74%), Positives = 215/260 (82%), Gaps = 3/260 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT+IG++++DGIV+ AERK+TS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60

Query: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120
              EKLY+L+DKI +AVAGLTADAEILIN AR   QNYL TY E+IPVE+LVK++SDIKQ
Sbjct: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120

Query: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180
           SYTQHGGLRPFGVSFIYAG DD  G QLYTSNPSGNYTGWKAIS+GANTSAAQTLLQMDY
Sbjct: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELSXXXXXXXXXXXXXXXXYNPAEIKQLL 240
           KD++ L +A EL LKTLSKTTDSS LTYDRVE S                Y P+EIKQLL
Sbjct: 181 KDEITLEEATELALKTLSKTTDSSALTYDRVEFS-TIKRGKEEGQVIQKIYKPSEIKQLL 239

Query: 241 IKFGINKKN--DEDEDVEMK 258
           +K GI KK+  D D DVEMK
Sbjct: 240 VKSGITKKDAEDGDADVEMK 259

>NDAI0G00890 Chr7 complement(186538..187302) [765 bp, 254 aa] {ON}
           Anc_3.499
          Length = 254

 Score =  385 bits (990), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 194/252 (76%), Positives = 212/252 (84%), Gaps = 1/252 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT IGIM  DGIVL AERK+TS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60

Query: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120
              EKLYKL+DKIT+AVAGLTADAEILIN AR  AQNYL TYNE+IPVEILV++LSDIKQ
Sbjct: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180
            YTQHGGLRPFGVSFIYAGYDD  G QLYTSNPSGNYTGWKAIS+GANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELSXXXXXXXXXXXXXXXXYNPAEIKQLL 240
           KDDM L++A+EL LKTLSKTTDSS+LTYD++E +                Y P EIK+LL
Sbjct: 181 KDDMRLDEAIELALKTLSKTTDSSSLTYDKLEFA-TIKKGKNDGEVYQKIYKPDEIKELL 239

Query: 241 IKFGINKKNDED 252
           IK G+ KK D++
Sbjct: 240 IKTGVTKKKDDE 251

>TDEL0D05670 Chr4 (1020517..1021284) [768 bp, 255 aa] {ON} Anc_3.499
           YGR135W
          Length = 255

 Score =  385 bits (990), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 192/253 (75%), Positives = 212/253 (83%), Gaps = 2/253 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT+IGIM+ DGIVL AERK+TSKLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60

Query: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120
              EKLY+L+DKIT+AVAGLTADAEILIN AR +AQNYL TYNE+IPVEILVK+LSDIKQ
Sbjct: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120

Query: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180
            YTQHGGLRPFGVSFIYAGYDD  G QLYTSNPSGNYTGWKAIS+GANTSAAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180

Query: 181 KDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELSXXXXXXXXXXXXXXXXYNPAEIKQLL 240
           KDD+ L  A+EL LKTLSKTTDSS LT DR+E +                + P EI+ LL
Sbjct: 181 KDDVKLEGAIELALKTLSKTTDSSALTNDRIEFA--TIQKAPDGKLYQKIFKPEEIQSLL 238

Query: 241 IKFGINKKNDEDE 253
           +K GI KK+ +DE
Sbjct: 239 VKHGITKKHHDDE 251

>Skud_7.446 Chr7 (740583..741359) [777 bp, 258 aa] {ON} YGR135W
           (REAL)
          Length = 258

 Score =  385 bits (990), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 194/259 (74%), Positives = 217/259 (83%), Gaps = 2/259 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT+IGIM+ DGIVL AERK+TS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120
              EKLYKL+DKI +AVAGLTADAEILIN AR  AQNYL TYNE+IPVEILV++LSDIKQ
Sbjct: 61  TSTEKLYKLNDKIAVAVAGLTADAEILINTARVHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180
            YTQHGGLRPFGVSFIYAG+DD  G QLYTSNPSGNYTGWKAIS+GANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGHDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELSXXXXXXXXXXXXXXXXYNPAEIKQLL 240
           K+DM ++ A++L LKTLSKTTDSS LTYDR+E +                + P EIK LL
Sbjct: 181 KEDMKVDGAIDLALKTLSKTTDSSALTYDRLEFA-TIRKGPNDGEVYQKIFKPQEIKDLL 239

Query: 241 IKFGINKKNDEDE-DVEMK 258
           +K GI+KK+++DE D EMK
Sbjct: 240 VKTGISKKDEDDEADQEMK 258

>Kpol_480.10 s480 complement(20212..20991) [780 bp, 259 aa] {ON}
           complement(20212..20991) [780 nt, 260 aa]
          Length = 259

 Score =  384 bits (987), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 191/248 (77%), Positives = 209/248 (84%), Gaps = 2/248 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT+IGIM+ DGIVL AERK+TS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120
              EK+Y+L+DKIT+AVAGLTADAEILIN AR  AQ YL TYNEEIPVEILV++LSDIKQ
Sbjct: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120

Query: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180
            YTQHGGLRPFGVSFIYAGYDD  G QLYTSNPSGNYTGWKAIS+GANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELSXXXXXXXXXXXXXXXXYNPAEIKQLL 240
           KDD+ +++A+EL LKTLSKTTDSS LTYDRVE +                + P EIKQLL
Sbjct: 181 KDDIKVDEAIELALKTLSKTTDSSALTYDRVEFA--TIKKGENDKIYQKIFKPEEIKQLL 238

Query: 241 IKFGINKK 248
           +K GI KK
Sbjct: 239 LKTGITKK 246

>Smik_6.231 Chr6 (379282..380058) [777 bp, 258 aa] {ON} YGR135W
           (REAL)
          Length = 258

 Score =  384 bits (985), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 191/248 (77%), Positives = 209/248 (84%), Gaps = 1/248 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT+IGIM+ DGIVL AERK+TS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120
              EKLYKL+DKI++AVAGLTADAEILIN AR  AQNYL TYNE+IPVEILV++LSDIKQ
Sbjct: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180
            YTQHGGLRPFGVSFIYAGYDD  G QLYTSNPSGNYTGWKAIS+GANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELSXXXXXXXXXXXXXXXXYNPAEIKQLL 240
           KDDM ++DA++L LKTLSKTTDSS LTYDR+E +                + P EIK LL
Sbjct: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFA-TIRKGVNDGEVYQKIFKPQEIKDLL 239

Query: 241 IKFGINKK 248
           +K GI KK
Sbjct: 240 VKTGITKK 247

>YGR135W Chr7 (761392..762168) [777 bp, 258 aa] {ON}  PRE9Alpha 3
           subunit of the 20S proteasome, the only nonessential 20S
           subunit; may be replaced by the alpha 4 subunit (Pre6p)
           under stress conditions to create a more active
           proteasomal isoform
          Length = 258

 Score =  384 bits (985), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 191/248 (77%), Positives = 208/248 (83%), Gaps = 1/248 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT+IGIM+ DGIVL AERK+TS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120
              EKLYKL+DKI +AVAGLTADAEILIN AR  AQNYL TYNE+IPVEILV++LSDIKQ
Sbjct: 61  TSTEKLYKLNDKIAVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180
            YTQHGGLRPFGVSFIYAGYDD  G QLYTSNPSGNYTGWKAIS+GANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELSXXXXXXXXXXXXXXXXYNPAEIKQLL 240
           KDDM ++DA+EL LKTLSKTTDSS LTYDR+E +                + P EIK +L
Sbjct: 181 KDDMKVDDAIELALKTLSKTTDSSALTYDRLEFA-TIRKGANDGEVYQKIFKPQEIKDIL 239

Query: 241 IKFGINKK 248
           +K GI KK
Sbjct: 240 VKTGITKK 247

>Kwal_47.18898 s47 (1019765..1020520) [756 bp, 251 aa] {ON} YGR135W
           (PRE9) - proteasome component Y13 [contig 189] FULL
          Length = 251

 Score =  382 bits (982), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 189/253 (74%), Positives = 211/253 (83%), Gaps = 2/253 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT+IG+M+KDGIVL AERK+TSKLLEQ 
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60

Query: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120
             +EKLYKL+D IT+AVAGLTADAEILIN AR FAQNYL TYNEEIPVEILV++LSD+KQ
Sbjct: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKTYNEEIPVEILVRRLSDVKQ 120

Query: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180
            YTQHGGLRPFG SFIYAGYDD  G QLYTSNPSGNY+GWKAIS+GANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGASFIYAGYDDRFGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELSXXXXXXXXXXXXXXXXYNPAEIKQLL 240
           KDD+ + +A EL LKTLSKTTDSS LT +RVE +                + P EI+ LL
Sbjct: 181 KDDITVKEATELALKTLSKTTDSSTLTSERVEFA--TITKLENGKIAQKIFKPREIETLL 238

Query: 241 IKFGINKKNDEDE 253
            + GINKK +E+E
Sbjct: 239 NETGINKKENEEE 251

>Suva_7.423 Chr7 (731573..732349) [777 bp, 258 aa] {ON} YGR135W
           (REAL)
          Length = 258

 Score =  381 bits (978), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 189/248 (76%), Positives = 208/248 (83%), Gaps = 1/248 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT+IGIM+ DGIVL AERK+TS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120
              EKLYKL+DKI +AVAGLTADAEILIN AR  AQNYL +YNE+IPVEILV++LSDIKQ
Sbjct: 61  TSTEKLYKLNDKIAVAVAGLTADAEILINTARVHAQNYLKSYNEDIPVEILVRRLSDIKQ 120

Query: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180
            YTQHGGLRPFGVSFIYAG+DD  G QLYTSNPSGNYTGWKAIS+GANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGHDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELSXXXXXXXXXXXXXXXXYNPAEIKQLL 240
           KDDM ++DA++L LKTLSKTTDSS LTYDR+E +                + P EIK LL
Sbjct: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFA-TIRKGANDGEVYQKIFKPQEIKDLL 239

Query: 241 IKFGINKK 248
           +K GI KK
Sbjct: 240 VKTGITKK 247

>ZYRO0D09746g Chr4 complement(825992..826753) [762 bp, 253 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 253

 Score =  381 bits (978), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 193/256 (75%), Positives = 213/256 (83%), Gaps = 3/256 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT+IGIM++DGIVL AERK+TSKLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60

Query: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120
              EKLY+L+DKI +AVAGLT+DAEILIN AR  AQNYL TYNE+IPVEILVK+LSDIKQ
Sbjct: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120

Query: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180
            YTQHGGLRPFGVSFIYAGYDD  G QLYTSNPSGNYTGWKAIS+GANTSAAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180

Query: 181 KDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELSXXXXXXXXXXXXXXXXYNPAEIKQLL 240
           KDD+ ++ A+EL LKTLSKTTDSS LTYDRVE +                + P EI+ LL
Sbjct: 181 KDDIKVDGAIELALKTLSKTTDSSALTYDRVEFA--TIKLGENGKLYQKVFKPEEIQTLL 238

Query: 241 IKFGINKKNDEDEDVE 256
           +K GI K   EDED E
Sbjct: 239 VKNGITKAG-EDEDEE 253

>KLTH0G02376g Chr7 complement(185961..186716) [756 bp, 251 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 251

 Score =  377 bits (969), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 187/253 (73%), Positives = 210/253 (83%), Gaps = 2/253 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60
           MGSRR+DSRTTIFSPEGRLYQVEYALESISHAGT+IG+M+KDGIVL AERK+TSKLLEQ 
Sbjct: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60

Query: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120
             +EKLYKL+D IT+AVAGLTADAEILIN AR FAQNYL +YNEEIPVEILV++LSD+KQ
Sbjct: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120

Query: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180
            YTQHGGLRPFG SFIYAGYDD  G QLYTSNPSGNY+GWKAIS+GANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELSXXXXXXXXXXXXXXXXYNPAEIKQLL 240
           KDD+ + +A EL LKTLSKTTDSS LT +RVE S                + P EI+ LL
Sbjct: 181 KDDITVEEATELALKTLSKTTDSSTLTPERVEFS--TITKLDNGKIAQKIFKPQEIETLL 238

Query: 241 IKFGINKKNDEDE 253
            K G+ KK ++DE
Sbjct: 239 NKTGVTKKENDDE 251

>Ecym_1230 Chr1 complement(475398..476153) [756 bp, 251 aa] {ON}
           similar to Ashbya gossypii AFR318W
          Length = 251

 Score =  373 bits (957), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 186/250 (74%), Positives = 209/250 (83%), Gaps = 2/250 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT+IGIM+KDGIVL AERK+TSKLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60

Query: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120
             +EKLY+L+D IT+AVAGLTADAEILIN AR  AQNYL  YNEEIPVEILV++LSDIKQ
Sbjct: 61  TSSEKLYRLNDNITVAVAGLTADAEILINTARLHAQNYLKMYNEEIPVEILVRRLSDIKQ 120

Query: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180
            YTQHGGLRPFGVSFIYAGYDD  G QLYTSNPSGNY+GWKAIS+GANT AAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTQAAQTLLQMDY 180

Query: 181 KDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELSXXXXXXXXXXXXXXXXYNPAEIKQLL 240
           KD++   +A+EL LKTLSKTTD+S+LT DR+E +                Y P+EIK+LL
Sbjct: 181 KDEITFENAIELALKTLSKTTDNSSLTDDRLEFA--TIKQDSNGKLVQKIYKPSEIKELL 238

Query: 241 IKFGINKKND 250
            K GI K+ +
Sbjct: 239 QKSGIMKQEE 248

>AFR318W Chr6 (1013015..1013770) [756 bp, 251 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR135W (PRE9)
          Length = 251

 Score =  370 bits (949), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 185/254 (72%), Positives = 210/254 (82%), Gaps = 3/254 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT+IGIM+KDGIVL AERK+TSKLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60

Query: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120
             +EKLY+L+D IT+AVAGLTADAEIL+N AR  AQNYL  YNEEIPVE+LV++LSDIKQ
Sbjct: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120

Query: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180
            YTQHGGLRPFGVSFIYAGYD   G QLYTSNPSGNY+GWKAIS+GANT A QTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180

Query: 181 KDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELSXXXXXXXXXXXXXXXXYNPAEIKQLL 240
           KDD+  +DA++L LKTLSKTTDSS+L+++R+E +                Y   EIK LL
Sbjct: 181 KDDLTFDDAIKLALKTLSKTTDSSSLSHERLEFA--TIQRNADGKVVQKIYKLGEIKDLL 238

Query: 241 IKFGINKKNDEDED 254
            K GINK+ +E ED
Sbjct: 239 EKTGINKQ-EEKED 251

>KLLA0E03917g Chr5 complement(356540..357289) [750 bp, 249 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 249

 Score =  367 bits (943), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 185/251 (73%), Positives = 208/251 (82%), Gaps = 2/251 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT+IGIM++ GIVL AERK+TSKLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMTEQGIVLAAERKVTSKLLEQD 60

Query: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120
             +EKLYKL+D IT+AVAGLTADAEILIN AR  AQ+YL TYNEEIPVE+LV++LSD+KQ
Sbjct: 61  TSSEKLYKLNDNITVAVAGLTADAEILINTARVQAQSYLKTYNEEIPVEMLVRRLSDLKQ 120

Query: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180
            YTQHGGLRPFGVSFIYAGYDD  G QLYTSNPSGNY+GWKAIS+GANT AAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTQAAQTLLQMDY 180

Query: 181 KDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELSXXXXXXXXXXXXXXXXYNPAEIKQLL 240
           KDD+ L+ A+EL LKTLSKTTDSS LT++R+E +                Y P EI  LL
Sbjct: 181 KDDITLDGAIELALKTLSKTTDSSVLTHERLEFA--TISKDAEGKIYQKIYKPTEIATLL 238

Query: 241 IKFGINKKNDE 251
            K  I KK+D+
Sbjct: 239 EKTEIVKKDDD 249

>CAGL0F01199g Chr6 complement(124304..125068) [765 bp, 254 aa] {ON}
           highly similar to uniprot|P40303 Saccharomyces
           cerevisiae YOL038w PRE6
          Length = 254

 Score =  156 bits (395), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 75/197 (38%), Positives = 122/197 (61%), Gaps = 5/197 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   +IFSP+G ++QVEYALE++     ++G+  KD +VL  ER+ T KL +  ++  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGLKGKDCVVLGCERRSTLKLQDTRVIASK 63

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           +  +   + L+ AGL AD+ IL+N+AR  AQ++ +T  + + VE + + ++ ++Q YTQ 
Sbjct: 64  VLPIDSHLVLSFAGLNADSRILVNMARVEAQSHRLTLEDPVTVEYMARYVAGVQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYD--DILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDD 183
           GG+RPFGVS + AG+D  D   P+LY + PSG Y+ W A +IG N+   +  L+ +Y  +
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTENPRLYQTEPSGIYSSWCAQAIGRNSKTVREFLEKNYNRE 183

Query: 184 ---MNLNDAMELGLKTL 197
               N  + + L +K L
Sbjct: 184 EPPSNKEECIRLTVKAL 200

>TPHA0I02070 Chr9 (460632..461402) [771 bp, 256 aa] {ON} Anc_7.120
           YOL038W
          Length = 256

 Score =  153 bits (387), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 78/196 (39%), Positives = 123/196 (62%), Gaps = 4/196 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   +IFSP+G ++QVEYALE++     S+GI  +D +VL  ER+ T KL +  I   K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCSVGIKGEDCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           + K+ + I L+ +GL AD+ ILI  AR  AQ++ +T  + + +E L + ++ ++Q YTQ 
Sbjct: 64  ISKIDNHIILSFSGLNADSRILIEKARIEAQSHKLTLEDPVSIEYLTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYD-DILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDD- 183
           GG+RPFGVS + AG+D +   P+LY + PSG Y+ W A +IG N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGVSTLIAGFDPNDNKPRLYQTEPSGIYSSWTAQTIGRNSKTVREFLENNYNKDE 183

Query: 184 --MNLNDAMELGLKTL 197
              N  + ++L +K+L
Sbjct: 184 PPKNKEECIKLTVKSL 199

>NCAS0F01030 Chr6 (202937..203698) [762 bp, 253 aa] {ON} Anc_7.120
          Length = 253

 Score =  153 bits (386), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 120/196 (61%), Gaps = 4/196 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   +IFSP+G ++QVEYALE++     ++GI   D +VL  ER+ T KL +  I   K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGTDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           + K+   + L+ +GL AD+ ILI  AR  AQ++ +T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  ISKIDSHLVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDILG-PQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDD- 183
           GG+RPFGVS + AG+D     P+LY + PSG Y+ W A +IG N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGVSTLIAGFDPRDNKPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLEKNYNRDE 183

Query: 184 --MNLNDAMELGLKTL 197
              N+ + + L +K+L
Sbjct: 184 PPKNVEECVRLTVKSL 199

>Kwal_YGOB_Anc_7.120 s55 complement(642281..643010,643097..643131)
           [765 bp, 254 aa] {ON} ANNOTATED BY YGOB -
          Length = 254

 Score =  153 bits (386), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 119/196 (60%), Gaps = 4/196 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   +IFSP+G ++QVEYALE++     ++GI  KD +V+  ER+ T KL +  I   K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGKDCVVVGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           + K+   + L+ AGL AD+ ILI  AR  AQ++ +T  + + V+ L + ++ ++Q YTQ 
Sbjct: 64  ISKIDSHVVLSFAGLNADSRILIEKARVEAQSHRLTLEDPVSVDYLTRYVAGVQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDI-LGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDD- 183
           GG+RPFGVS + AG+D     P+LY + PSG Y+ W A +IG N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTTPKLYQTEPSGIYSAWSAQAIGRNSKTVREFLEKNYVRDA 183

Query: 184 --MNLNDAMELGLKTL 197
                 D ++L +K L
Sbjct: 184 PPATEQDCVKLTVKAL 199

>KLTH0F13574g Chr6 complement(1116049..1116778,1116859..1116893)
           [765 bp, 254 aa] {ON} highly similar to uniprot|P40303
           Saccharomyces cerevisiae YOL038W PRE6 20S proteasome
           alpha-type subunit
          Length = 254

 Score =  152 bits (384), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 76/196 (38%), Positives = 119/196 (60%), Gaps = 4/196 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   +IFSP+G ++QVEYALE++     ++GI  KD +V+  ER+ T KL +  I   K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGKDCVVIGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           + K+   + L+ AGL AD+ ILI  AR  AQ++ +T  + + V+ L + ++ ++Q YTQ 
Sbjct: 64  IAKIDSHVVLSFAGLNADSRILIEKARVEAQSHKLTLEDPVSVDYLTRYVAGVQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDI-LGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDD- 183
           GG+RPFGVS + AG+D     P+LY + PSG Y+ W A +IG N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTTPKLYQTEPSGVYSAWSAQAIGRNSKTVREFLEKNYARDA 183

Query: 184 --MNLNDAMELGLKTL 197
                 + ++L +K L
Sbjct: 184 PPATEQECVKLTVKAL 199

>KLLA0B11836g Chr2 (1034800..1035564) [765 bp, 254 aa] {ON} highly
           similar to uniprot|P40303 Saccharomyces cerevisiae
           YOL038W PRE6 20S proteasome alpha-type subunit
          Length = 254

 Score =  152 bits (384), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 76/196 (38%), Positives = 122/196 (62%), Gaps = 4/196 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   +IFSP+G ++QVEYALE++     ++G+   D +VL  ER+ T KL +  I   K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGLKGADCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           + K+ + + L+ AGL AD+ ILI  AR  AQ++ +T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  ISKIDNHVVLSFAGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDILG-PQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDD- 183
           GG+RPFGVS + AG+D     P+LY + PSG Y+ W A SIG N++  +  L+ +Y  + 
Sbjct: 124 GGVRPFGVSVLIAGFDPRDNKPRLYQTEPSGIYSAWCAQSIGRNSNTVREFLEKNYNKNE 183

Query: 184 --MNLNDAMELGLKTL 197
              +  + ++L +K+L
Sbjct: 184 PPADEKECVKLTIKSL 199

>ZYRO0G04136g Chr7 complement(335007..335771) [765 bp, 254 aa] {ON}
           highly similar to uniprot|P40303 Saccharomyces
           cerevisiae YOL038W PRE6 20S proteasome alpha-type
           subunit
          Length = 254

 Score =  151 bits (381), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 73/179 (40%), Positives = 112/179 (62%), Gaps = 1/179 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   +IFSP+G ++QVEYA E++     ++GI  KD +VL  ER+ T KL +  I   K
Sbjct: 4   YDRALSIFSPDGHIFQVEYASEAVKRGTCAVGIKGKDCVVLGCERRSTLKLQDSRITPSK 63

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           + K+   + L+ +GL AD+ ILI  AR  AQ++ +T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  ISKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVSVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYD-DILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDD 183
           GG+RPFGV+ + AG+D D   P+LY + PSG Y+ W A +IG N+   +  L+ +Y  D
Sbjct: 124 GGVRPFGVATLIAGFDKDDDTPKLYQTEPSGIYSAWTAQTIGRNSKTVREFLEKNYNRD 182

>KLTH0E16324g Chr5 (1450336..1450379,1450467..1451175) [753 bp, 250
           aa] {ON} similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092C PRE8 20S proteasome beta-type subunit
          Length = 250

 Score =  151 bits (381), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 81/211 (38%), Positives = 129/211 (61%), Gaps = 3/211 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNE 64
           RY    T FSP G+L Q++YAL ++    TS+GI + +G+++  E+K TS L   + L+ 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIRATNGVIIATEKKSTSSLALTESLS- 62

Query: 65  KLYKLSDKITLAVAGLTADAEILINIARQFAQ-NYLMTYNEEIPVEILVKKLSDIKQSYT 123
           K+  ++  I  A +G+  D  +LI+ +R+ A  +Y   YNE  P +ILV +++ I Q  T
Sbjct: 63  KVAHITPDIGAAYSGMGPDFRVLIDKSRKVAHTHYKRIYNEYPPTKILVAEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AGYD+  G  LY  +PSG+Y  WKA +IG   +AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGYGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDE 182

Query: 184 MNLNDAMELGLKTLSKTTDSSNLTYDRVELS 214
           + L DA+ + L TL ++ +      D +E++
Sbjct: 183 LELEDAIHIALLTLKESVE-GEFNGDTIEIA 212

>KNAG0J00180 Chr10 (20275..21027) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  151 bits (381), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 77/199 (38%), Positives = 124/199 (62%), Gaps = 2/199 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNE 64
           RY    T FSP G+L Q++YAL ++    TS+GI + +G+V+  E+K +S L   D L+ 
Sbjct: 4   RYAFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKATNGVVIATEKKSSSPLALTDTLS- 62

Query: 65  KLYKLSDKITLAVAGLTADAEILINIARQFAQ-NYLMTYNEEIPVEILVKKLSDIKQSYT 123
           K+  ++  I    +G+  D  +L++ +R+ A  +Y   YNE  P ++LV +++++ Q  T
Sbjct: 63  KIELITPDIGAVYSGMGPDYRVLVDKSRKVAHTHYKRIYNEYPPTKLLVSEIAEVMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AGYDD  G  LY  +PSG+Y  WKA +IG   +AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGYDDHRGFSLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDE 182

Query: 184 MNLNDAMELGLKTLSKTTD 202
           + L DA+ + L TL ++ +
Sbjct: 183 LELEDAIHIALLTLKESVE 201

>SAKL0F04224g Chr6 (335860..335894,335967..336690) [759 bp, 252 aa]
           {ON} highly similar to uniprot|P40303 Saccharomyces
           cerevisiae YOL038W PRE6 20S proteasome alpha-type
           subunit
          Length = 252

 Score =  150 bits (380), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 76/196 (38%), Positives = 121/196 (61%), Gaps = 4/196 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   +IFSP+G ++QVEYALE++     ++GI   D +VL  ER+ T KL +  I   K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGTDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           + ++   + L+ AGL AD+ ILI  AR  AQ++ +T  + + ++ L + ++ I+Q YTQ 
Sbjct: 64  ISQIDTHVVLSFAGLNADSRILIEKARVEAQSHRLTLEDPVSIDYLTRYIAGIQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDILG-PQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDD- 183
           GG+RPFGVS + AG+D   G P+LY + PSG Y+ W A +IG N+   +  L+ +Y  + 
Sbjct: 124 GGVRPFGVSTLIAGFDPNDGVPKLYQTEPSGIYSAWSAQAIGRNSKTVREFLEKNYSKEE 183

Query: 184 --MNLNDAMELGLKTL 197
                 +A++L +K+L
Sbjct: 184 PPATEQEAVKLTVKSL 199

>TBLA0J01980 Chr10 (468588..469352) [765 bp, 254 aa] {ON} Anc_7.120
           YOL038W
          Length = 254

 Score =  150 bits (380), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 76/196 (38%), Positives = 120/196 (61%), Gaps = 4/196 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   +IFSP+G ++QVEYALE++     ++GI   D +VL  ER+ T KL +  I   K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCTVGIKGTDCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           + K+ + I L+ +GL AD+ ILI  AR  AQ++ +T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  ISKIDNHIVLSFSGLNADSRILIEKARVEAQSHKLTVEDPVTVEYLTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDILG-PQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDD- 183
           GG+RPFG+S + AG+D     P+LY + PSG Y+ W A +IG N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGISTLIAGFDPRDNTPRLYQTEPSGIYSAWTAQTIGRNSKTVREFLEKNYDRDE 183

Query: 184 --MNLNDAMELGLKTL 197
                 + ++L +K+L
Sbjct: 184 PPSTAEECIKLTIKSL 199

>AAR012C Chr1 complement(364905..365625,365693..365727) [756 bp, 251
           aa] {ON} syntenic homolog of Saccharomyces cerevisiae
           YOL038W (PRE6); 1-intron
          Length = 251

 Score =  150 bits (380), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 75/196 (38%), Positives = 120/196 (61%), Gaps = 4/196 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   +IFSP G ++QVEYALE++     ++GI  +D +VL  ER+ T KL +  I   K
Sbjct: 4   YDRALSIFSPNGHIFQVEYALEAVKRGTCTVGIKGEDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           + ++ + + L+ AGL AD+ ILI  AR  AQ++ +T  + + VE + + ++ ++Q YTQ 
Sbjct: 64  ISRIDNHLILSFAGLNADSRILIEKARVEAQSHRLTLEDPVTVEYMTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDI-LGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDM 184
           GG+RPFGVS + AG+D     P+LY + PSG Y+ W A +IG N+   +  L+ +Y    
Sbjct: 124 GGVRPFGVSTLVAGFDPRDARPRLYQTEPSGIYSAWAAQAIGRNSKTVREFLEKNYSKHT 183

Query: 185 ---NLNDAMELGLKTL 197
              +  D ++L +K+L
Sbjct: 184 PPASEQDCVKLTVKSL 199

>NDAI0H01520 Chr8 (363987..364745) [759 bp, 252 aa] {ON} Anc_7.120
          Length = 252

 Score =  150 bits (380), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 75/196 (38%), Positives = 122/196 (62%), Gaps = 4/196 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   +IFSP+G ++QVEYALE++     ++GI  K+ +VL  ER+ T KL +  I   K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGKNCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           + K+   + L+ +GL AD+ ILI  AR  AQ++ +T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  ISKIDSHLVLSFSGLNADSRILIEKARIEAQSHRLTLEDPVTVEYLTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDI-LGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDD- 183
           GG+RPFGVS + AG+D     P+LY + PSG Y+ W A +IG N+   +  L+ +Y  + 
Sbjct: 124 GGVRPFGVSTLIAGFDPRDDKPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLEKNYNREE 183

Query: 184 --MNLNDAMELGLKTL 197
              N+++ + L +++L
Sbjct: 184 PPENVDECVRLTVRSL 199

>ADL354W Chr4 (85188..85231,85297..86005) [753 bp, 250 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML092C
           (PRE8); 1-intron
          Length = 250

 Score =  150 bits (378), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 78/199 (39%), Positives = 123/199 (61%), Gaps = 2/199 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNE 64
           RY    T FSP G+L Q++YAL ++    TS+GI + +G+V+  E+K  + L  +D L+ 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKATNGVVIATEKKANTTLTIKDTLD- 62

Query: 65  KLYKLSDKITLAVAGLTADAEILINIARQFA-QNYLMTYNEEIPVEILVKKLSDIKQSYT 123
           K+ +++  I    +G+  D  +LIN +R+ A  +Y   Y E  P +ILV +++ I Q  T
Sbjct: 63  KVSQITPDIGAVYSGMGPDFRVLINKSRKTAYGSYRKAYGEYPPTKILVSQIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AGYD+  G  LY  +PSG+Y  WKA +IG   +AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGFGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDE 182

Query: 184 MNLNDAMELGLKTLSKTTD 202
           + L DA+ + L TL ++ +
Sbjct: 183 LELEDAIHIALLTLKESVE 201

>Ecym_8151 Chr8 (318925..318968,319052..319760) [753 bp, 250 aa]
           {ON} similar to Ashbya gossypii ADL354W 1-intron
          Length = 250

 Score =  149 bits (377), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 79/199 (39%), Positives = 123/199 (61%), Gaps = 2/199 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNE 64
           RY    T FSP G+L Q++YAL ++    TS+GI + +G+V+  E+K  S L   D L +
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKATNGVVIATEKKANSTLTLTDTL-D 62

Query: 65  KLYKLSDKITLAVAGLTADAEILINIARQFA-QNYLMTYNEEIPVEILVKKLSDIKQSYT 123
           K+ K++  I    +G+  D  +LIN +R+ A  +Y+ TY E  P +ILV +++ I Q  T
Sbjct: 63  KISKITPDIGAVYSGMGPDFRVLINKSRKTAYGSYMKTYGEYPPTKILVSQIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AGYD+     LY  +PSG+Y  WKA +IG   +AA+T L+  + ++
Sbjct: 123 QSGGVRPFGVSLLVAGYDNHNEFGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNNE 182

Query: 184 MNLNDAMELGLKTLSKTTD 202
           + L DA+ + L TL ++ +
Sbjct: 183 LELEDAIHIALLTLKESVE 201

>KLLA0D10373g Chr4 complement(876175..876927) [753 bp, 250 aa] {ON}
           highly similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092C PRE8 20S proteasome beta-type
           subunit,
          Length = 250

 Score =  149 bits (376), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 82/211 (38%), Positives = 127/211 (60%), Gaps = 3/211 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNE 64
           RY    T FSP G+L Q++YAL ++    TS+GI S +GIV+  E+K +S L   D ++ 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKSTNGIVIATEKKSSSSLALPDTVS- 62

Query: 65  KLYKLSDKITLAVAGLTADAEILINIARQFAQ-NYLMTYNEEIPVEILVKKLSDIKQSYT 123
           K+  ++  I    +G+  D  +L++ AR+ A  NY   Y E  P +ILV +++ I Q  T
Sbjct: 63  KVSLITPDIGAVYSGMGPDFRVLVDKARKVAHTNYKRIYGEYPPTKILVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AG+D+  G  LY  +PSG Y  WKA +IG  +SAA+T L+  + ++
Sbjct: 123 QSGGVRPFGVSVLVAGHDEHNGFGLYQVDPSGAYFPWKATAIGKGSSAAKTFLEKRWNEE 182

Query: 184 MNLNDAMELGLKTLSKTTDSSNLTYDRVELS 214
           + L DA+ + L TL ++ +      D +EL+
Sbjct: 183 LELEDAIHIALLTLKESVE-GEFNGDTIELA 212

>Smik_15.129 Chr15 (221503..222267) [765 bp, 254 aa] {ON} YOL038W
           (REAL)
          Length = 254

 Score =  149 bits (376), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 74/196 (37%), Positives = 121/196 (61%), Gaps = 4/196 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   +IFSP+G ++QVEYALE++     ++G+  K+ +VL  ER+ T KL +  I   K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           + K+   + L+ +GL AD+ ILI  AR  AQ++ +T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  VSKIDSHLVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDILG-PQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY---K 181
           GG+RPFGVS + AG+D     P+LY + PSG Y+ W A +IG N+   +  L+ +Y   +
Sbjct: 124 GGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKE 183

Query: 182 DDMNLNDAMELGLKTL 197
               + D ++L +++L
Sbjct: 184 PPATVEDCVKLTVRSL 199

>Kpol_1023.108 s1023 (252377..253141) [765 bp, 254 aa] {ON}
           (252377..253141) [765 nt, 255 aa]
          Length = 254

 Score =  149 bits (375), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 75/196 (38%), Positives = 123/196 (62%), Gaps = 4/196 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   +IFSP+G ++QVEYALE++     S+GI  ++ +VL  ER+ T KL +  I   K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCSVGIKGENCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           + K+ + + L+ +GL AD+ ILI  AR  AQ++ +T  + I VE L + ++ ++Q YTQ 
Sbjct: 64  ISKIDNHVILSFSGLNADSRILIEKARIEAQSHKLTLEDPISVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYD-DILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY---K 181
           GG+RPFG+S + AG+D +   P+LY + PSG Y+ W A +IG N+   +  L+ +Y   +
Sbjct: 124 GGVRPFGISTLIAGFDPNDKTPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLENNYDRNE 183

Query: 182 DDMNLNDAMELGLKTL 197
               + + ++L +K+L
Sbjct: 184 PPKTVEECVKLTVKSL 199

>Suva_15.131 Chr15 (227798..228562) [765 bp, 254 aa] {ON} YOL038W
           (REAL)
          Length = 254

 Score =  148 bits (374), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 73/196 (37%), Positives = 121/196 (61%), Gaps = 4/196 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   +IFSP+G ++QVEYALE++     ++G+  K+ +VL  ER+ T KL +  I   K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           + K+   + L+ +GL AD+ ILI  AR  AQ++ +T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  VSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDILG-PQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY---K 181
           GG+RPFGVS + AG+D     P+LY + PSG Y+ W A +IG N+   +  L+ +Y   +
Sbjct: 124 GGVRPFGVSTLIAGFDSRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKE 183

Query: 182 DDMNLNDAMELGLKTL 197
               + + ++L +++L
Sbjct: 184 PPATVEECVKLTVRSL 199

>Ecym_1272 Chr1 (552861..552895,553024..553744) [756 bp, 251 aa]
           {ON} similar to Ashbya gossypii AAR012C  1-intron
          Length = 251

 Score =  148 bits (373), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 109/176 (61%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   +IFSP G ++QVEYALE++     ++G+   D +VL  ER+ T KL +  I   K
Sbjct: 4   YDRALSIFSPNGHIFQVEYALEAVKRGTCTVGVKGTDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           + K+   + L+ AGL AD+ ILI  AR  AQ++ +T  + + VE + + ++ ++Q YTQ 
Sbjct: 64  ISKIDRHVILSFAGLNADSRILIEKARVEAQSHRLTLEDPVTVEYMTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDI-LGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180
           GG+RPFGVS + AG+D     P+LY + PSG Y+ W A +IG N+   +  L+ +Y
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTRPRLYQTEPSGIYSAWSAQAIGRNSKTVREFLEKNY 179

>YOL038W Chr15 (255337..256101) [765 bp, 254 aa] {ON}  PRE6Alpha 4
           subunit of the 20S proteasome; may replace alpha 3
           subunit (Pre9p) under stress conditions to create a more
           active proteasomal isoform; GFP-fusion protein relocates
           from cytosol to the mitochondrial surface upon oxidative
           stress
          Length = 254

 Score =  148 bits (373), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 73/196 (37%), Positives = 121/196 (61%), Gaps = 4/196 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   +IFSP+G ++QVEYALE++     ++G+  K+ +VL  ER+ T KL +  I   K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           + K+   + L+ +GL AD+ ILI  AR  AQ++ +T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  VSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDILG-PQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY---K 181
           GG+RPFGVS + AG+D     P+LY + PSG Y+ W A +IG N+   +  L+ +Y   +
Sbjct: 124 GGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKE 183

Query: 182 DDMNLNDAMELGLKTL 197
               + + ++L +++L
Sbjct: 184 PPATVEECVKLTVRSL 199

>KAFR0G03030 Chr7 complement(630616..631380) [765 bp, 254 aa] {ON}
           Anc_7.120 YOL038W
          Length = 254

 Score =  148 bits (373), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 75/196 (38%), Positives = 120/196 (61%), Gaps = 4/196 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   +IFSP+G ++QVEYALE++     ++G+   + +VL  ER+ T KL +  I   K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGTNCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           + K+ + I L+ +GL AD+ ILI  AR  AQ++ +T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  ISKIDNHIVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLARYVAGVQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDILG-PQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDD- 183
           GG+RPFGVS + AG D     P+LY + PSG Y+ W A +IG N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGVSTLIAGLDPRDNTPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLEKNYNKDE 183

Query: 184 --MNLNDAMELGLKTL 197
               + + ++L +K+L
Sbjct: 184 PPSTVEECVKLTIKSL 199

>Skud_15.119 Chr15 (214242..215006) [765 bp, 254 aa] {ON} YOL038W
           (REAL)
          Length = 254

 Score =  148 bits (373), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 73/196 (37%), Positives = 121/196 (61%), Gaps = 4/196 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   +IFSP+G ++QVEYALE++     ++G+  K+ +VL  ER+ T KL +  I   K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           + K+   + L+ +GL AD+ ILI  AR  AQ++ +T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  VSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDILG-PQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY---K 181
           GG+RPFGVS + AG+D     P+LY + PSG Y+ W A +IG N+   +  L+ +Y   +
Sbjct: 124 GGVRPFGVSTLIAGFDARDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKE 183

Query: 182 DDMNLNDAMELGLKTL 197
               + + ++L +++L
Sbjct: 184 PPATVEECVKLTVRSL 199

>KAFR0L02080 Chr12 (395922..396674) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  147 bits (371), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 75/199 (37%), Positives = 125/199 (62%), Gaps = 2/199 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNE 64
           RY    T FSP G+L Q++YAL ++    TS+GI + +G+V+  E+K +S L   + L+ 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLALTETLS- 62

Query: 65  KLYKLSDKITLAVAGLTADAEILINIARQFAQ-NYLMTYNEEIPVEILVKKLSDIKQSYT 123
           K+  ++  I    +G+  D  +L++ +R+ A  +Y   YNE  P ++LV ++++I Q  T
Sbjct: 63  KIELITPDIGAVYSGMGPDYRVLVDKSRKVAHTHYKRIYNEYPPTKLLVSEIAEIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AG+D+  G  LY  +PSG+Y  WKA +IG  ++AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGHDEHQGFSLYQVDPSGSYFPWKATAIGKGSTAAKTFLEKRWNDE 182

Query: 184 MNLNDAMELGLKTLSKTTD 202
           + L DA+ + L TL ++ +
Sbjct: 183 LELEDAIHIALLTLKESIE 201

>CAGL0H07007g Chr8 complement(694778..695530) [753 bp, 250 aa] {ON}
           highly similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092c PRE8
          Length = 250

 Score =  147 bits (371), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 77/199 (38%), Positives = 123/199 (61%), Gaps = 2/199 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNE 64
           RY    T FSP G+L Q++YAL ++    TS+GI + +G+V+  E+K +S L   + L+ 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLALTETLS- 62

Query: 65  KLYKLSDKITLAVAGLTADAEILINIARQFAQ-NYLMTYNEEIPVEILVKKLSDIKQSYT 123
           K+  L+  I    +G+  D  +L++ +R+ A  NY   Y E  P ++LV +++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGIGPDYRVLVDKSRKVAHTNYKRIYGEYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AGYD+  G  LY  +PSG+Y  WKA SIG  ++AA+T L+  + ++
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGYSLYQVDPSGSYFPWKATSIGKGSTAAKTFLEKRWNNE 182

Query: 184 MNLNDAMELGLKTLSKTTD 202
           + L DA+ + L TL ++ +
Sbjct: 183 LELEDAIHIALLTLKESVE 201

>Smik_13.43 Chr13 complement(83092..83844) [753 bp, 250 aa] {ON}
           YML092C (REAL)
          Length = 250

 Score =  147 bits (371), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 127/211 (60%), Gaps = 3/211 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNE 64
           RY    T FSP G+L Q++YAL ++    TS+GI + +G+V+  E+K +S L   + L+ 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAISETLS- 62

Query: 65  KLYKLSDKITLAVAGLTADAEILINIARQFAQ-NYLMTYNEEIPVEILVKKLSDIKQSYT 123
           K+  L+  I    +G+  D  +L++ +R+ A  NY   Y E  P ++LV +++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTNYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AG+D+  G  LY  +PSG+Y  WKA +IG  + AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 MNLNDAMELGLKTLSKTTDSSNLTYDRVELS 214
           + L DA+ + L TL ++ +      D +EL+
Sbjct: 183 LELEDAIHIALLTLKESVE-GEFNGDTIELA 212

>NDAI0E00160 Chr5 complement(10576..11328) [753 bp, 250 aa] {ON}
           Anc_8.871
          Length = 250

 Score =  147 bits (370), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 79/211 (37%), Positives = 128/211 (60%), Gaps = 3/211 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNE 64
           RY    T FSP G+L Q++YAL +++   TSIGI + +GIV+  E+K +S L   + L+ 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVNQGVTSIGIKATNGIVIATEKKSSSPLALTETLS- 62

Query: 65  KLYKLSDKITLAVAGLTADAEILINIARQFAQ-NYLMTYNEEIPVEILVKKLSDIKQSYT 123
           K+  ++  I    +G+  D  +L++ +R+ A  NY   Y E  P ++LV +++ I Q  T
Sbjct: 63  KVELITPDIGAVYSGMGPDYRVLVDKSRKVAHSNYKRIYGEYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AG+D+  G  LY  +PSG+Y  WKA +IG  + AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGHDEHRGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 MNLNDAMELGLKTLSKTTDSSNLTYDRVELS 214
           + L DA+ + L TL ++ +      D +E++
Sbjct: 183 LELEDAIHIALLTLKESVE-GEFNGDTIEIA 212

>NDAI0C03400 Chr3 complement(779360..780151) [792 bp, 263 aa] {ON}
           Anc_5.64
          Length = 263

 Score =  147 bits (371), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 80/203 (39%), Positives = 123/203 (60%), Gaps = 7/203 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   + FSPEGRL+QVEY+LE+I    T+IGI + +G+VL  E++ TS LLE D + EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTSEGVVLGVEKRATSPLLEADSI-EK 66

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           + ++   +  A++GLTADA  +I  AR  A N+ + Y+E++ VE L + + D+   + + 
Sbjct: 67  IVEIEHHVGCAMSGLTADARSMIEHARVAAVNHNLYYDEDMKVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMD 179
                    RPFGV+ + AGYDD  G QLY + PSG +  + A +IG+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDDDEGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDMNLNDAMELGLKTLSKTTD 202
           +   + L +A  L LK L +  +
Sbjct: 187 WHSSLTLREAEVLVLKILKQVME 209

>Suva_13.56 Chr13 complement(87087..87839) [753 bp, 250 aa] {ON}
           YML092C (REAL)
          Length = 250

 Score =  146 bits (369), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 78/211 (36%), Positives = 127/211 (60%), Gaps = 3/211 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNE 64
           RY    T FSP G+L Q++YAL ++    TS+GI + +G+V+  E+K +S L   + L+ 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKTSSPLAMSETLS- 62

Query: 65  KLYKLSDKITLAVAGLTADAEILINIARQFAQ-NYLMTYNEEIPVEILVKKLSDIKQSYT 123
           K+  L+  I    +G+  D  +L++ +R+ A  +Y   Y E  P ++LV +++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AG+D+  G  LY  +PSG+Y  WKA +IG  + AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 MNLNDAMELGLKTLSKTTDSSNLTYDRVELS 214
           + L DA+ + L TL ++ +      D +EL+
Sbjct: 183 LELEDAIHIALLTLKESVE-GEFNGDTIELA 212

>TPHA0H01190 Chr8 complement(263603..264385) [783 bp, 260 aa] {ON}
           Anc_5.64 YGR253C
          Length = 260

 Score =  147 bits (370), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 82/203 (40%), Positives = 122/203 (60%), Gaps = 7/203 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   + FSPEGRL+QVEY+LE+I    T+IGI +K+G+VL  E++ TS LLE D + EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESDSI-EK 66

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           + ++   I  A++GLTADA  +I  AR  A  + + Y+E+I VE L + + D+   + + 
Sbjct: 67  ILEIDRHIGCAMSGLTADARSMIEHARTSAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMD 179
                    RPFGV+ + AGYD   G QLY + PSG +  + A +IGA +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDEGYQLYHAEPSGTFYRYNAKAIGAGSEGAQSELQNE 186

Query: 180 YKDDMNLNDAMELGLKTLSKTTD 202
           +   + L +A  L LK L +  +
Sbjct: 187 WHSSLTLKEAELLVLKVLKQVME 209

>Kpol_1062.2 s1062 (5124..5906) [783 bp, 260 aa] {ON} (5124..5906)
           [783 nt, 261 aa]
          Length = 260

 Score =  146 bits (368), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 80/203 (39%), Positives = 123/203 (60%), Gaps = 7/203 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   + FSPEGRL+QVEY+LE+I    T+IGI +++G+VL  E++ TS LLE D + EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGITTREGVVLGVEKRATSPLLESDSI-EK 66

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           + ++ + I  A++GLTADA  +I  AR  A  + + Y+E+I VE L + + D+   + + 
Sbjct: 67  IVEIDNHIGCAMSGLTADARSMIEHARTSAVTHNLYYDEDISVETLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMD 179
                    RPFGV+ + AGYD   G QLY + PSG +  + A +IG+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDRDQGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDMNLNDAMELGLKTLSKTTD 202
           +   + L +A  L LK L +  +
Sbjct: 187 WHSSLTLKEAELLVLKILKQVME 209

>Skud_13.51 Chr13 complement(85368..86120) [753 bp, 250 aa] {ON}
           YML092C (REAL)
          Length = 250

 Score =  145 bits (367), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 78/211 (36%), Positives = 127/211 (60%), Gaps = 3/211 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNE 64
           RY    T FSP G+L Q++YAL ++    TS+GI + +G+V+  E+K +S L   + L+ 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLS- 62

Query: 65  KLYKLSDKITLAVAGLTADAEILINIARQFAQ-NYLMTYNEEIPVEILVKKLSDIKQSYT 123
           K+  L+  I    +G+  D  +L++ +R+ A  +Y   Y E  P ++LV +++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AG+D+  G  LY  +PSG+Y  WKA +IG  + AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 MNLNDAMELGLKTLSKTTDSSNLTYDRVELS 214
           + L DA+ + L TL ++ +      D +EL+
Sbjct: 183 LELEDAIHIALLTLKESVE-GEFNGDTIELA 212

>TDEL0H03300 Chr8 complement(552725..553495) [771 bp, 256 aa] {ON}
           Anc_7.120 YOL038W
          Length = 256

 Score =  145 bits (367), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 73/198 (36%), Positives = 119/198 (60%), Gaps = 8/198 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   +IFSP+G ++QVEYA E++     ++GI  +D +VL  ER+ T KL +  I   K
Sbjct: 4   YDRALSIFSPDGHIFQVEYAAEAVKRGTCAVGIKGRDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           +  +   + L+ +GL AD+ ILI  AR  AQ++ +T  + + VE L + ++ ++Q YTQ 
Sbjct: 64  ISTIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGY---DDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKD 182
           GG+RPFGV+ + AG+   DD   P+LY + PSG Y+ W A +IG N+   +  L+ +Y  
Sbjct: 124 GGVRPFGVATLIAGFDPQDDT--PRLYQTEPSGIYSAWTAQTIGRNSKTVREFLEKNYNR 181

Query: 183 D---MNLNDAMELGLKTL 197
           D       + ++L +++L
Sbjct: 182 DEPPATAEECVKLTVRSL 199

>Kwal_56.24780 s56 complement(1144302..1145090) [789 bp, 262 aa]
           {ON} YGR253C (PUP2) - 1:1 [contig 160] FULL
          Length = 262

 Score =  145 bits (367), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 82/215 (38%), Positives = 127/215 (59%), Gaps = 8/215 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   + FSPEGRL+QVEY+LE+I    T+IG+ + +G+VL  E+++TS LLE D + EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVATSEGVVLGVEKRVTSPLLEGDSI-EK 66

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           + ++   +  A++GLTADA  +I  AR  A  + + Y+EEI VE L + + D+   + + 
Sbjct: 67  IVEIERHVGCAMSGLTADARSMIEHARVSAVTHNLYYDEEISVESLTQSICDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMD 179
                    RPFGV+ + AGYD   G QLY + PSG +  + A +IG+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDQEQGYQLYHAEPSGTFYRFNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELS 214
           +   + L +A  L L+ L +  +   L  D  +LS
Sbjct: 187 WHSSLTLKEAELLVLRILKQVME-EKLDEDNAQLS 220

>YML092C Chr13 complement(85987..86739) [753 bp, 250 aa] {ON}
           PRE8Alpha 2 subunit of the 20S proteasome
          Length = 250

 Score =  145 bits (366), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 78/211 (36%), Positives = 127/211 (60%), Gaps = 3/211 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNE 64
           RY    T FSP G+L Q++YAL ++    TS+GI + +G+V+  E+K +S L   + L+ 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLS- 62

Query: 65  KLYKLSDKITLAVAGLTADAEILINIARQFAQ-NYLMTYNEEIPVEILVKKLSDIKQSYT 123
           K+  L+  I    +G+  D  +L++ +R+ A  +Y   Y E  P ++LV +++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AG+D+  G  LY  +PSG+Y  WKA +IG  + AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 MNLNDAMELGLKTLSKTTDSSNLTYDRVELS 214
           + L DA+ + L TL ++ +      D +EL+
Sbjct: 183 LELEDAIHIALLTLKESVE-GEFNGDTIELA 212

>KNAG0K00450 Chr11 complement(75675..76478) [804 bp, 267 aa] {ON}
           Anc_5.64 YGR253C
          Length = 267

 Score =  145 bits (366), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 81/203 (39%), Positives = 121/203 (59%), Gaps = 7/203 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   + FSPEGRL+QVEY+LE+I    T+IGI + +G+VL  E++ TS LLE D + EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGITTSEGVVLGVEKRATSPLLESDSI-EK 66

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           + ++   I  A++GLTADA  +I  AR  A  + + Y+E I VE L + + D+   + + 
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTSAITHDLYYDENIKVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMD 179
                    RPFGV+ + AGYD   G QLY + PSG +  + A +IG+ +  AQ+ LQ +
Sbjct: 127 AAGEERLMSRPFGVALLIAGYDADDGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDMNLNDAMELGLKTLSKTTD 202
           +   +N+ DA  L LK L +  +
Sbjct: 187 WHSSLNMRDAEVLTLKILKQVME 209

>NCAS0D01340 Chr4 (244060..244845) [786 bp, 261 aa] {ON} Anc_5.64
          Length = 261

 Score =  145 bits (365), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 80/203 (39%), Positives = 123/203 (60%), Gaps = 7/203 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   + FSPEGRL+QVEY+LE+I    T+IGI + +G+VL  E++ TS LLE D + EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTSEGVVLGVEKRATSPLLEADSI-EK 66

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           + ++   I  A++GLTADA  +I  AR  A N+ + Y+E+I VE L + + D+   + + 
Sbjct: 67  IVEIEHHIGCAMSGLTADARSMIEHARVAAVNHNLYYDEDIKVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMD 179
                    RPFGV+ + AGYD+  G QL+ + PSG +  + A +IG+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDNDEGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDMNLNDAMELGLKTLSKTTD 202
           +   + L +A  L LK L +  +
Sbjct: 187 WHSSLTLKEAELLVLKILKQVME 209

>TBLA0C06620 Chr3 complement(1598566..1599354) [789 bp, 262 aa] {ON}
           Anc_5.64 YGR253C
          Length = 262

 Score =  144 bits (364), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 83/215 (38%), Positives = 128/215 (59%), Gaps = 8/215 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   + FSPEGRL+QVEY+LE+I    T+IGI + +G+VL  E++ TS+LLE D + EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTSEGVVLGVEKRATSRLLESDSI-EK 66

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           + ++   I  A++GLTADA  +I  AR  A  + + Y+E+I VE L + + D+   + + 
Sbjct: 67  IVEIEKHIGCAMSGLTADARSMIEHARTSAVTHNLYYDEDISVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMD 179
                    RPFGV+ + AGYD   G QL+ + PSG +  + A +IG+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELS 214
           +   + L +A  L LK L +  +   L  + V+LS
Sbjct: 187 WHSSLTLKEAELLVLKILKQVME-EKLNENNVQLS 220

>TPHA0C04930 Chr3 (1064804..1065556) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  143 bits (361), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 128/212 (60%), Gaps = 5/212 (2%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKL-LEQDILN 63
           RY    T FSP G+L Q++YAL ++    TS+GI + +G+++  E+K +S L L +DI  
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVIIATEKKTSSSLALTEDI-- 61

Query: 64  EKLYKLSDKITLAVAGLTADAEILINIARQFAQ-NYLMTYNEEIPVEILVKKLSDIKQSY 122
            K+  L+  I    +G+  D  +L++ +R+ A  NY   Y E    ++LV +++ + Q  
Sbjct: 62  SKISALTPDIGAVYSGMGPDFRVLVDKSRKVAHTNYKRIYGEYPSTKLLVSEIAKVMQEA 121

Query: 123 TQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKD 182
           TQ GG+RPFGVS + AG+D+  G  LY  +PSG+Y  WKA SIG  ++AA+T L+  + +
Sbjct: 122 TQSGGVRPFGVSLLVAGHDEHNGFSLYQVDPSGSYFPWKATSIGKGSTAAKTFLEKRWNN 181

Query: 183 DMNLNDAMELGLKTLSKTTDSSNLTYDRVELS 214
           ++ L DA+ + L TL ++ +      D +E++
Sbjct: 182 ELELEDAIHIALLTLKESVE-GEFNGDTIEIA 212

>Ecym_5100 Chr5 complement(221199..221984) [786 bp, 261 aa] {ON}
           similar to Ashbya gossypii AER296W
          Length = 261

 Score =  144 bits (362), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 80/203 (39%), Positives = 122/203 (60%), Gaps = 7/203 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   + FSPEGRL+QVEY+LE+I    T+IGI + +G+VL  E+++TS LLE D + EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATNEGVVLGVEKRVTSPLLESDSI-EK 66

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           + ++   I  A++GLTADA  +I  AR  +  + + Y+EEI VE L + + D+   + + 
Sbjct: 67  IVEVDKHIGCAMSGLTADARSMIEHARISSVTHNLYYDEEISVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMD 179
                    RPFGV+ + AGYD   G QLY + PSG +  + A +IG+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKEEGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDMNLNDAMELGLKTLSKTTD 202
           +   + L +A  L LK L +  +
Sbjct: 187 WYSSLTLKEAELLVLKILKQVME 209

>SAKL0H02068g Chr8 (202802..203587) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P32379 Saccharomyces cerevisiae
           YGR253C PUP2 Alpha subunit of the 20S proteasome
           involved in ubiquitin-dependent catabolism human homolog
           is subunit zeta
          Length = 261

 Score =  144 bits (362), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 80/203 (39%), Positives = 122/203 (60%), Gaps = 7/203 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   + FSPEGRL+QVEY+LE+I    T+IGI + +G+VL  E+++TS LLE D + EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGITTSEGVVLGVEKRVTSPLLESDSI-EK 66

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           + ++   I  A++GLTADA  +I  AR  A  + + Y+E+I VE L + + D+   + + 
Sbjct: 67  IVEVDRHIGCAMSGLTADARSMIEHARVSAVTHNLYYDEDIGVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMD 179
                    RPFGV+ + AGYD   G QLY + PSG +  + A +IG+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDEGYQLYHAEPSGTFYRYDAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDMNLNDAMELGLKTLSKTTD 202
           +   + L +A  L LK L +  +
Sbjct: 187 WHSSLTLKEAELLVLKILKQVME 209

>NCAS0B00150 Chr2 complement(10879..11631) [753 bp, 250 aa] {ON}
           Anc_8.871
          Length = 250

 Score =  143 bits (360), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 74/199 (37%), Positives = 123/199 (61%), Gaps = 2/199 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNE 64
           RY    T FSP G+L Q++YAL +++   TS+GI + +G+V+  E+K +S L   + L+ 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVNQGVTSLGIKATNGVVIATEKKSSSPLALTETLS- 62

Query: 65  KLYKLSDKITLAVAGLTADAEILINIARQFAQ-NYLMTYNEEIPVEILVKKLSDIKQSYT 123
           K+  ++  I    +G+  D  +L++ +R+ A  NY   Y    P ++LV +++ I Q  T
Sbjct: 63  KVELITPDIGAVYSGMGPDYRVLVDKSRKVAHTNYKRIYGVYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AG+D+  G  LY  +PSG+Y  WKA +IG  ++AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGHDEHKGFSLYQVDPSGSYFPWKATAIGKGSTAAKTFLEKRWNDE 182

Query: 184 MNLNDAMELGLKTLSKTTD 202
           + L DA+ + L TL ++ +
Sbjct: 183 LELEDAIHIALLTLKESVE 201

>KLLA0A05093g Chr1 (454423..455211) [789 bp, 262 aa] {ON} highly
           similar to uniprot|P32379 Saccharomyces cerevisiae
           YGR253C PUP2 Alpha subunit of the 20S proteasome
           involved in ubiquitin-dependent catabolism human homolog
           is subunit zeta
          Length = 262

 Score =  143 bits (361), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 122/203 (60%), Gaps = 7/203 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   + FSPEGRL+QVEY+LE+I    T+IG+++ +GIVL  E+++TS LLE D + EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVVTNEGIVLGVEKRVTSALLESDSI-EK 66

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           + ++   I  A++GLTADA  ++  AR  A  + + Y+E+I VE L + + D+   + + 
Sbjct: 67  IVEVDTHIGCAMSGLTADARSMLEHARVNAVTHDLYYDEKITVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMD 179
                    RPFGV+ +  GYD   G QLY + PSG +  + A +IG+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIGGYDQEQGFQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDMNLNDAMELGLKTLSKTTD 202
           +   + L +A  L LK L +  +
Sbjct: 187 WHSSLTLKEAESLVLKILKQVME 209

>Kpol_455.5 s455 (4683..5432) [750 bp, 249 aa] {ON} (4683..5432)
           [750 nt, 250 aa]
          Length = 249

 Score =  143 bits (360), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 128/212 (60%), Gaps = 5/212 (2%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKL-LEQDILN 63
           RY    T FSP G+L Q++YAL ++    TS+GI + +G+++  E+K +S L L +D+  
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVIIATEKKSSSPLALTEDV-- 61

Query: 64  EKLYKLSDKITLAVAGLTADAEILINIARQFAQ-NYLMTYNEEIPVEILVKKLSDIKQSY 122
            K+  L+  I    +G+  D  +L++ +R+ A  NY   Y E  P ++LV +++ I Q  
Sbjct: 62  SKISLLTPDIGAVYSGMGPDFRVLVDKSRKVAHTNYKRIYGEYPPTKLLVSEIAKIMQEA 121

Query: 123 TQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKD 182
           TQ GG+RPFGVS + AG+D+  G  LY  +PSG+Y  WKA +IG  + AA+T L+  + +
Sbjct: 122 TQSGGVRPFGVSLLVAGHDEHNGFSLYQVDPSGSYFPWKATAIGKGSIAAKTFLEKRWNN 181

Query: 183 DMNLNDAMELGLKTLSKTTDSSNLTYDRVELS 214
           ++ L DA+ + L TL ++ +      D +E++
Sbjct: 182 ELELEDAIHIALLTLKESVE-GEFNGDTIEIA 212

>AER296W Chr5 (1181448..1182230) [783 bp, 260 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR253C (PUP2)
          Length = 260

 Score =  142 bits (359), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 80/203 (39%), Positives = 122/203 (60%), Gaps = 7/203 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   + FSPEGRL+QVEY+LE+I    T+IGI + +G+VL  E+++TS LLE D + EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATNEGVVLGVEKRVTSPLLESDSI-EK 66

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           + ++   I  A++GLTADA  +I  AR  +  + + Y+EEI VE L + + D+   + + 
Sbjct: 67  IVEVDRHIGCAMSGLTADARSMIEHARISSVTHNLYYDEEIGVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMD 179
                    RPFGV+ + AGYD   G QLY + PSG +  + A +IG+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKEDGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDMNLNDAMELGLKTLSKTTD 202
           +   + L +A  L LK L +  +
Sbjct: 187 WYSSLTLKEAELLVLKILKQVME 209

>KLTH0H00528g Chr8 (57753..58538) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P32379 Saccharomyces cerevisiae
           YGR253C PUP2 Alpha subunit of the 20S proteasome
           involved in ubiquitin-dependent catabolism human homolog
           is subunit zeta
          Length = 261

 Score =  142 bits (358), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 122/203 (60%), Gaps = 7/203 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   + FSPEGRL+QVEY+LE+I    T+IG+ + +G+VL  E+++TS LLE D + EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVATSEGVVLGVEKRVTSPLLEGDSI-EK 66

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           + ++   +  A++GLTADA  +I  AR  +  + + Y+E+I +E L + + D+   + + 
Sbjct: 67  IVEIERHVGCAMSGLTADARSMIEHARVSSVTHNLYYDEDISIESLTQSICDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMD 179
                    RPFGV+ + AGYD   G QLY + PSG +  + A +IG+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDSEQGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDMNLNDAMELGLKTLSKTTD 202
           +   + L +A  L LK L +  +
Sbjct: 187 WHSSLTLKEAELLVLKILKQVME 209

>KNAG0L01020 Chr12 complement(188232..189032) [801 bp, 266 aa] {ON}
           Anc_7.120 YOL038W
          Length = 266

 Score =  142 bits (359), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 70/181 (38%), Positives = 109/181 (60%), Gaps = 5/181 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   +IFSP+G ++QVEYALE++     ++G+     +VL  ER+ T KL +      K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVRRGTCAVGVKGPRCVVLGCERRSTLKLQDPRTTPSK 63

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           +  +   + L+ AGL+ADA +LI  AR  AQ++ +T  + + VE + + ++ I+Q YTQ 
Sbjct: 64  VALVDTHVALSFAGLSADARVLIERARTEAQSHRLTLEDPVSVEYMARYIAGIQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDILG---PQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKD 182
           GG+RPFGVS + AG+D   G   P+LY + PSG Y+ W A +IG N    +  L+ +Y  
Sbjct: 124 GGVRPFGVSTLVAGFDS--GDDTPRLYHTEPSGIYSAWTAQTIGRNAKTVREFLEKNYAG 181

Query: 183 D 183
           +
Sbjct: 182 E 182

>ZYRO0A00616g Chr1 complement(41163..41915) [753 bp, 250 aa] {ON}
           highly similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092C PRE8 20S proteasome beta-type subunit
          Length = 250

 Score =  142 bits (357), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 126/211 (59%), Gaps = 3/211 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNE 64
           RY    T FSP G+L Q++YA  ++    TSIG+ + +G+V+  E+K +S L   + LN 
Sbjct: 4   RYSFSLTTFSPNGKLGQIDYAFTAVKQGVTSIGVKATNGVVIATEKKSSSPLALTETLN- 62

Query: 65  KLYKLSDKITLAVAGLTADAEILINIARQFAQ-NYLMTYNEEIPVEILVKKLSDIKQSYT 123
           K+ +++  I    +G+  D  +L++ +R+ A  +Y   Y E  P ++LV +++ I Q  T
Sbjct: 63  KISQITPNIGTVYSGMGPDYRVLVDKSRKVAHTHYKRIYGEYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDD 183
           Q GG+RP+G S + AGYD+  G  LY  +PSG+Y  WKA +IG  ++AA+T L+  + ++
Sbjct: 123 QSGGVRPYGASLLVAGYDEHTGFGLYQVDPSGSYFPWKATAIGKGSTAAKTFLEKRWNEE 182

Query: 184 MNLNDAMELGLKTLSKTTDSSNLTYDRVELS 214
           + L DA+   L TL ++ +      D +E++
Sbjct: 183 LELEDAIHTVLLTLKESVE-GEFNGDTIEIA 212

>TDEL0B00400 Chr2 (73242..73994) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  141 bits (356), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 76/211 (36%), Positives = 127/211 (60%), Gaps = 3/211 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNE 64
           RY    T FSP G+L Q++YA  ++    TSIGI + +G+V+ +E+K +S L   + L+ 
Sbjct: 4   RYSFSLTTFSPNGKLGQIDYAFTAVKQGVTSIGIKATNGVVIASEKKSSSPLALTETLS- 62

Query: 65  KLYKLSDKITLAVAGLTADAEILINIARQFAQ-NYLMTYNEEIPVEILVKKLSDIKQSYT 123
           K+  ++  I    +G+  D  +L++ +R+ A  +Y   Y E  P ++LV +++ I Q  T
Sbjct: 63  KVSVITPDIGAVYSGMGPDFRVLVDKSRKVAHTHYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AGYD+  G  LY  +PSG+Y  WKA +IG  ++AA+T L+  +  +
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHSGFGLYQVDPSGSYFPWKATAIGRGSTAAKTFLEKRWNAE 182

Query: 184 MNLNDAMELGLKTLSKTTDSSNLTYDRVELS 214
           + L DA+ + L TL ++ +      D +E++
Sbjct: 183 LELEDAIHIVLLTLKESVE-GEFNGDTIEIA 212

>TDEL0G00880 Chr7 (179880..180662) [783 bp, 260 aa] {ON} Anc_5.64
           YGR253C
          Length = 260

 Score =  141 bits (356), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 121/203 (59%), Gaps = 7/203 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   + FSPEGRL+QVEY+LE+I    T+IGI + +G+VL  E++ TS LLE D + EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATSEGVVLGVEKRATSPLLEADSI-EK 66

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           + ++   I  A++GLTADA  +I  AR  A  + + Y+E++ VE L + + D+   + + 
Sbjct: 67  IVEVDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDMSVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMD 179
                    RPFGV+ + AGYD   G QL+ + PSG +  + A +IG+ +  AQ+ LQ +
Sbjct: 127 AAGEERLMSRPFGVALLIAGYDKESGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDMNLNDAMELGLKTLSKTTD 202
           +   + L +A  L LK L +  +
Sbjct: 187 WHSSLTLKEAELLVLKILKQVME 209

>CAGL0I02442g Chr9 complement(216120..216902) [783 bp, 260 aa] {ON}
           highly similar to uniprot|P32379 Saccharomyces
           cerevisiae YGR253c PUP2
          Length = 260

 Score =  141 bits (355), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 75/203 (36%), Positives = 123/203 (60%), Gaps = 7/203 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   + FSPEGRL+QVEY+LE+I    T+IG+++ +G+VL  E++ TS LLE D + EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVVTSEGVVLGVEKRATSPLLESDSI-EK 66

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           + ++   +  A++GLTADA  ++  AR  A  + + Y+E+I +E L + + D+   + + 
Sbjct: 67  IVEIDRHVGCAMSGLTADARSMLEHARVSAVTHNLYYDEDIKIESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMD 179
                    RPFGV+ + AGYD   G QL+ + PSG +  + A +IG+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDMNLNDAMELGLKTLSKTTD 202
           +   + L +A +L LK L +  +
Sbjct: 187 WHSSLTLKEAEQLVLKILKQVME 209

>SAKL0D00440g Chr4 complement(37327..38035,38098..38141) [753 bp,
           250 aa] {ON} highly similar to uniprot|P23639
           Saccharomyces cerevisiae YML092C PRE8 20S proteasome
           beta-type subunit
          Length = 250

 Score =  140 bits (354), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 75/211 (35%), Positives = 127/211 (60%), Gaps = 3/211 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNE 64
           RY    T FSP G+L Q++YAL ++    TS+GI + +G+++  E+K +S L   + L+ 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVIIATEKKSSSPLALTESLS- 62

Query: 65  KLYKLSDKITLAVAGLTADAEILINIARQFAQ-NYLMTYNEEIPVEILVKKLSDIKQSYT 123
           K+  ++  I    +G+  D  +L++ +R+ A  +Y   Y E  P +ILV +++   Q  T
Sbjct: 63  KVALITPDIGAVYSGMGPDFRVLVDKSRKVAHTHYKRIYGEYPPTKILVSEIAKTMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AGYD+  G  LY  +PSG+Y  WKA +IG + +AA+T L+  + ++
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGYGLYQVDPSGSYFPWKATAIGKSATAAKTFLEKRWNEE 182

Query: 184 MNLNDAMELGLKTLSKTTDSSNLTYDRVELS 214
           + L DA+ + L TL ++ +      D +E++
Sbjct: 183 LELEDAIHIALLTLKESVE-GEFNGDTIEIA 212

>KAFR0B04440 Chr2 (923770..924552) [783 bp, 260 aa] {ON} Anc_5.64
           YGR253C
          Length = 260

 Score =  140 bits (353), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 76/203 (37%), Positives = 122/203 (60%), Gaps = 7/203 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   + FSPEGRL+QVEY+LE+I    T++GI + +G+VL  E++ TS LLE D + EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAVGICTSEGVVLGVEKRATSPLLESDSI-EK 66

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           + ++   +  A++GLTADA  +I  AR  A ++ + Y+E+I +E L + + D+   + + 
Sbjct: 67  IVEIDRHVGCAMSGLTADARSMIEHARVAAVSHNLYYDEDIKIESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMD 179
                    RPFGV+ + AGYD   G QL+ + PSG +  + A +IG+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDMNLNDAMELGLKTLSKTTD 202
           +   + L +A  L LK L +  +
Sbjct: 187 WHSSLTLKEAELLVLKILKQVME 209

>ZYRO0C11770g Chr3 complement(920017..920799) [783 bp, 260 aa] {ON}
           highly similar to uniprot|P32379 Saccharomyces
           cerevisiae YGR253C PUP2 Alpha subunit of the 20S
           proteasome involved in ubiquitin-dependent catabolism
           human homolog is subunit zeta
          Length = 260

 Score =  138 bits (347), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 77/203 (37%), Positives = 119/203 (58%), Gaps = 7/203 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   + FSPEGRL+QVEY+LE+I    T+IGI + +G++L  E++  S LLE D + EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATSEGVILGVEKRANSPLLEADSI-EK 66

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           + ++   I  A++GLTADA  +I  AR  A  + + Y+E I VE L + + D+   + + 
Sbjct: 67  ILEVDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDENISVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMD 179
                    RPFGV+ + AGYD   G QL+ + PSG +  + A +IG+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDMNLNDAMELGLKTLSKTTD 202
           +   + L +A  L LK L +  +
Sbjct: 187 WHSSLTLKEAELLVLKILKQVME 209

>YGR253C Chr7 complement(998358..999140) [783 bp, 260 aa] {ON}
           PUP2Alpha 5 subunit of the 20S proteasome involved in
           ubiquitin-dependent catabolism; human homolog is subunit
           zeta
          Length = 260

 Score =  137 bits (346), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 120/203 (59%), Gaps = 7/203 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   + FSPEGRL+QVEY+LE+I    T+IGI +K+G+VL  E++ TS LLE D + EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESDSI-EK 66

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           + ++   I  A++GLTADA  +I  AR  A  + + Y+E+I VE L + + D+   + + 
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMD 179
                    RPFGV+ + AG+D   G QL+ + PSG +  + A +IG+ +  AQ  L  +
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 YKDDMNLNDAMELGLKTLSKTTD 202
           +   + L +A  L LK L +  +
Sbjct: 187 WHSSLTLKEAELLVLKILKQVME 209

>Suva_7.549 Chr7 complement(953986..954768) [783 bp, 260 aa] {ON}
           YGR253C (REAL)
          Length = 260

 Score =  137 bits (346), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 120/203 (59%), Gaps = 7/203 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   + FSPEGRL+QVEY+LE+I    T+IGI +K+G+VL  E++ TS LLE D + EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESDSI-EK 66

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           + ++   I  A++GLTADA  +I  AR  A  + + Y+E+I VE L + + D+   + + 
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMD 179
                    RPFGV+ + AG+D   G QL+ + PSG +  + A +IG+ +  AQ  L  +
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 YKDDMNLNDAMELGLKTLSKTTD 202
           +   + L +A  L LK L +  +
Sbjct: 187 WHSSLTLKEAELLVLKILKQVME 209

>Skud_7.586 Chr7 complement(972832..973614) [783 bp, 260 aa] {ON}
           YGR253C (REAL)
          Length = 260

 Score =  137 bits (345), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 121/203 (59%), Gaps = 7/203 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   + FSPEGRL+QVEY+LE+I    T+IGI +K+G+VL  E++ TS LLE D + EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTKEGVVLGVEKRATSPLLESDSI-EK 66

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           + ++   I  A++GLTADA  +I  AR  A  + + Y+E+I VE L + + D+   + + 
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMD 179
                    RPFGV+ + AG+D   G QL+ + PSG +  + A +IG+ +  AQ  L  +
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 YKDDMNLNDAMELGLKTLSKTTD 202
           +   ++L +A  L LK L +  +
Sbjct: 187 WHSSLSLKEAELLILKILKQVME 209

>Smik_16.54 Chr16 (97704..98486) [783 bp, 260 aa] {ON} YGR253C
           (REAL)
          Length = 260

 Score =  137 bits (345), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 120/203 (59%), Gaps = 7/203 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   + FSPEGRL+QVEY+LE+I    T+IGI +K+G+VL  E++ TS LLE D + EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESDSI-EK 66

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           + ++   I  A++GLTADA  +I  AR  A  + + Y+E+I VE L + + D+   + + 
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMD 179
                    RPFGV+ + AG+D   G QL+ + PSG +  + A +IG+ +  AQ  L  +
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 YKDDMNLNDAMELGLKTLSKTTD 202
           +   + L +A  L LK L +  +
Sbjct: 187 WHSSLTLKEAELLILKILKQVME 209

>TBLA0C06340 Chr3 complement(1530163..1530933) [771 bp, 256 aa] {ON}
           Anc_8.871 YML092C
          Length = 256

 Score =  135 bits (339), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 76/205 (37%), Positives = 114/205 (55%), Gaps = 8/205 (3%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNE 64
           RY    T FSP G+L Q++YAL ++    T++GI + +G+VL  E+K  S L   + L +
Sbjct: 4   RYSFSLTTFSPNGKLGQIDYALTAVKQGVTALGIKATNGVVLATEKKSGSSLALAESL-D 62

Query: 65  KLYKLSDKITLAVAGLTADAEILINIARQFAQ-NYLMTYNEEIPVEILVKKLSDIKQSYT 123
           K+  L+  I    AG+  D  +L++ AR+ A  NY   Y E  P   LV  ++ I Q  T
Sbjct: 63  KISLLTPNIGTVYAGMGPDCRVLVDKARKAAHTNYKRVYGEYPPTRQLVADVAAIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDI------LGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQ 177
           Q GG+RPFGVS + AG+D+        G  LY  +PSG Y  WKA ++G    AA+T L+
Sbjct: 123 QSGGVRPFGVSLLVAGHDNANENDSNSGFALYQVDPSGAYFPWKATAVGRGAVAAKTFLE 182

Query: 178 MDYKDDMNLNDAMELGLKTLSKTTD 202
             + D++ L DA+ + L  L +  +
Sbjct: 183 KRWHDELELEDAVHIALLALREAVE 207

>ADR401C Chr4 complement(1425757..1426593,1426655..1426657) [840 bp,
           279 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YOR362C (PRE10); 1-intron
          Length = 279

 Score =  129 bits (323), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 71/212 (33%), Positives = 116/212 (54%), Gaps = 5/212 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   ++FSP+GR +QVEYA++++ +  TSIGI  KDG+V   E+ ITSKLL     N+K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSIGIRCKDGVVFAVEKLITSKLLVPH-KNKK 66

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           +  +   I    +GL  D   L+NI RQ A ++   Y + IP+     ++    Q++T +
Sbjct: 67  IQTVDKHIGCVYSGLMPDGRHLVNIGRQEAADFRKYYRQPIPLPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQM---DYKD 182
             +RPFG+  I+ G D+  GP LY   PSG Y G++  + G    AA+  L+    + K 
Sbjct: 127 NSVRPFGIIAIFGGVDE-KGPHLYMLEPSGAYWGYRGAAAGKGRQAAKAELEKLIGNDKS 185

Query: 183 DMNLNDAMELGLKTLSKTTDSSNLTYDRVELS 214
           +++  DA++   + +    + +      +ELS
Sbjct: 186 ELSARDAVKEAARIIYVAHEDNKEKEFEIELS 217

>ZYRO0C00792g Chr3 (60472..61344) [873 bp, 290 aa] {ON} highly
           similar to uniprot|P21242 Saccharomyces cerevisiae
           YOR362C PRE10 20S proteasome alpha-type subunit
          Length = 290

 Score =  127 bits (318), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 110/195 (56%), Gaps = 5/195 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   ++FSP+GR +QVEYA++++ +  TSIGI   DG+V   E+ ++SKLL     N K
Sbjct: 8   YDLANSVFSPDGRNFQVEYAVKAVENGTTSIGIRCNDGVVFAVEKLVSSKLLVPK-RNVK 66

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           +  +   +    +GL  D   L+N  R+ AQ++  T+ E IP++ L  +L    Q++T +
Sbjct: 67  IQTIDRHVGCVYSGLIPDGRHLVNRGREEAQSHKKTFGESIPLQALADRLGYYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQM---DYKD 182
             +RPFGV+ I+ G DD  GP LY   PSG + G+K  + G     A+  L+     + +
Sbjct: 127 NSVRPFGVTAIFGGVDD-KGPHLYMLEPSGTFWGYKGAATGKGRQTAKAELEKVIDQHPE 185

Query: 183 DMNLNDAMELGLKTL 197
            ++  DA++   K +
Sbjct: 186 GLSAKDAVKEAAKVI 200

>Ecym_7233 Chr7 (485803..486543) [741 bp, 246 aa] {ON} similar to
           Ashbya gossypii AGL089W
          Length = 246

 Score =  124 bits (310), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 101/182 (55%), Gaps = 2/182 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TSIGIMSKDGIVLLAERKITSKLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     S+ I  K+ +VL+ ++K+  KLL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSVAIKGKNCVVLVNQKKVPDKLLDP 60

Query: 60  DILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIK 119
             ++  ++ +S  I +   G   DA  +    +  A  +   Y  +IPV +L K+L+++ 
Sbjct: 61  ATVS-YMFPISKHIGMCATGPIGDARNVAVRCKSMAAEFRYEYGYDIPVHVLAKRLANLA 119

Query: 120 QSYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMD 179
           Q+YTQ   +RP GV   +   D+  GP ++  +P+G YTG+KA + G       T L+  
Sbjct: 120 QTYTQRAYMRPLGVVLTFISVDEEKGPSIFKCDPAGYYTGYKATATGPKQQELITALEKH 179

Query: 180 YK 181
           +K
Sbjct: 180 FK 181

>AGL089W Chr7 (539399..540139) [741 bp, 246 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL011C (SCL1)
          Length = 246

 Score =  124 bits (310), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 63/182 (34%), Positives = 98/182 (53%), Gaps = 2/182 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TSIGIMSKDGIVLLAERKITSKLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     S+ I  K   VL+ ++K+  KLLE 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSVAIRGKSCTVLVNQKKVPDKLLEP 60

Query: 60  DILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIK 119
             +   L+ ++  I +   G  ADA  +    R  A  +   Y  ++PV +L K+ +++ 
Sbjct: 61  STVT-YLFPIAKHIGMCATGPIADARNVAVRCRAMAAEFRYEYGYDMPVHVLAKRFANLS 119

Query: 120 QSYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMD 179
           Q+YTQ   +RP GV   +   D+  GP ++  +P+G YTG+KA + G       T L+  
Sbjct: 120 QTYTQRAYMRPLGVVLTFISVDEEEGPSIFKCDPAGYYTGYKATATGPKQQELITALEKH 179

Query: 180 YK 181
           +K
Sbjct: 180 FK 181

>KLLA0A05027g Chr1 (450398..451138) [741 bp, 246 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 246

 Score =  123 bits (308), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 108/205 (52%), Gaps = 9/205 (4%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TSIGIMSKDGIVLLAERKITSKLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     SI I SK   V+++++K+  KLL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKAANQPNLNSIAIRSKTASVVISQKKVPDKLLDP 60

Query: 60  DILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIK 119
             ++  ++ ++  I     G   DA  +    +  A  +   Y  +IP  +L K+++++ 
Sbjct: 61  KTVS-YIFPVARHIGFCATGPVPDARNIALRCKAEASEFRYKYGYDIPCSVLAKRMANLS 119

Query: 120 QSYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMD 179
           Q YTQ   +RP G+   +  YD+  GP ++  +P+G YTG+KA + G       + L+  
Sbjct: 120 QIYTQRAYMRPLGIILTFISYDEETGPAIFKCDPAGYYTGYKATATGPKQQELNSALEKH 179

Query: 180 YK-------DDMNLNDAMELGLKTL 197
           +K       D+ +    +E G+ TL
Sbjct: 180 FKKLKDDKIDEESWEKTVEFGITTL 204

>CAGL0H06105g Chr8 (596149..597021) [873 bp, 290 aa] {ON} highly
           similar to uniprot|P21242 Saccharomyces cerevisiae
           YOR362c PRE10
          Length = 290

 Score =  124 bits (310), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 68/194 (35%), Positives = 107/194 (55%), Gaps = 4/194 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   ++FSP+GR +QVEYA +++ +  TSIGI   DG+V   E+ ITSKLL  +  N K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYANKAVENGATSIGIKFNDGVVFAVEKIITSKLLVPN-KNLK 66

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           +  +   I +  +GL  D   L+N AR+ +QN+   Y   IPV+   +++    Q++T  
Sbjct: 67  IQTVDKHIGVVYSGLIPDGRHLVNRAREESQNFRKMYGSAIPVDAFAERVGQYVQAHTLF 126

Query: 126 GGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQ--MDYKDD 183
             +RPFGV+ I+ G D   GP LY   PSG Y G+   + G     A+  L+  +D   +
Sbjct: 127 NSVRPFGVTAIFGGCDK-NGPHLYMLEPSGTYWGYNGAATGKGRQTAKAELEKLLDKTPE 185

Query: 184 MNLNDAMELGLKTL 197
           M+  +A +   + +
Sbjct: 186 MSAKEAAKHAARII 199

>TBLA0E00690 Chr5 complement(136929..137765) [837 bp, 278 aa] {ON}
           Anc_7.20 YOR362C
          Length = 278

 Score =  123 bits (308), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 68/195 (34%), Positives = 107/195 (54%), Gaps = 5/195 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   ++FSP+GR +QVEYA++++ +  TS+GI   DG+V   E+ I+SKLL     N K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSVGIKCDDGVVFAVEKIISSKLLVPK-RNVK 66

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           +  +   I    +GL  D   L+N  R+ A N+   Y + IPV  L  ++S   Q+YT +
Sbjct: 67  IQTIDRHIGCVYSGLIPDGRYLVNRGREEASNFKKLYTKPIPVSALADRISQYVQAYTLY 126

Query: 126 GGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYK---D 182
             +RPFG+S I  G D+  G  LY   PSG   G+K  + G    AA+  L+  +    D
Sbjct: 127 NSVRPFGISAIIGGIDED-GSHLYMVEPSGTCWGYKGAATGKGRQAAKAELEKLFDRSTD 185

Query: 183 DMNLNDAMELGLKTL 197
            +++ DA++   + +
Sbjct: 186 GLSVKDAIKEAARVI 200

>CAGL0M14003g Chr13 (1383750..1384451) [702 bp, 233 aa] {ON} highly
           similar to uniprot|P40302 Saccharomyces cerevisiae
           YMR314w PRE5
          Length = 233

 Score =  121 bits (303), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 77/217 (35%), Positives = 112/217 (51%), Gaps = 7/217 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I     ++G+ SKD  VL+A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSKDYAVLVALKRNADEL---S 57

Query: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120
              +K+ K  + + L++AGL  DA +L N  RQ      + YN ++ VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSQLVYNRKLSVEKAGHMLCDKAQ 117

Query: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GYD+  GP L    PSGN       +IGA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGYDNS-GPHLLEFQPSGNTLEVYGSAIGARSQGAKTYLERVL 176

Query: 181 KDDMNLNDAMEL---GLKTLSKTTDSSNLTYDRVELS 214
            D + + DA EL   G++ L ++     L  D + ++
Sbjct: 177 DDYLAITDATELIKSGVEALRQSLKDETLNTDNLSIA 213

>KLTH0D00902g Chr4 (86268..86270,86342..87172) [834 bp, 277 aa] {ON}
           highly similar to uniprot|P21242 Saccharomyces
           cerevisiae YOR362C PRE10 20S proteasome alpha-type
           subunit
          Length = 277

 Score =  122 bits (306), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 65/172 (37%), Positives = 99/172 (57%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   ++FSP+GR +QVEYA+++  +  TS+G+  KDGIVL  E+ +TSKLL     N+K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAAENGATSVGMKFKDGIVLAVEKLVTSKLLVPG-KNKK 66

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           +  +   +  A +GL  D   L+N  R+ A ++  TY   IP+  L  +L    Q++T +
Sbjct: 67  IQTIDRHVGCAYSGLMPDGRHLVNRGREEASSFKKTYATPIPLPALADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQ 177
             +RPFG++ I  G DD  G  LY   PSG Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGITAIVGGVDDD-GAHLYMLEPSGTYWGYKGAATGKGRQSAKAELE 177

>NCAS0I00250 Chr9 complement(31100..31978) [879 bp, 292 aa] {ON}
           Anc_7.20
          Length = 292

 Score =  122 bits (306), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 95/172 (55%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   ++FSP+GR +QVEYA++++ +  TSIGI   DG+V   E+ +TSKLL     N K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSIGIKCDDGVVFAVEKIVTSKLLVPK-RNVK 66

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           +  +   I    +GL  D    +N  R+ A N+   Y+  IP+     ++    Q++T +
Sbjct: 67  IQGIDRHIGCVYSGLIPDGRHFVNRGREEASNFKKLYSNAIPIPAFADRIGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQ 177
             +RPFGV+ I+ G D+  GP LY   PSG Y G+K  + G     A+  L+
Sbjct: 127 NSVRPFGVTAIFGGIDE-NGPHLYMLEPSGTYWGYKGAATGKGRQTAKAELE 177

>Kpol_538.40 s538 complement(86524..87348) [825 bp, 274 aa] {ON}
           complement(86524..87348) [825 nt, 275 aa]
          Length = 274

 Score =  122 bits (305), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 100/172 (58%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   ++FSP+GR +QVEYA++++ +  TS+GI   DG+V   E+ I+SKLL     N K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSVGIKCNDGVVFAVEKLISSKLLVPK-KNVK 66

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           +  +   I    +GL  D   L+N  R+ ++++   Y++ IP+     ++    Q++T +
Sbjct: 67  IQVIDRHIGCVYSGLIPDGRHLVNRGREESKSFSQMYSKRIPIPAFADRIGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQ 177
             +RPFGVS I+ G DD  G  LY   PSG+Y G+K  + G+    A+T L+
Sbjct: 127 NSVRPFGVSAIFGGIDD-EGSHLYMIEPSGSYWGYKGAAAGSGRQIAKTELE 177

>Ecym_5019 Chr5 (42044..42046,42100..42954) [858 bp, 285 aa] {ON}
           similar to Ashbya gossypii ADR401C
          Length = 285

 Score =  122 bits (305), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 96/172 (55%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   ++FSP+GR +QVEYA++++ +  TSIGI  KDG+V   E+ I SKLL     NEK
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGSTSIGIKCKDGVVFAVEKLINSKLLVPS-KNEK 66

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           +  +   I    +GL  D   L+NI RQ A ++   Y + I +     ++    Q++T +
Sbjct: 67  IQTIDKHIGCVYSGLMPDGRHLVNIGRQEANSFRKLYRKPITIPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQ 177
             +RPFG+  I+ G DD  G  LY   PSG Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGIIAIFGGVDD-EGAHLYMLEPSGAYWGYKGAATGKGRQSAKAELE 177

>KLTH0B09504g Chr2 complement(779619..780320) [702 bp, 233 aa] {ON}
           highly similar to uniprot|P40302 Saccharomyces
           cerevisiae YMR314W PRE5 20S proteasome alpha-type
           subunit
          Length = 233

 Score =  120 bits (301), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 72/192 (37%), Positives = 103/192 (53%), Gaps = 4/192 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I     ++G+ SK   VL+A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGVRSKKFAVLVALKRNADEL---S 57

Query: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120
              +K+ K  + + L++AGL  D  +L N  RQ      + YN ++ +E     LSD  Q
Sbjct: 58  SYQKKIIKCDEHLGLSLAGLAPDGRVLSNFLRQQCNYSSLVYNRKLSLEKAGNLLSDKAQ 117

Query: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180
             TQ  G RP+GV  + AGYD+  GP L    PSGN       +IGA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLAGYDNS-GPHLLEFQPSGNTLELYGSAIGARSQGAKTYLERTL 176

Query: 181 KDDMNLNDAMEL 192
           +D + L+DA +L
Sbjct: 177 QDYLELDDADDL 188

>KNAG0E01180 Chr5 complement(232483..233184) [702 bp, 233 aa] {ON}
           Anc_5.1 YMR314W
          Length = 233

 Score =  119 bits (299), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 74/210 (35%), Positives = 107/210 (50%), Gaps = 7/210 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I     ++G+ S     L+A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSSKYACLVALKRNADEL---S 57

Query: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120
              +K+ K  D + L++AGL  DA +L N  RQ      + YN E+ +E +   LSD  Q
Sbjct: 58  SYQKKIIKCDDHVGLSLAGLAPDARVLSNFVRQHCNYSKLVYNRELSMEKIGYLLSDKAQ 117

Query: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GYD   GP L    PSGN       +IGA +  ++T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLVGYDKS-GPHLIEFQPSGNILELYGAAIGARSQGSRTYLERVM 176

Query: 181 KDDMNLNDAMEL---GLKTLSKTTDSSNLT 207
            D + + DA EL   G++ L ++     L+
Sbjct: 177 DDFLPVEDATELIKQGVEALRQSLKDETLS 206

>KNAG0E00230 Chr5 (29197..30036) [840 bp, 279 aa] {ON} Anc_7.20
           YOR362C
          Length = 279

 Score =  120 bits (301), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 63/188 (33%), Positives = 104/188 (55%), Gaps = 10/188 (5%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLL-------E 58
           YD   ++FSP+GR +QVEYA +++ +  TS+G++ +DG+VL  E+ + SKLL       +
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAAKAVENGATSVGLLCEDGVVLAVEKLVASKLLVKASPQNK 67

Query: 59  QDILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDI 118
               N K+  +   I  A +GL  D   L+N AR+ +Q +   Y  +IP   L  ++   
Sbjct: 68  GSGANTKIQTVGRHIGCACSGLVPDGRHLVNRAREESQQFKQLYKRDIPPVALADRMGQY 127

Query: 119 KQSYTQHGGLRPFGVSFIYAGYD-DILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQ 177
            Q++T +  +RPFGV+ I+ G D +   P LY   PSG Y G++  + G    +A+  L+
Sbjct: 128 VQAHTLYNSVRPFGVAAIFGGVDPETAEPHLYMLEPSGVYWGYRGAATGKGRQSAKAELE 187

Query: 178 --MDYKDD 183
             +  +DD
Sbjct: 188 KLISSRDD 195

>Smik_15.546 Chr15 complement(963345..964211) [867 bp, 288 aa] {ON}
           YOR362C (REAL)
          Length = 288

 Score =  120 bits (300), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 65/172 (37%), Positives = 96/172 (55%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   ++FSP+GR +QVEYA++++ +  TSIGI   DG+V   E+ ITSKLL     N K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQ-KNVK 66

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           +  +   I    +GL  D   L+N  R+ A ++   YN  IP+     +L    Q++T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYNTPIPIPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQ 177
             +RPFGVS I+ G D   G  LY   PSG+Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGVSTIFGGVDKN-GAHLYMLEPSGSYWGYKGAATGKGRQSAKAELE 177

>KLLA0A03487g Chr1 (316951..316953,317116..317940) [828 bp, 275 aa]
           {ON} similar to uniprot|P21242 Saccharomyces cerevisiae
           YOR362C PRE10 20S proteasome alpha-type subunit
          Length = 275

 Score =  119 bits (299), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 64/181 (35%), Positives = 102/181 (56%), Gaps = 2/181 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   ++FSP+GR +QVEYA++++ +  TS+GI  +DG+VL  E+ ITSKLL     N+K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGSTSLGIKCEDGVVLAVEKLITSKLLVPG-KNKK 66

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           +  +   I    +GL  D   L+N  R+ A ++   Y+  IP+     ++    Q++T +
Sbjct: 67  IQTVDRHIGCVYSGLMPDGRHLVNRGREEAASFKKMYSTPIPIPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMN 185
             +RPFGV+ I+ G D   G  LY   PSG Y G+K+ + G    +A+  L+     + N
Sbjct: 127 NSVRPFGVTAIFGGVDSD-GAHLYMLEPSGTYWGYKSAATGKGRQSAKAELEKLSNKNPN 185

Query: 186 L 186
           L
Sbjct: 186 L 186

>NDAI0A08770 Chr1 complement(2020318..2021196) [879 bp, 292 aa] {ON}
           Anc_7.20
          Length = 292

 Score =  119 bits (299), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 104/195 (53%), Gaps = 5/195 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   ++FSP+GR +QVEYA +++ +  TSIGI  KDG+V   E+ ITSKLL     N K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAGKAVENGATSIGIKCKDGVVFAVEKIITSKLLVPK-KNVK 66

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           +  +   I    +GL  D   L+N  R+ A ++   Y+  IP+    ++L    Q++T +
Sbjct: 67  IQGVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKMYDLPIPISAFAERLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQM---DYKD 182
             +RPFGV+ I+ G D+  GP LY   PSG   G+   + G     A+  L+     + D
Sbjct: 127 NSVRPFGVTSIFGGIDE-KGPHLYMLEPSGTCWGYNGAATGKGRQTAKAELEKLADQHPD 185

Query: 183 DMNLNDAMELGLKTL 197
            +   DA++   K +
Sbjct: 186 GLTTRDAVKYAAKII 200

>TBLA0C04080 Chr3 complement(987028..987789) [762 bp, 253 aa] {ON}
           Anc_4.110 YGL011C
          Length = 253

 Score =  118 bits (296), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 67/192 (34%), Positives = 103/192 (53%), Gaps = 8/192 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TSIGIMSKDGIVLLAERKITSKLLEQDILNE 64
           YD   TIFSPEGRLYQVEYA ++ +     SI I      V++ ++K+  KLL+   ++ 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKACNQTNINSIAIRGNKCAVIVNQKKVPDKLLDPSTVS- 70

Query: 65  KLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQ 124
            ++ +S  I L   G   DA+     A+     Y   Y  ++P ++L K++++I Q YTQ
Sbjct: 71  YIFPISKTIGLVANGPIPDAKNAATKAKTETAEYRYKYGYDMPCDVLAKRMANIAQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGA-----NTSAAQTLLQMD 179
              +RP GV   +  YD+ LGP +Y ++P+G Y G+KA + G      NT       + D
Sbjct: 131 RAYMRPLGVILTFISYDEELGPSIYKTDPAGYYVGYKATATGPKQQEINTGLENWFKKND 190

Query: 180 YKDDMNLNDAME 191
            K+ +N  DA E
Sbjct: 191 VKEKIN-EDAWE 201

>KAFR0C05000 Chr3 (992380..993225) [846 bp, 281 aa] {ON} Anc_7.20
           YOR362C
          Length = 281

 Score =  118 bits (296), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 98/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   ++FSP+GR +QVEYA++++ +  TSIGI   DG+V   E+ ITSKL+  +  N K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSIGIKCNDGVVFAVEKLITSKLMVPN-KNIK 66

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           +  +   I    +GL  D   L+N  R+ + ++   Y + IP+  L  +L    Q++T +
Sbjct: 67  IQTIDRHIGCVYSGLIPDGRHLVNRGREESSSFKKLYGKPIPIPALADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQ 177
             +RPFG++ I+ G D+  G  LY   PSG+Y G+K  + G     A+  L+
Sbjct: 127 NSVRPFGITAIFGGVDED-GSHLYMLEPSGSYWGYKGAATGKGRQTAKAELE 177

>Skud_15.530 Chr15 complement(955569..956435) [867 bp, 288 aa] {ON}
           YOR362C (REAL)
          Length = 288

 Score =  118 bits (296), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 65/172 (37%), Positives = 95/172 (55%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   ++FSP+GR +QVEYA++++ +  TSIGI   DG+V   E+ ITSKLL     N K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQ-KNVK 66

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           +  +   I    +GL  D   L+N  R+ A ++   Y   IPV     +L    Q++T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKMYKTPIPVPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQ 177
             +RPFGVS I+ G D   G  LY   PSG+Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGVSTIFGGVDKD-GAHLYMLEPSGSYWGYKGAATGKGRQSAKAELE 177

>TDEL0H04310 Chr8 complement(742283..743107) [825 bp, 274 aa] {ON}
           Anc_7.20 YOR362C
          Length = 274

 Score =  117 bits (294), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 98/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   ++FSP+GR +QV+YA++++ +  TSIGI  KDG+V   E+ +TSKLL     N K
Sbjct: 8   YDLSNSVFSPDGRNFQVQYAVKAVENGTTSIGIKFKDGVVFAVEKLVTSKLLVPK-KNVK 66

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           +  +   I    +GL  D   L+N  R+ + ++   Y + IP+  L  +L    Q++T +
Sbjct: 67  IQVVDRHIGCVYSGLMPDGRQLVNRGREESSSFKKLYQKPIPIPALADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQ 177
             +RPFGV+ I+ G D+  GP LY   PSG + G+K  + G     A+  L+
Sbjct: 127 NSVRPFGVTAIFGGIDE-EGPHLYMLEPSGAHWGYKGAATGKGRQTAKAELE 177

>Kwal_26.9483 s26 complement(1238526..1239227) [702 bp, 233 aa] {ON}
           YMR314W (PRE5) - alpha-type of subunit of 20S proteasome
           [contig 73] FULL
          Length = 233

 Score =  116 bits (291), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 70/192 (36%), Positives = 100/192 (52%), Gaps = 4/192 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I     ++G+ SK   VL+A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGVRSKKHAVLVALKRNADEL---S 57

Query: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120
              +K+ K  + + L++AGL  D  +L N  RQ      + YN ++ +E     LSD  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDGRVLSNFLRQQCNYSSLVYNRKLSLEKAGNLLSDKAQ 117

Query: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180
             TQ  G RP+GV  + AGYD+  GP L    PSGN       +IGA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLAGYDNS-GPHLLEFQPSGNTLELYGAAIGARSQGAKTYLERTL 176

Query: 181 KDDMNLNDAMEL 192
            + + + D  EL
Sbjct: 177 NEYLEIEDEDEL 188

>ZYRO0G10164g Chr7 (814364..815125) [762 bp, 253 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 253

 Score =  117 bits (292), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 67/217 (30%), Positives = 114/217 (52%), Gaps = 13/217 (5%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TSIGIMSKDGIVLLAERKITSKLLEQDILNE 64
           YD   TIFSPEGRLYQVEYA ++ +     S+ I  K+  V+++++K+  KLL+   ++ 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTSINSLAIRGKNCSVIISQKKVPDKLLDPSTVS- 70

Query: 65  KLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQ 124
            ++K+S  I + + G   DA      A+     +   +  ++P ++L K+++++ Q YTQ
Sbjct: 71  YIFKISKTIGMVINGPIPDARNAALRAKAETAEFRYKFGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQ------- 177
              +RP GV   Y   D+  GP +Y S+P+G + G+KA + G       T L+       
Sbjct: 131 RAYMRPLGVIQTYVSVDEEQGPSIYKSDPAGYFVGYKATATGPKQQEITTRLENYIKKTP 190

Query: 178 -MDYKDDMNLNDAMELGLKTLSKTTDSSNLTYDRVEL 213
             DY  + +    +E G+ TL   TDS    + + +L
Sbjct: 191 SQDYMQEESWEKVVEFGITTL---TDSLGTEFSKKDL 224

>YOR362C Chr15 complement(1017880..1018746) [867 bp, 288 aa] {ON}
           PRE10Alpha 7 subunit of the 20S proteasome
          Length = 288

 Score =  117 bits (294), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 95/172 (55%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   ++FSP+GR +QVEYA++++ +  TSIGI   DG+V   E+ ITSKLL     N K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQ-KNVK 66

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           +  +   I    +GL  D   L+N  R+ A ++   Y   IP+     +L    Q++T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQ 177
             +RPFGVS I+ G D   G  LY   PSG+Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGVSTIFGGVDK-NGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELE 177

>NCAS0D02310 Chr4 complement(433672..434373) [702 bp, 233 aa] {ON}
           Anc_5.1
          Length = 233

 Score =  116 bits (290), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 75/217 (34%), Positives = 109/217 (50%), Gaps = 7/217 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I     ++G+ S    VL+A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSSKYAVLVALKRNADEL---S 57

Query: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120
              +K+ K  + + LA+AGL  DA +L N  RQ      M +N ++ VE     L D  Q
Sbjct: 58  SFQKKIIKCDEHLGLALAGLAPDARVLSNYLRQQCNYSDMVFNRKLSVEKAGHLLCDKAQ 117

Query: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GYD   GP L    PSGN       +IGA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIVGYDKS-GPHLLEFQPSGNTLELYGSAIGARSQGAKTYLERVL 176

Query: 181 KDDMNLNDAMEL---GLKTLSKTTDSSNLTYDRVELS 214
              + + DA EL   G++ L ++     L+ D + ++
Sbjct: 177 DKFVEIEDAEELIKTGVEALKQSLKDETLSTDNLSIA 213

>TPHA0N00240 Chr14 (44110..44943) [834 bp, 277 aa] {ON} Anc_7.20
           YOR362C
          Length = 277

 Score =  117 bits (293), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 95/172 (55%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   ++FSP+GR++QVEYA +++ +  TSIGI   DG+V   E+ I+SKLL     N K
Sbjct: 8   YDLSNSVFSPDGRIFQVEYANKAVENGATSIGIKCTDGVVFAVEKIISSKLLVPK-KNVK 66

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           +  +   I    +GL  D   L+N  R+ + N+   Y + I +     ++    Q+YT +
Sbjct: 67  IQVIDRHIGCVYSGLIPDGRHLVNRGREESANFKKVYGQPIGIPAFADRIGQYIQAYTLY 126

Query: 126 GGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQ 177
             +RPFGVS I+ G D   GP LY   P+G + G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGVSAIFGGIDS-EGPHLYMVEPNGAFWGYKGAATGKGRQSAKAELE 177

>Suva_8.419 Chr8 complement(753633..754511) [879 bp, 292 aa] {ON}
           YOR362C (REAL)
          Length = 292

 Score =  117 bits (294), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 95/172 (55%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   ++FSP+GR +QVEYA++++ +  TSIGI   DG+V   E+ ITSKLL     N K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCDDGVVFAVEKLITSKLLVPQ-KNTK 66

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           +  +   I    +GL  D   L+N  R+ A ++   Y   IP+     +L    Q++T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQ 177
             +RPFGVS I+ G D   G  LY   PSG+Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGVSTIFGGVDKD-GAHLYMLEPSGSYWGYKGAATGKGRQSAKAELE 177

>Kwal_47.17493 s47 (426759..427499) [741 bp, 246 aa] {ON} YGL011C
           (SCL1) - Proteasome subunit YC7alpha/Y8 (protease yscE
           subunit 7) [contig 207] FULL
          Length = 246

 Score =  116 bits (291), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 61/182 (33%), Positives = 100/182 (54%), Gaps = 2/182 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TSIGIMSKDGIVLLAERKITSKLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     SI I   D  V+++++K+  KLL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSIAIRGTDCCVIISQKKVPDKLLDP 60

Query: 60  DILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIK 119
             ++  L+++S  + +   G   DA      A+  A  Y   Y  ++P ++L K+++++ 
Sbjct: 61  STMS-YLFQISRHVGMVANGPIPDARNAALRAKAEAAEYRYKYGYDMPADVLAKRMANLS 119

Query: 120 QSYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMD 179
           Q YTQ   +RP GV   +   D+ LGP +Y  +P+G Y G+KA + G       + L+  
Sbjct: 120 QIYTQRAYMRPLGVILTFVSVDEELGPSIYKCDPAGYYVGYKATATGPKQQELTSALEKY 179

Query: 180 YK 181
           +K
Sbjct: 180 FK 181

>KLTH0E07788g Chr5 (715745..716485) [741 bp, 246 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 246

 Score =  116 bits (290), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 66/202 (32%), Positives = 105/202 (51%), Gaps = 9/202 (4%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TSIGIMSKDGIVLLAERKITSKLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     S+ I   D  V++ ++K+  KLL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSMAIRGNDCCVVINQKKVPDKLLDP 60

Query: 60  DILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIK 119
             ++  L+ +S  I +   G   DA      A+     Y   Y  ++P ++L K+++++ 
Sbjct: 61  STMS-YLFPISKHIGMVANGPIPDARNAALRAKAEVAEYRYKYGYDMPADVLAKRMANLS 119

Query: 120 QSYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGAN----TSAAQTL 175
           Q YTQ   +RP GV   +   D+ LGP +Y  +P+G Y G+KA + G      TSA +  
Sbjct: 120 QIYTQRAYMRPLGVILTFVSVDEELGPSIYKCDPAGYYVGYKATATGPKQQELTSALEKY 179

Query: 176 LQMDYKDDMN---LNDAMELGL 194
            +    D +N       +ELG+
Sbjct: 180 FKKRKSDCVNEDSYEKVVELGI 201

>YGL011C Chr7 complement(474489..475247) [759 bp, 252 aa] {ON}
           SCL1Alpha 1 subunit of the 20S proteasome involved in
           the degradation of ubiquitinated substrates; 20S
           proteasome is the core complex of the 26S proteasome;
           essential for growth; detected in the mitochondria
          Length = 252

 Score =  115 bits (289), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 60/177 (33%), Positives = 100/177 (56%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TSIGIMSKDGIVLLAERKITSKLLEQDILNE 64
           YD   TIFSPEGRLYQVEYA ++ +     S+ +  KD  V+++++K+  KLL+   ++ 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKDCTVVISQKKVPDKLLDPTTVS- 70

Query: 65  KLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQ 124
            ++ +S  I + V G   DA      A+  A  +   Y  ++P ++L K+++++ Q YTQ
Sbjct: 71  YIFCISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYK 181
              +RP GV   +   D+ LGP +Y ++P+G Y G+KA + G       T L+  +K
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFK 187

>Suva_7.270 Chr7 complement(465865..466623) [759 bp, 252 aa] {ON}
           YGL011C (REAL)
          Length = 252

 Score =  115 bits (289), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 60/177 (33%), Positives = 101/177 (57%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TSIGIMSKDGIVLLAERKITSKLLEQDILNE 64
           YD   TIFSPEGRLYQVEYA ++ +     S+ I  K+  V+++++K+  KLL+ + ++ 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAIRGKNCTVVISQKKVPDKLLDPNTVS- 70

Query: 65  KLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQ 124
            ++ +S  I + V G   DA      A+  A  +   Y  ++P ++L K+++++ Q YTQ
Sbjct: 71  YIFSISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYK 181
              +RP GV   +   D+ LGP +Y ++P+G Y G+KA + G       T L+  +K
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFK 187

>NDAI0I02640 Chr9 (613923..614624) [702 bp, 233 aa] {ON} Anc_5.1
          Length = 233

 Score =  114 bits (286), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 73/217 (33%), Positives = 111/217 (51%), Gaps = 7/217 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I     ++G+ SK   VL+A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSKKHAVLVALKRNADEL---S 57

Query: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120
              +K+ K  + + LA+AGL  DA +L N  RQ      + YN ++ VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHLGLALAGLAPDARVLSNYLRQQCNYSSLIYNRKLSVEKAGHLLCDKAQ 117

Query: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  G+D+  GP L    PSGN       +IGA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIVGHDNS-GPHLLEFQPSGNTVELYGSAIGARSQGAKTYLERVL 176

Query: 181 KDDMNLNDAMEL---GLKTLSKTTDSSNLTYDRVELS 214
              + + D  EL   G+++L ++     L+ + + ++
Sbjct: 177 DQFIEIEDPEELIKTGVESLKQSLKDETLSTENLSIA 213

>SAKL0D14476g Chr4 complement(1189461..1190303,1190367..1190369)
           [846 bp, 281 aa] {ON} similar to uniprot|P21242
           Saccharomyces cerevisiae YOR362C PRE10 20S proteasome
           alpha-type subunit
          Length = 281

 Score =  115 bits (287), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 62/188 (32%), Positives = 105/188 (55%), Gaps = 4/188 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD   +++SP+GR +QVEYA++++ +  TS+GI  +DG+V   E+ +TSKLL     N+K
Sbjct: 8   YDLSNSVYSPDGRNFQVEYAVKAVENGATSVGIKFRDGVVFAVEKLVTSKLLVPG-KNKK 66

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           +  +   I    +GL  D   L+N  R+ A ++   Y++ IPV     ++    Q++T +
Sbjct: 67  IQTVDRHIGCVYSGLMPDGRHLVNRGREEAASFKKLYSQPIPVPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQ--MDYKDD 183
             +RPFGV+ I+ G D   G  LY   PSG Y G+   + G    +A+  L+     K D
Sbjct: 127 NSVRPFGVTAIFGGVDKD-GAHLYMLEPSGTYWGYTGAATGKGRQSAKAELEKLATSKPD 185

Query: 184 MNLNDAME 191
           ++  +A++
Sbjct: 186 LSPREAVK 193

>Smik_7.279 Chr7 complement(466525..467283) [759 bp, 252 aa] {ON}
           YGL011C (REAL)
          Length = 252

 Score =  114 bits (285), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 100/177 (56%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TSIGIMSKDGIVLLAERKITSKLLEQDILNE 64
           YD   TIFSPEGRLYQVEYA ++ +     S+ +  K+  V+++++K+  KLL+   ++ 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKNCTVVISQKKVPDKLLDPTTVS- 70

Query: 65  KLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQ 124
            ++ +S  I + V G   DA      A+  A  +   Y  ++P ++L K+++++ Q YTQ
Sbjct: 71  YIFSISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYK 181
              +RP GV   +   D+ LGP +Y ++P+G Y G+KA + G       T L+  +K
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFK 187

>Kpol_1061.45 s1061 complement(125355..126125) [771 bp, 256 aa] {ON}
           complement(125355..126125) [771 nt, 257 aa]
          Length = 256

 Score =  114 bits (285), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 60/177 (33%), Positives = 98/177 (55%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TSIGIMSKDGIVLLAERKITSKLLEQDILNE 64
           YD   TIFSPEGRLYQVEYA ++ +     SI I   +  V++ ++K+  KLL+ + ++ 
Sbjct: 13  YDRHITIFSPEGRLYQVEYAFKACNQTNINSIAIRGNNCSVIINQKKVPDKLLDAETVS- 71

Query: 65  KLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQ 124
            ++++S  I +   G   DA       +  A  +   Y  ++PV++L K+++++ Q YTQ
Sbjct: 72  YIFQISRTIGMVANGPIPDARNAAIRCKAEAAEFRYKYGYDMPVDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYK 181
              +RP GV   +   D+  GP +Y S+PSG Y G+KA + G       T L+  +K
Sbjct: 132 RAYMRPLGVILTFVSLDEEKGPSIYKSDPSGYYVGYKATATGPKQQEISTSLENFFK 188

>Skud_7.276 Chr7 complement(477638..478396) [759 bp, 252 aa] {ON}
           YGL011C (REAL)
          Length = 252

 Score =  114 bits (284), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 100/177 (56%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TSIGIMSKDGIVLLAERKITSKLLEQDILNE 64
           YD   TIFSPEGRLYQVEYA ++ +     S+ +  K+  V+++++K+  KLL+   ++ 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKNCTVVISQKKVPDKLLDPATVS- 70

Query: 65  KLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQ 124
            ++ +S  I + V G   DA      A+  A  +   Y  ++P ++L K+++++ Q YTQ
Sbjct: 71  YIFSISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYK 181
              +RP GV   +   D+ LGP +Y ++P+G Y G+KA + G       T L+  +K
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFK 187

>SAKL0H21956g Chr8 (1918407..1919153) [747 bp, 248 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 248

 Score =  114 bits (284), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 59/192 (30%), Positives = 106/192 (55%), Gaps = 2/192 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TSIGIMSKDGIVLLAERKITSKLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     S+ I   + +V+++++K+  KLL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSLAIRGTNCVVVVSQKKVPDKLLDS 60

Query: 60  DILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIK 119
           + ++  ++K+S  + +   G   DA      A+  A  +   Y  ++P ++L K+++++ 
Sbjct: 61  NTVS-YIFKVSPHVGMVANGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRIANLS 119

Query: 120 QSYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMD 179
           Q YTQ   +RP GV   +   D+  GP +Y  +P+G + G+KA + G       T L+  
Sbjct: 120 QIYTQRAYMRPLGVILTFVSVDEENGPSVYKCDPAGYFVGYKATATGPKQQELDTSLEKF 179

Query: 180 YKDDMNLNDAME 191
           +K + N  D ++
Sbjct: 180 FKKNNNGKDHVQ 191

>TDEL0F02360 Chr6 complement(436203..436964) [762 bp, 253 aa] {ON}
           Anc_4.110 YGL011C
          Length = 253

 Score =  114 bits (284), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 109/200 (54%), Gaps = 9/200 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TSIGIMSKDGIVLLAERKITSKLLEQDILNE 64
           YD   TIFSPEGRL+QVEYA ++ +     S+ +  ++  V++ ++K+  KLLE   ++ 
Sbjct: 13  YDRHITIFSPEGRLFQVEYAFKATNQTNINSLAVRGRNSTVVINQKKVPDKLLEASTVS- 71

Query: 65  KLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQ 124
            ++ +S  I +   G   DA      A+  A  Y   Y  ++P ++L K+++++ Q YTQ
Sbjct: 72  YIFPISRTIGMVANGAIPDARNAALRAKAEAAEYRYKYGYDMPCDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDD- 183
              +RP GV   +   D+ LGP +Y ++P+G + G+KA + G       T L+  +K++ 
Sbjct: 132 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYFVGYKATATGPKQQEISTRLENSFKNNS 191

Query: 184 MNLND------AMELGLKTL 197
           +N+ D       +E G+  L
Sbjct: 192 LNVVDEESWEKVVEFGISHL 211

>YMR314W Chr13 (901709..902413) [705 bp, 234 aa] {ON}  PRE5Alpha 6
           subunit of the 20S proteasome
          Length = 234

 Score =  113 bits (282), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 73/218 (33%), Positives = 112/218 (51%), Gaps = 8/218 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I     ++G+ S    VL+A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADELSS-- 58

Query: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120
              +K+ K  + + L++AGL  DA +L N  RQ      + +N ++ VE     L D  Q
Sbjct: 59  -YQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQ 117

Query: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GYD   G  L    PSGN T     +IGA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGYDKS-GAHLLEFQPSGNVTELYGTAIGARSQGAKTYLERTL 176

Query: 181 ----KDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELS 214
               K D N ++ ++ G++ +S++    +LT D + ++
Sbjct: 177 DTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIA 214

>ZYRO0C01144g Chr3 complement(78422..79123) [702 bp, 233 aa] {ON}
           highly similar to uniprot|P40302 Saccharomyces
           cerevisiae YMR314W PRE5 20S proteasome alpha-type
           subunit
          Length = 233

 Score =  113 bits (282), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 70/210 (33%), Positives = 108/210 (51%), Gaps = 7/210 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I     ++G+ S    V++A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKLGSVTVGLRSNKHAVVVALKRNADDL---S 57

Query: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120
              +K+ K  + + L++AGL  DA +L N  RQ      + YN ++ VE +   L D  Q
Sbjct: 58  SYQKKIIKCDEHLGLSLAGLAPDARVLSNFLRQQCNYSQLVYNRKLSVERVGHLLCDKAQ 117

Query: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GYD+  GP L    PSGN       +IGA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLVVGYDNS-GPHLLEFQPSGNVLELYGTAIGARSQGAKTYLEKTL 176

Query: 181 KDDMNL---NDAMELGLKTLSKTTDSSNLT 207
           +  + +   N+ ++LG++ L ++     L+
Sbjct: 177 EQFLEVEDPNELIKLGVEALRQSLKDETLS 206

>CAGL0A00407g Chr1 (41556..42320) [765 bp, 254 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011c SCL1
          Length = 254

 Score =  113 bits (282), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 60/177 (33%), Positives = 98/177 (55%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TSIGIMSKDGIVLLAERKITSKLLEQDILNE 64
           YD   TIFSPEGRLYQVEYA ++ +     S+ +  K+  V++ ++K+  KLL+   ++ 
Sbjct: 13  YDRHITIFSPEGRLYQVEYAFKATNQTNLNSLAVRGKNCSVIINQKKVPDKLLDPSTVS- 71

Query: 65  KLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQ 124
            ++K+S  I +   G   DA      A+  A  +   Y  ++P ++L K+++++ Q YTQ
Sbjct: 72  YIFKISKTIGMVANGPIPDARNAAARAKGEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYK 181
              +RP GV   +   D+ LGP +Y  +P+G Y G+KA + G       T L+  YK
Sbjct: 132 RAYMRPLGVILTFISVDEELGPSIYKCDPAGYYVGYKATATGPKQQELTTSLENYYK 188

>Skud_13.488 Chr13 (875208..875912) [705 bp, 234 aa] {ON} YMR314W
           (REAL)
          Length = 234

 Score =  112 bits (280), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 73/218 (33%), Positives = 111/218 (50%), Gaps = 8/218 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I     ++G+ S    VL+A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120
              +K+ K  + + L++AGL  DA +L N  RQ      + +N ++ VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQ 117

Query: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GYD   G  L    PSGN       SIGA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGYDKS-GAHLLEFQPSGNVMELYGTSIGARSQGAKTYLERTL 176

Query: 181 ----KDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELS 214
               K D N ++ ++ G++ +S++    +LT D + ++
Sbjct: 177 DTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIA 214

>Smik_13.531 Chr13 (884471..885172) [702 bp, 234 aa] {ON} YMR314W
           (REAL)
          Length = 234

 Score =  112 bits (279), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 73/218 (33%), Positives = 111/218 (50%), Gaps = 8/218 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I     ++G+ S    VL+A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADELSS-- 58

Query: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120
              +K+ K  D + L++AGL  DA +L N  RQ      + +N ++ VE     L D  Q
Sbjct: 59  -YQKKIIKCDDHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVEKAGYLLCDKAQ 117

Query: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GYD   G  L    PSGN       +IGA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGYDKS-GAHLLEFQPSGNVMELYGTAIGARSQGAKTYLERTL 176

Query: 181 ----KDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELS 214
               K D N ++ ++ G++ +S++    +LT D + ++
Sbjct: 177 DTFIKIDGNPDELIKAGIEAISQSLRDESLTVDNLSIA 214

>NCAS0A01640 Chr1 complement(320645..321406) [762 bp, 253 aa] {ON}
           Anc_4.110
          Length = 253

 Score =  112 bits (280), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 56/177 (31%), Positives = 97/177 (54%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGT-SIGIMSKDGIVLLAERKITSKLLEQDILNE 64
           YD   TIFSPEGRLYQVEYA ++ +     S+ +   +  V++ ++K+  KLL+   ++ 
Sbjct: 13  YDRHITIFSPEGRLYQVEYAFKATNQTNVNSVAVRGTNCTVVINQKKVPDKLLDPSTVS- 71

Query: 65  KLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQ 124
            ++ +S  + +   G   DA      A+  A  +   Y  ++P ++L K+++++ Q YTQ
Sbjct: 72  YIFPISRHVGMVANGPIPDARNAAMRAKMEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYK 181
              +RP GV   +   D+ LGP +Y ++P+G Y G+KA + G       T L+  +K
Sbjct: 132 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPRQQEITTSLENYFK 188

>TPHA0F00670 Chr6 (153895..154668) [774 bp, 257 aa] {ON} Anc_4.110
           YGL011C
          Length = 257

 Score =  112 bits (280), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 96/181 (53%), Gaps = 2/181 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TSIGIMSKDGIVLLAERKITSKLLEQDILNE 64
           YD   TIFSPEGRL+QVEYA ++ +     S+ +   D  V++ ++K+  KLL+ D ++ 
Sbjct: 13  YDRHITIFSPEGRLFQVEYAFKACNQTNINSVAVRGNDCTVIINQKKVPDKLLDADTVS- 71

Query: 65  KLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQ 124
            ++ +S  I +   G   DA       +  A  +   Y  ++P ++L K+++++ Q YTQ
Sbjct: 72  YIFPISRTIGMVANGPIPDARNAALRCKAEAAEFRYKYGYDMPADVLAKRMANLAQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDM 184
              +RP GV   +   D+  GP +Y S+PSG Y G+K  + G       T L+  +K   
Sbjct: 132 RAYMRPLGVILTFISVDEEKGPSIYKSDPSGYYIGYKVTATGPKQQEIATSLENFFKKQK 191

Query: 185 N 185
           N
Sbjct: 192 N 192

>Suva_13.507 Chr13 (884695..885399) [705 bp, 234 aa] {ON} YMR314W
           (REAL)
          Length = 234

 Score =  111 bits (278), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 71/218 (32%), Positives = 111/218 (50%), Gaps = 8/218 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I     ++G+ S    VL+A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120
              +K+ K  + + L++AGL  DA +L N  RQ      + +N ++ +E     L D  Q
Sbjct: 58  SFQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAIERAGHLLCDKAQ 117

Query: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GYD   G  L    PSGN       +IGA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGYDKS-GAHLLEFQPSGNVMELYGTAIGARSQGAKTYLERTL 176

Query: 181 ----KDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELS 214
               K D N ++ ++ G++ +S++    +LT D + ++
Sbjct: 177 DTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIA 214

>SAKL0H00946g Chr8 (106740..107441) [702 bp, 233 aa] {ON} highly
           similar to uniprot|P40302 Saccharomyces cerevisiae
           YMR314W PRE5 20S proteasome alpha-type subunit
          Length = 233

 Score =  110 bits (274), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 70/210 (33%), Positives = 108/210 (51%), Gaps = 7/210 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I     ++G+ SK   V++A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSKKHAVVVALKRNADEL---S 57

Query: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120
               K+ K  + + L++AGL  DA +L N  RQ      + +N ++ +E     L D  Q
Sbjct: 58  SYQNKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLSLEKAGYLLCDKAQ 117

Query: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  G+D+  GP L    PSGN       +IGA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLIGHDNS-GPHLLEFQPSGNTLELYGAAIGARSQGAKTYLERVM 176

Query: 181 KDDMNLNDAMEL---GLKTLSKTTDSSNLT 207
           ++ + + DA EL   G++ L ++     L+
Sbjct: 177 EEYLEIEDADELIKKGVEALKQSLKDETLS 206

>KAFR0I02720 Chr9 (551846..552553) [708 bp, 235 aa] {ON} Anc_5.1
           YMR314W
          Length = 235

 Score =  109 bits (272), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 63/177 (35%), Positives = 93/177 (52%), Gaps = 4/177 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60
           M    YD  T  FSP GRL+Q+EYA+E+I     ++G+ SK+   ++A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQLEYAIEAIKQGSVTVGLRSKNYACVVALKRNADEL---S 57

Query: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120
              +K+ K  D + L++AGL  DA +L N  RQ      + +N ++ VE     LSD  Q
Sbjct: 58  SYQKKIIKCDDHMGLSLAGLAPDARVLSNFLRQQCNYSKLVFNRDLSVEKAGFLLSDKAQ 117

Query: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQ 177
             TQ  G RP+GV  +  GYD   GP L    PSGN       +IGA +  ++T L+
Sbjct: 118 KNTQSYGGRPYGVGLLVVGYDKT-GPHLLEFQPSGNVMELYGTAIGARSQGSKTYLE 173

>KLLA0A10153g Chr1 complement(892398..893099) [702 bp, 233 aa] {ON}
           highly similar to uniprot|P40302 Saccharomyces
           cerevisiae YMR314W PRE5 20S proteasome alpha-type
           subunit
          Length = 233

 Score =  108 bits (271), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 69/192 (35%), Positives = 98/192 (51%), Gaps = 4/192 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I     ++G+ S    V++A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSTKYAVVVALKRNADEL---S 57

Query: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120
              +K+ K  D + +++AGL  DA +L N  RQ      + YN ++ +E     LSD  Q
Sbjct: 58  SYQKKIIKCDDHLGVSLAGLAPDARVLSNYLRQQCNYSSLVYNRKLALERAGYLLSDKAQ 117

Query: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GYD+  G  L    PSGN       +IGA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLIGYDNT-GAHLLEFQPSGNTLELYGTAIGARSQGAKTYLERVL 176

Query: 181 KDDMNLNDAMEL 192
            D   + DA EL
Sbjct: 177 DDFREIEDADEL 188

>KNAG0D03540 Chr4 complement(648200..648958) [759 bp, 252 aa] {ON}
           Anc_4.110 YGL011C
          Length = 252

 Score =  108 bits (271), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 97/177 (54%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGT-SIGIMSKDGIVLLAERKITSKLLEQDILNE 64
           YD   TIFSPEGRL+QVEYA ++ +     S+ I  +   V++ ++K+  KLL+   ++ 
Sbjct: 12  YDRHITIFSPEGRLFQVEYAFKATNQTNVNSMAIRGETCSVIVNQKKVPDKLLDPSTVS- 70

Query: 65  KLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQ 124
            ++ +S  I +   G   DA      A+  A  Y   Y  ++P ++L K+++++ Q YTQ
Sbjct: 71  YIFPISKTIGMVANGPIPDARNAALRAKAEAAEYRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYK 181
              +RP GV   +   D+ LGP +Y S+P+G Y G+KA + G       T L+  +K
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKSDPAGYYVGYKATATGPKQQEITTNLENYFK 187

>AGL336W Chr7 (81511..82431) [921 bp, 306 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR314W (PRE5)
          Length = 306

 Score =  110 bits (274), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 67/184 (36%), Positives = 98/184 (53%), Gaps = 4/184 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEK 65
           YD  T  FSP GRL+QVEYALE+I     ++G+ S   +VL+A ++   +L       +K
Sbjct: 79  YDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSNKYVVLVALKRNADEL---SSYQKK 135

Query: 66  LYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH 125
           + K  D + L++AGL  DA +L N  RQ      + Y  ++ V    + LSD  Q  TQ 
Sbjct: 136 IIKCDDHMGLSLAGLAPDARVLSNFLRQQCNYSQLVYARDLSVVKAGQLLSDKAQKNTQS 195

Query: 126 GGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMN 185
            G RP+GV  + AGYD+  G  L    PSGN       +IGA +  A+T L+   ++ + 
Sbjct: 196 YGGRPYGVGLLLAGYDNS-GAHLLEFQPSGNTLELYGAAIGARSQGAKTYLERVMEEYLE 254

Query: 186 LNDA 189
           + DA
Sbjct: 255 IEDA 258

>Kpol_1060.1 s1060 complement(1850..2551) [702 bp, 233 aa] {ON}
           complement(1850..2551) [702 nt, 234 aa]
          Length = 233

 Score =  108 bits (269), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 69/192 (35%), Positives = 98/192 (51%), Gaps = 4/192 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I     ++G+ S    VL A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNKYAVLAALKRNADEL---S 57

Query: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120
              +K+ K  + + L++AGL  DA +L N  RQ      + +N ++ VE     LSD  Q
Sbjct: 58  SYQKKIIKCDEHLGLSLAGLAPDARVLSNYLRQQCHYSQLVFNRKLSVEKAGHLLSDKAQ 117

Query: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GYD+  G  L    PSGN       +IGA +  A+T L+   
Sbjct: 118 QNTQSYGGRPYGVGLLLIGYDNS-GAHLLEFQPSGNTLEVYGSAIGARSQGAKTYLEKVM 176

Query: 181 KDDMNLNDAMEL 192
            + ++L D  EL
Sbjct: 177 DNFVDLEDPEEL 188

>Ecym_5650 Chr5 complement(1313015..1313716) [702 bp, 233 aa] {ON}
           similar to Ashbya gossypii AGL336W
          Length = 233

 Score =  108 bits (269), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 100/192 (52%), Gaps = 4/192 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I     ++G+ S+  +VL+A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSEKYVVLVALKRNADEL---S 57

Query: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120
              +K+ K  + + L++AGL  DA +L N  RQ      + YN  + +      LSD  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSQLVYNRNLSLVKAGHLLSDKAQ 117

Query: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180
             TQ  G RP+GV  + AGYD+  G  L    PSGN       +IGA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLAGYDNS-GAHLLEFQPSGNTLELYGAAIGARSQGAKTYLERVM 176

Query: 181 KDDMNLNDAMEL 192
           ++ + +  A EL
Sbjct: 177 EEYLKIETADEL 188

>TBLA0C07190 Chr3 (1742456..1743157) [702 bp, 233 aa] {ON} Anc_5.1
           YMR314W
          Length = 233

 Score =  107 bits (268), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 70/210 (33%), Positives = 109/210 (51%), Gaps = 7/210 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60
           M    YD  +  FSP GRL+QVEYALE+I     ++G+ S    VL+A ++   +L    
Sbjct: 1   MFRNNYDGDSVTFSPTGRLFQVEYALEAIKQGSVTVGLRSHKYAVLVALKRNADEL---S 57

Query: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120
              +K+ K    + L++AGL  DA +L N  RQ      + ++ ++ VE     LSD  Q
Sbjct: 58  SYQKKIIKCDTHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFDRKLSVEKAGSLLSDKAQ 117

Query: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQM-- 178
             TQ  G RP+GV  +  GYD+  G  L    PSGN       SIGA +  A+T L+   
Sbjct: 118 QNTQSYGGRPYGVGLLVIGYDNS-GSHLLEFQPSGNVLELYGSSIGARSQGAKTYLERVL 176

Query: 179 -DYKDDMNLNDAMELGLKTLSKTTDSSNLT 207
            D+ +  N+ + +++G++ L ++    +LT
Sbjct: 177 DDFLEIDNVEELIKVGVEALKQSLKDEDLT 206

>KAFR0F03430 Chr6 complement(682440..683198) [759 bp, 252 aa] {ON}
           Anc_4.110 YGL011C
          Length = 252

 Score =  107 bits (268), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 99/179 (55%), Gaps = 2/179 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TSIGIMSKDGIVLLAERKITSKLLEQDILNE 64
           YD   TIFSPEGRL+QVEYA ++ +     S+ +  K+  V++ ++K+  KLL+   L+ 
Sbjct: 12  YDRHITIFSPEGRLFQVEYAFKATNQTNINSLAVRGKNCAVVINQKKVPDKLLDPATLS- 70

Query: 65  KLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQ 124
            ++ +S  + +   G   DA      A+  A  +   Y  ++P + L K+++++ Q YTQ
Sbjct: 71  YIFPISRHVGMLANGPIPDARNAALRAKAEAAEFRYKYGYDMPCDALAKRMANLAQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDD 183
              +RP GV   +  +D+ LGP +Y ++P+G + G+KA + G       T L+  +K +
Sbjct: 131 RAYMRPLGVILTFISFDEELGPSIYKTDPAGYFVGYKATATGPKQQEITTSLENYFKKN 189

>TPHA0A05670 Chr1 (1284623..1285324) [702 bp, 233 aa] {ON} 
          Length = 233

 Score =  107 bits (266), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 71/217 (32%), Positives = 109/217 (50%), Gaps = 7/217 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I     ++G+ SK+  V+ A ++   +L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSKNYAVITALKRNADEL---S 57

Query: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120
              +K+ +  + + L++AGL  DA +L N  RQ      + +N ++ VE     LSD  Q
Sbjct: 58  SYQKKIIRCDEHLGLSLAGLAPDARVLSNYLRQQCNYSQLVFNRKLSVEKAGHLLSDKAQ 117

Query: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GYD+  G  L    PSGN       +IGA +  A+T L+   
Sbjct: 118 QNTQSYGGRPYGVGLLIIGYDNS-GAHLLEFQPSGNTLEVYGSAIGARSQGAKTYLERVM 176

Query: 181 KDDMNLNDAMEL---GLKTLSKTTDSSNLTYDRVELS 214
              + + D  EL    ++ L ++     LT D + ++
Sbjct: 177 DKYIEIEDPEELIKTCVEALRQSLKDETLTTDNLSIA 213

>Kwal_27.9720 s27 complement(34522..35043) [522 bp, 173 aa] {ON}
           YML092C (PRE8) - proteasome component Y7 [contig 336]
           FULL
          Length = 173

 Score =  105 bits (261), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 54/136 (39%), Positives = 83/136 (61%), Gaps = 2/136 (1%)

Query: 80  LTADAEILINIARQFAQ-NYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYA 138
           +  D  +LI+ +R+ A   Y   YNE  P +ILV +++ I Q  TQ GG+RPFGVS + A
Sbjct: 1   MGPDFRVLIDKSRKVAHTQYKRIYNEYPPTKILVAEVAKIMQEATQSGGVRPFGVSLLVA 60

Query: 139 GYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMELGLKTLS 198
           GYD+  G  LY  +PSG+Y  WKA +IG   +AA+T L+  + D++ L DA+ + L TL 
Sbjct: 61  GYDEHNGFGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDELELEDAIHIALLTLK 120

Query: 199 KTTDSSNLTYDRVELS 214
           ++ +      D +E++
Sbjct: 121 ESVE-GEFNGDTIEIA 135

>TDEL0G00240 Chr7 complement(46296..47012) [717 bp, 238 aa] {ON}
           Anc_5.1 YMR314W
          Length = 238

 Score = 98.2 bits (243), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 69/222 (31%), Positives = 107/222 (48%), Gaps = 12/222 (5%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEY-----ALESISHAGTSIGIMSKDGIVLLAERKITSK 55
           M    YD  T  FSP GRL+QV+Y     ALE+I     ++G+ SK   VL+A ++   +
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVDYTKLYDALEAIKQGSVTVGLHSKKYAVLVALKRNADE 60

Query: 56  LLEQDILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKL 115
           L        K+ K  + + L++AGL  DA +L N  RQ      + +N ++ VE     L
Sbjct: 61  L---SSYQRKIIKCDEHLGLSLAGLAPDARVLSNYLRQQCNYSNLVFNRKLSVEKAGHLL 117

Query: 116 SDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTL 175
            D  Q  TQ  G RP+GV  +  G+D   G  L    PSGN       +IGA +  A+T 
Sbjct: 118 CDKAQKNTQSYGGRPYGVGLLIIGHDKS-GAHLLEFQPSGNTLELYGSAIGARSQGAKTY 176

Query: 176 LQMDYKDDMNLNDAMEL---GLKTLSKTTDSSNLTYDRVELS 214
           L+      + + D  EL   G++ L ++     L+ + + ++
Sbjct: 177 LERTLDTFLEIEDPNELIKQGVEALRQSLKDETLSNNNLSIA 218

>NDAI0D03560 Chr4 complement(848282..848800) [519 bp, 172 aa] {ON}
           Anc_4.110
          Length = 172

 Score = 65.9 bits (159), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 47/80 (58%)

Query: 102 YNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWK 161
           Y  ++P ++L K+++++ Q YTQ   +RP GV   +   D+ LGP +Y S+P+G Y G+K
Sbjct: 28  YGYDMPCDVLAKRMANLSQIYTQRAYMRPLGVILTFVSVDEELGPSIYKSDPAGYYVGYK 87

Query: 162 AISIGANTSAAQTLLQMDYK 181
           A + G       T L+  +K
Sbjct: 88  ATATGPKQQEITTNLENYFK 107

>Kwal_26.6819 s26 (77152..77742) [591 bp, 196 aa] {ON} YOR362C
           (PRE10) - proteasome component YC1 (protease yscE
           subunit 1) [contig 44] FULL
          Length = 196

 Score = 62.4 bits (150), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 68/134 (50%), Gaps = 3/134 (2%)

Query: 83  DAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDD 142
           D   L+N AR+ A ++  TY   I +  L  +L    Q++T +  +RPFG++ I  G D+
Sbjct: 3   DGRHLVNRAREEAASFKKTYGTPITLPALADRLGQYVQAHTLYNSVRPFGITAIVGGVDE 62

Query: 143 ILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQ--MDYKDDMNLNDAMELGLKTLSKT 200
             G  LY   PSG+Y G+K  + G    +A+  L+  +  K D++  +A++   + +   
Sbjct: 63  N-GAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKILSSKPDISAKEAVKEAARVVYLA 121

Query: 201 TDSSNLTYDRVELS 214
            D +      +E+S
Sbjct: 122 HDDNKEKEFELEMS 135

>TBLA0D01750 Chr4 complement(430768..431547) [780 bp, 259 aa] {ON}
           Anc_5.507 YOR157C
          Length = 259

 Score = 53.5 bits (127), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 84/182 (46%), Gaps = 16/182 (8%)

Query: 20  YQVEYALESISH-------AGTSI-GIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSD 71
           YQ    L S SH        GT+I G+   +G+++ A+ + T   +  D    KL++++ 
Sbjct: 9   YQRNAFLASQSHNTPKATSTGTTIVGVKFNNGVIIAADTRSTQGPIVADKNCAKLHRMAP 68

Query: 72  KITLAVAGLTADAEILIN-IARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRP 130
           +I  A AG  AD E +   +      + L T+ E      +V  L  +KQ   ++ G   
Sbjct: 69  RIWCAGAGTAADTEAVTQLVGSNLELHSLYTHRE----PRVVSALQMLKQHLFKYQG--H 122

Query: 131 FGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAM 190
            G   I AG D   GP L+     G+       S+G+ + AA  +L+ ++K D+   +AM
Sbjct: 123 IGAYLIVAGVDPT-GPHLFAVQAHGSTDVGFYHSLGSGSLAAMAVLETNWKQDLTKEEAM 181

Query: 191 EL 192
           +L
Sbjct: 182 KL 183

>SAKL0G04290g Chr7 (354481..355266) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 261

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/181 (28%), Positives = 87/181 (48%), Gaps = 14/181 (7%)

Query: 20  YQVEYALESISHA-------GTSI-GIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSD 71
           YQ    L + SHA       GT+I G+    G+V+ A+ + T   +  D   EKL+++S 
Sbjct: 9   YQRNQFLAAKSHAQPKATSTGTTIVGVKFNGGVVIAADTRSTQGPIVADKNCEKLHRISP 68

Query: 72  KITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPF 131
           +I  A AG  AD E +  +     + + +  N E  V   V  L  +KQ   ++ G    
Sbjct: 69  RIWCAGAGTAADTEAVTQLIGSNIELHSLYTNREPRV---VSALQMLKQHLFKYQG--HV 123

Query: 132 GVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAME 191
           G   I AG D   G  L++ +  G+       S+G+ + AA  +L+ ++K +++  +A+E
Sbjct: 124 GAYLIVAGVDPT-GAHLFSIHAHGSTDVGFYQSLGSGSLAAMAVLEANWKQNLSREEAIE 182

Query: 192 L 192
           L
Sbjct: 183 L 183

>Suva_8.208 Chr8 complement(380119..380904) [786 bp, 261 aa] {ON}
           YOR157C (REAL)
          Length = 261

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 86/182 (47%), Gaps = 16/182 (8%)

Query: 20  YQVEYALESISHA-------GTSI-GIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSD 71
           YQ    L   SHA       GT+I G+  K+G+V+ A+ + T   +  D    KL+++S 
Sbjct: 9   YQRNGFLAGNSHAQPKATSTGTTIVGVKYKNGVVIAADTRSTQGPIVADKNCAKLHRISP 68

Query: 72  KITLAVAGLTADAEILIN-IARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRP 130
           KI  A AG  AD E +   I      + L T  E      +V  L  +KQ   ++ G   
Sbjct: 69  KIWCAGAGTAADTEAVTQLIGSNIELHSLYTSRE----PRVVSALQMLKQHLFKYQG--H 122

Query: 131 FGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAM 190
            G   I AG D   G  L++ +  G+      +S+G+ + AA  +L+  +K D+  ++A+
Sbjct: 123 IGAYLIVAGVDPT-GAHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKDEAI 181

Query: 191 EL 192
           +L
Sbjct: 182 KL 183

>TPHA0E02050 Chr5 complement(426185..426970) [786 bp, 261 aa] {ON}
           Anc_5.507 YOR157C
          Length = 261

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 46/170 (27%), Positives = 83/170 (48%), Gaps = 7/170 (4%)

Query: 24  YALESISHAGTSI-GIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTA 82
           YA    +  GT+I G+  K G+V+ A+ + T   +  D    KL++++ +I  A AG  A
Sbjct: 20  YAQPKATSTGTTIVGVKFKGGVVIAADTRSTQGPIVADKNCAKLHRIAPRIWCAGAGTAA 79

Query: 83  DAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDD 142
           D E +  +     + + + Y E  P   +V  L  +KQ   ++ G    G   I AG D 
Sbjct: 80  DTEAVTQLIGSNIELHSL-YTERAPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDP 134

Query: 143 ILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMEL 192
             G  L++ +  G+       ++G+ + AA  +L+  +K D++  DA++L
Sbjct: 135 T-GAHLFSIHAHGSTDVGYYHTLGSGSLAAMAVLESQWKQDLSKEDAIKL 183

>Smik_15.337 Chr15 complement(586945..587730) [786 bp, 261 aa] {ON}
           YOR157C (REAL)
          Length = 261

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 77/160 (48%), Gaps = 8/160 (5%)

Query: 34  TSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILIN-IAR 92
           T +G+   DG+V+ A+ + T   +  D    KL+++S KI  A AG  AD E +   I  
Sbjct: 31  TIVGVKYNDGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQLIGS 90

Query: 93  QFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQLYTSN 152
               + L T  E      +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 91  NIELHSLYTSRE----PRVVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GSHLFSIH 143

Query: 153 PSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMEL 192
             G+      +S+G+ + AA  +L+  +K D+  ++A++L
Sbjct: 144 AHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKDEAVKL 183

>KAFR0C05300 Chr3 (1062416..1063201) [786 bp, 261 aa] {ON} Anc_5.507
           YOR157C
          Length = 261

 Score = 51.2 bits (121), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 86/181 (47%), Gaps = 14/181 (7%)

Query: 20  YQVEYALESISH-------AGTSI-GIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSD 71
           YQ    L S SH        GT+I G+    G+V+ A+ + T   +  D    KL+++S 
Sbjct: 9   YQRNSFLSSKSHKQPKATSTGTTIVGVKFNGGVVIAADTRSTQGPIVADKNCAKLHRISP 68

Query: 72  KITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPF 131
           +I  A AG  AD E +  +     + + ++   E  V   V  L  +KQ   ++ G    
Sbjct: 69  RIWCAGAGTAADTEAVTQLISSNIELHSLSTRREPRV---VTTLQMLKQHLFRYQG--HI 123

Query: 132 GVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAME 191
           G   I AG D   G  L++ +  G+      +S+G+ + AA  +L+  ++ D++ ++A+E
Sbjct: 124 GAYLIVAGVDPT-GAHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESKWRADISKDEAIE 182

Query: 192 L 192
           L
Sbjct: 183 L 183

>NDAI0C01170 Chr3 complement(235314..236105) [792 bp, 263 aa] {ON}
           Anc_5.507 YOR157C
          Length = 263

 Score = 50.4 bits (119), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 42/164 (25%), Positives = 81/164 (49%), Gaps = 6/164 (3%)

Query: 34  TSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILINIARQ 93
           T +G+  +DG+V+ A+ + T   +  D    KL+++S KI  A AG  AD E +  +   
Sbjct: 32  TIVGLKYRDGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQLIGS 91

Query: 94  FAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNP 153
             + + + Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ + 
Sbjct: 92  NIELHSL-YTSRSPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIHA 145

Query: 154 SGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMELGLKTL 197
            G+      +S+G+ + AA  +L+  ++ +++  +A+EL  + +
Sbjct: 146 HGSTDVGYYLSLGSGSLAAMAVLESQWRPELSKEEAIELASQAI 189

>Skud_15.321 Chr15 complement(579715..580500) [786 bp, 261 aa] {ON}
           YOR157C (REAL)
          Length = 261

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 77/160 (48%), Gaps = 8/160 (5%)

Query: 34  TSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILIN-IAR 92
           T +G+   +G+V+ A+ + T   +  D    KL+++S KI  A AG  AD E +   I  
Sbjct: 31  TIVGVKYNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQLIGS 90

Query: 93  QFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQLYTSN 152
               + L T  E      +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 91  NIELHSLYTSRE----PRVVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GSHLFSIH 143

Query: 153 PSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMEL 192
             G+      +S+G+ + AA  +L+  +K D+  ++A++L
Sbjct: 144 AHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKDEAIKL 183

>Kwal_47.18748 s47 complement(955252..956043) [792 bp, 263 aa] {ON}
           YOR157C (PUP1) - putative proteasome subunit [contig
           190] FULL
          Length = 263

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/168 (26%), Positives = 79/168 (47%), Gaps = 10/168 (5%)

Query: 27  ESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEI 86
           ++ S   T +G+    G+V+ A+ + T   +  +    KL+++S KI  A AG  AD E 
Sbjct: 24  QATSTGTTIVGVKYNGGVVIAADTRSTQGPIVANKNCAKLHRISPKIWCAGAGTAADTE- 82

Query: 87  LINIARQFAQNYLMT--YNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDIL 144
              + +    N  +   Y    P   +V  L  +KQ   ++ G    G   I AG D   
Sbjct: 83  --EVTKLIGSNLELHSLYASRAPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT- 135

Query: 145 GPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMEL 192
           G  L++ +  G+       S+G+ + AA  +L+  +K+D+N  +AM+L
Sbjct: 136 GAHLFSIHAHGSTDVGYYQSLGSGSLAAMAVLESHWKEDINREEAMQL 183

>KNAG0B03800 Chr2 complement(729075..729860) [786 bp, 261 aa] {ON}
           Anc_5.507 YOR157C
          Length = 261

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 89/182 (48%), Gaps = 15/182 (8%)

Query: 20  YQVEYALESISHA--------GTSI-GIMSKDGIVLLAERKITSKLLEQDILNEKLYKLS 70
           YQ    L S +H+        GT+I G+   +G+V+ A+ + T   +  D    KL+++S
Sbjct: 9   YQRNAFLASKTHSNLPKATSTGTTIVGVKFHNGVVIAADTRSTQGPIVADKNCAKLHRIS 68

Query: 71  DKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRP 130
            +I  A AG  AD E +  +     + + + Y +  P   +V  L  +KQ   ++ G   
Sbjct: 69  PRIWCAGAGTAADTEAVTQLIGSNVELHSL-YAKRQPR--VVTALQMLKQHLFKYQG--H 123

Query: 131 FGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAM 190
            G   I AG D   G  L++    G+      +S+G+ + AA  +L+ ++K+D++  +A+
Sbjct: 124 IGAYLIVAGTDPT-GAHLFSVQAHGSTDVGFYLSLGSGSLAAMAVLESNWKEDLSKEEAI 182

Query: 191 EL 192
           +L
Sbjct: 183 KL 184

>YOR157C Chr15 complement(630966..631751) [786 bp, 261 aa] {ON}
           PUP1Beta 2 subunit of the 20S proteasome; endopeptidase
           with trypsin-like activity that cleaves after basic
           residues; synthesized as a proprotein before being
           proteolytically processed for assembly into 20S
           particle; human homolog is subunit Z
          Length = 261

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 76/160 (47%), Gaps = 8/160 (5%)

Query: 34  TSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILIN-IAR 92
           T +G+   +G+V+ A+ + T   +  D    KL+++S KI  A AG  AD E +   I  
Sbjct: 31  TIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQLIGS 90

Query: 93  QFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQLYTSN 152
               + L T  E      +V  L  +KQ   ++ G    G   I AG D   G  L++ +
Sbjct: 91  NIELHSLYTSRE----PRVVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GSHLFSIH 143

Query: 153 PSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMEL 192
             G+      +S+G+ + AA  +L+  +K D+   +A++L
Sbjct: 144 AHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKL 183

>TDEL0A03710 Chr1 (663138..663923) [786 bp, 261 aa] {ON} Anc_5.507
           YOR157C
          Length = 261

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 50/181 (27%), Positives = 84/181 (46%), Gaps = 14/181 (7%)

Query: 20  YQVEYALESISHA-------GTSI-GIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSD 71
           YQ    L S SHA       GT+I G+   +G+V+ A+ + T   +  D    KL+++S 
Sbjct: 9   YQRNNFLASKSHAQPKATSTGTTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISP 68

Query: 72  KITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPF 131
           +I  A AG  AD E +  +     + + +  + E  V   V  L  +KQ   ++ G    
Sbjct: 69  RIWCAGAGTAADTEAVTQLISSNLELHSLYASREPRV---VSALQMLKQHLFKYQG--HI 123

Query: 132 GVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAME 191
           G   I AG D   G  L++ +  G+       S+G+ + AA  +L+  +K D+   +A+ 
Sbjct: 124 GAYLIVAGVDPT-GAHLFSIHAHGSTDVGYYQSLGSGSLAAMAVLESHWKQDLTKEEAIN 182

Query: 192 L 192
           L
Sbjct: 183 L 183

>Ecym_5458 Chr5 (940918..941694) [777 bp, 258 aa] {ON} similar to
           Ashbya gossypii AAR119W
          Length = 258

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 81/167 (48%), Gaps = 8/167 (4%)

Query: 27  ESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEI 86
           ++ S   T +G+  ++G+V+ A+ + T   +  +   EKL+K+S +I  A AG  AD + 
Sbjct: 24  QATSTGTTIVGVKFENGVVIAADTRSTQGPIVANKNCEKLHKISSRIWCAGAGTAADTDA 83

Query: 87  LIN-IARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILG 145
           +   I      + L T  E      +V  L  +KQ   ++ G    G   I AG D   G
Sbjct: 84  VTGLIGSNLELHSLFTGRE----PRVVSALQKLKQHLFKYQG--HIGAYLIVAGVDPT-G 136

Query: 146 PQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMEL 192
             L++ +  G+       S+G+ + AA  +L+ ++K+ +   +A++L
Sbjct: 137 AHLFSVHAHGSTDVGYYQSLGSGSLAAMAVLEANWKEHLTKEEAIKL 183

>ZYRO0D12034g Chr4 (1020703..1021488) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 261

 Score = 47.8 bits (112), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 81/170 (47%), Gaps = 7/170 (4%)

Query: 24  YALESISHAGTSI-GIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTA 82
           +A+   +  GT+I G+    G+V+ A+ + T   +  D    KL++++ +I  A AG  A
Sbjct: 20  HAVPKATSTGTTIVGVKYDKGVVIAADTRSTQGPIVADKNCAKLHRMAPRIWCAGAGTAA 79

Query: 83  DAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDD 142
           D E +  +     + +    N E  V   V  L  +KQ   ++ G    G   I AG D 
Sbjct: 80  DTEAVTQLIGSNLELHSQYANREPRV---VSALQMLKQHLFRYQG--HIGAYLIVAGVDP 134

Query: 143 ILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMEL 192
             G  L++    G+      +S+G+ + AA   L+ ++K ++  ++A++L
Sbjct: 135 T-GAHLFSVQAHGSTDVGHYLSLGSGSLAAMATLESNWKQNLTKDEAVKL 183

>Kpol_534.57 s534 (145742..146389) [648 bp, 215 aa] {ON}
           (145742..146389) [648 nt, 216 aa]
          Length = 215

 Score = 47.0 bits (110), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 45/172 (26%), Positives = 77/172 (44%), Gaps = 15/172 (8%)

Query: 33  GTSI-GIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILINIA 91
           GTSI  +  KDG++L A+ + T+     + + +KL ++ DKI    +G  AD + + +I 
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RQFAQNYLMTYNE---EIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQL 148
           +   + Y   Y E   E+   I      + K + T            I AGYD+    Q+
Sbjct: 79  QYHLEMYTAQYGEPSTEVAASIFKTLCYENKDNLT---------AGIIVAGYDEANKGQV 129

Query: 149 YTSNPSGNYTGWKAISIGANTSA-AQTLLQMDYKDDMNLNDAMELGLKTLSK 199
           Y S P G     +  +I  + SA        ++K+DM   + +E    +LS+
Sbjct: 130 Y-SIPLGGSVHRQPYAIAGSGSAFIYGYCDKNFKEDMTKEETIEFMKHSLSQ 180

>CAGL0L04312g Chr12 complement(504465..505250) [786 bp, 261 aa] {ON}
           highly similar to uniprot|P25043 Saccharomyces
           cerevisiae YOR157c PUP1
          Length = 261

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/167 (25%), Positives = 78/167 (46%), Gaps = 6/167 (3%)

Query: 26  LESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAE 85
           +++ S   T +G+    G+V+ A+ + T   +  D    KL+++S +I  A AG  AD E
Sbjct: 23  VKATSTGTTIVGVKFAGGVVIAADTRSTQGPIVADKNCAKLHRISPRIWCAGAGTAADTE 82

Query: 86  ILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILG 145
            +  +     + + +  N    V   V  L  +KQ   ++ G    G   I AG D   G
Sbjct: 83  AVTQLIGSNIELHSLYTNRSPRV---VSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-G 136

Query: 146 PQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMEL 192
             L++ +  G+       S+G+ + AA  +L+  +K DM   +A++L
Sbjct: 137 AHLFSIHAHGSTDVGYYQSLGSGSLAAMAVLESHWKPDMTKEEAIQL 183

>Kpol_2002.109 s2002 (258951..259598) [648 bp, 215 aa] {ON}
           (258951..259598) [648 nt, 216 aa]
          Length = 215

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/172 (25%), Positives = 78/172 (45%), Gaps = 15/172 (8%)

Query: 33  GTSI-GIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILINIA 91
           GTSI  +  KDG++L A+ + T+     + + +KL ++ DKI    +G  AD + + +I 
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RQFAQNYLMTYNE---EIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQL 148
           +   + Y   Y E   E+   I      + K + T            I AGYD+    Q+
Sbjct: 79  QYHLEMYTAQYGEPSTEVAASIFKTLCYENKDNLT---------AGIIVAGYDEANKGQV 129

Query: 149 YTSNPSGNYTGWKAISI-GANTSAAQTLLQMDYKDDMNLNDAMELGLKTLSK 199
           Y S P G     +  +I G+ ++        ++K+DM   + +E    +LS+
Sbjct: 130 Y-SIPLGGSVHRQPYAIAGSGSTFIYGYCDKNFKEDMTKEETIEFMKHSLSQ 180

>Kpol_218.1 s218 complement(238..1023) [786 bp, 261 aa] {ON}
           complement(238..1023) [786 nt, 262 aa]
          Length = 261

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 76/159 (47%), Gaps = 6/159 (3%)

Query: 34  TSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILINIARQ 93
           T +G+    G+V+ A+ + T   +  D    KL++++ +I  A AG  AD E +  +   
Sbjct: 31  TIVGVKFDGGVVIAADTRSTQGPIVADKNCAKLHRIAPRIWCAGAGTAADTEAVTQLIGS 90

Query: 94  FAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNP 153
             + + +  N E  V   V  L  +KQ   ++ G    G   I AG D   G  L++ + 
Sbjct: 91  NIELHSLYSNREPRV---VSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIHA 144

Query: 154 SGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMEL 192
            G+       S+G+ + AA  +L+ ++K D+   +A++L
Sbjct: 145 HGSTDVGYYHSLGSGSLAAMAVLESNWKQDLTKEEAIKL 183

>NCAS0H02480 Chr8 (491249..492043) [795 bp, 264 aa] {ON} Anc_5.507
          Length = 264

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 88/188 (46%), Gaps = 17/188 (9%)

Query: 20  YQVEYALESISHA--------GTSI-GIMSKDGIVLLAERKITSKLLEQDILNEKLYKLS 70
           YQ   AL + SH+        GT+I G+   +G+++ A+ + T   +  +    KL+++S
Sbjct: 9   YQRNAALAAKSHSQQPKATSTGTTIVGVKYANGVIIAADTRSTQGPIVANKNCAKLHRIS 68

Query: 71  DKITLAVAGLTADAEILIN-IARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLR 129
            +I  A AG  AD E +   I      + L T  E      +V  L  +KQ   ++ G  
Sbjct: 69  PRIWCAGAGTAADTEAVTQLIGSNIELHSLYTSRE----PRVVSALQMLKQHLFKYQG-- 122

Query: 130 PFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDA 189
             G   I AG D   G  L++ +  G+      +S+G+ + AA  +L+  ++ +M+   A
Sbjct: 123 HIGAYLIVAGTDPT-GAHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESHWEPEMSKEAA 181

Query: 190 MELGLKTL 197
           +EL  + +
Sbjct: 182 VELASQAI 189

>KLLA0A02233g Chr1 complement(198766..199554) [789 bp, 262 aa] {ON}
           highly similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 262

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 76/159 (47%), Gaps = 6/159 (3%)

Query: 34  TSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILINIARQ 93
           T +G+    G+++ A+ + T   +  D   EKL++++ +I  A AG  AD E +  +   
Sbjct: 32  TIVGVKFNGGVIIAADTRSTQGPIVADKNCEKLHRIAPRIWCAGAGTAADTEAVTQLISS 91

Query: 94  FAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNP 153
             + + +    E  V   V  L  +KQ   ++ G    G   I AG D   G  L++ + 
Sbjct: 92  NIELHSLYTGREPRV---VSSLQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIHA 145

Query: 154 SGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMEL 192
            G+       S+G+ + AA  +L+ ++  D++  +A++L
Sbjct: 146 HGSTDVGYYQSLGSGSLAAMAVLEANWNQDLSKEEAIKL 184

>KLLA0F12936g Chr6 complement(1191839..1192421,1192526..1192590)
           [648 bp, 215 aa] {ON} highly similar to uniprot|P38624
           YJL001W Saccharomyces cerevisiae PRE3 20S proteasome
           beta-type subunit
          Length = 215

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 77/172 (44%), Gaps = 15/172 (8%)

Query: 33  GTSI-GIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILINIA 91
           GTSI  +  KDG++L A+ + T+     + + +KL K+ DKI    +G  AD + + +I 
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTKVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RQFAQNYLMTYNE---EIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQL 148
           +   + Y   Y E   ++   I      + K   T            I AGYD+    ++
Sbjct: 79  QYHLELYTSQYGEPTTKVAASIFKTLCYENKDHLT---------AGIIVAGYDEKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISIGANTSA-AQTLLQMDYKDDMNLNDAMELGLKTLSK 199
           Y S P G     ++ SI  + SA        +YK+DM   + +E    +LS+
Sbjct: 130 Y-SIPLGGSVHKQSYSIAGSGSAFIYGYCDKNYKEDMTKEETIEFVKHSLSQ 180

>AAR119W Chr1 (557434..558213) [780 bp, 259 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR157C (PUP1)
          Length = 259

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 47/175 (26%), Positives = 80/175 (45%), Gaps = 16/175 (9%)

Query: 20  YQVEYALESISH-------AGTSI-GIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSD 71
           YQ    L S SH        GT+I G+  + G+V+ A+ + T   +  +   EKL++++ 
Sbjct: 9   YQRNQHLASTSHKQPRATSTGTTIVGVKFEGGVVIAADTRSTQGPIVANKNCEKLHRIAP 68

Query: 72  KITLAVAGLTADAEILIN-IARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRP 130
           +I  A AG  AD E +   I      + L T  E      +V  L  +KQ   ++ G   
Sbjct: 69  RIWCAGAGTAADTEAVTWLIGSNLELHSLYTGRE----PRVVSALQKLKQHLFKYQG--H 122

Query: 131 FGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMN 185
            G   I AG D   G  L++ +  G+    +  S+G+ + AA  +L+  +++ M 
Sbjct: 123 IGAYLIVAGVDPT-GAHLFSVHAHGSTDVGQYQSLGSGSLAAMAVLEAQWREGMG 176

>KLTH0G03168g Chr7 (249621..250412) [792 bp, 263 aa] {ON} highly
           similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 263

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 79/166 (47%), Gaps = 6/166 (3%)

Query: 27  ESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEI 86
           ++ S   T +G+    G+++ A+ + T   +  +    KL+++S KI  A AG  AD E 
Sbjct: 24  QATSTGTTIVGVKYDGGVLIAADTRSTQGPIVANKNCAKLHRISPKIWCAGAGTAADTEE 83

Query: 87  LINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGP 146
           +  +     + + M  + E  V   V  L  +KQ   ++ G    G   I AG D   G 
Sbjct: 84  VTKLIGSNLELHSMYASREPRV---VSALQMLKQHLFKYQG--HIGAYLIVAGADPT-GT 137

Query: 147 QLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMEL 192
            L++ +  G+       S+G+ + AA  +L+ +++ D+   +AM+L
Sbjct: 138 HLFSIHAHGSTDVGFYQSLGSGSLAAMAVLEANWRPDLKKEEAMQL 183

>KAFR0B00650 Chr2 (129107..129832) [726 bp, 241 aa] {ON} Anc_7.480
           YBL041W
          Length = 241

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 73/173 (42%), Gaps = 13/173 (7%)

Query: 20  YQVEYALESISH--------AGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSD 71
           Y  E A + I H         GT +GI  +D  VL  + + T+          K++   D
Sbjct: 8   YSNEVAQQPIEHRFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 67

Query: 72  KITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPF 131
            I ++  G  AD E L+   +   + Y   +N++   ++ +K  +   Q         P+
Sbjct: 68  NIVISANGFAADGEALVKRFKNSIKWYHFDHNDK---KLSIKSAARNIQHLLYGKRFFPY 124

Query: 132 GVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLL--QMDYKD 182
            V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 125 YVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>AGL324W Chr7 (102113..102844) [732 bp, 243 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL041W (PRE7)
          Length = 243

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/153 (22%), Positives = 69/153 (45%), Gaps = 6/153 (3%)

Query: 32  AGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILINIA 91
           AGT +GI  +D  VL  + + T+          K++   D I ++  G  AD + L+   
Sbjct: 31  AGTILGIAGEDFAVLAGDTRHTTGYSINSREEPKVFDCGDNILISANGFAADGDALVKRF 90

Query: 92  RQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQLYTS 151
           +   + Y   +N+++ ++   + +    Q       + P+ V  I AG D+     +Y+ 
Sbjct: 91  KNSMKWYRFDHNKKMTIKSAARSI----QHLLYGKRMFPYYVHTIIAGLDEEGKGAVYSY 146

Query: 152 NPSGNYTGWKAISIGANTSAAQTLL--QMDYKD 182
           +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 147 DPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 179

>AAL172C Chr1 complement(39647..40229,40286..40350) [648 bp, 215 aa]
           {ON} syntenic homolog of Saccharomyces cerevisiae
           YJL001W (PRE3); 1-intron
          Length = 215

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/168 (21%), Positives = 73/168 (43%), Gaps = 7/168 (4%)

Query: 33  GTSI-GIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILINIA 91
           GTSI  +  +DG++L A+ + T+     + + +KL ++ D+I    +G  AD + + ++ 
Sbjct: 19  GTSIMAVKFRDGVILGADSRTTTGTYIANRVTDKLTRVHDRIWCCRSGSAADTQAVADMV 78

Query: 92  RQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQLYTS 151
           + + + Y M Y E           S I      H          I AGYDD    ++Y+ 
Sbjct: 79  QHYLELYTMQYGEP-SASTAASLFSTICYENKDH-----LTAGIIVAGYDDKNKGEVYSI 132

Query: 152 NPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMELGLKTLSK 199
              G+         G+ ++         +++DM+  + ++    +LS+
Sbjct: 133 PLGGSVHKAPYAIAGSGSTFIYGYCDKHFREDMSKEETIDFMKHSLSQ 180

>Skud_16.388 Chr16 (696682..697545) [864 bp, 287 aa] {ON} YPR103W
           (REAL)
          Length = 287

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/169 (21%), Positives = 73/169 (43%), Gaps = 4/169 (2%)

Query: 29  ISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILI 88
           I+H  T++    + GIV+  + + T+         +K+ +++  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTLAGGAADCQFWE 131

Query: 89  NIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQL 148
                  + + +   E I V    K LS++   Y   G      +  +  GY    GP +
Sbjct: 132 TWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAG----LSMGTMVCGYTKKEGPTI 187

Query: 149 YTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMELGLKTL 197
           Y  +  G         +G+  + A  +L  +YK D+++ DA+ LG +++
Sbjct: 188 YYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRSI 236

>KNAG0A07520 Chr1 (1176893..1177756) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/173 (20%), Positives = 73/173 (42%), Gaps = 4/173 (2%)

Query: 29  ISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILI 88
           I+H  T++    + GIV+  + + T+         +K+ +++  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQL 148
                  + Y +   + I V    K L+++   Y   G      +  +  GY    GP +
Sbjct: 132 TWLGSQCRLYELKEKQRITVAAASKILANLVYQYKGAG----LSMGTMICGYTKKEGPTV 187

Query: 149 YTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMELGLKTLSKTT 201
           Y  +  G         +G+  + A  +L  +YK D+++ DA+ LG + +   T
Sbjct: 188 YYVDSDGTRLKGDVFCVGSGQTFAYGVLDTNYKWDLSVEDALYLGKRAILAAT 240

>Smik_16.343 Chr16 (609756..610619) [864 bp, 287 aa] {ON} YPR103W
           (REAL)
          Length = 287

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/169 (21%), Positives = 73/169 (43%), Gaps = 4/169 (2%)

Query: 29  ISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILI 88
           I+H  T++    + GIV+  + + T+         +K+ +++  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQL 148
                  + + +   E I V    K LS++   Y   G      +  +  GY    GP +
Sbjct: 132 TWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTRKEGPTI 187

Query: 149 YTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMELGLKTL 197
           Y  +  G         +G+  + A  +L  +YK D+++ DA+ LG +++
Sbjct: 188 YYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSIEDALYLGKRSI 236

>Suva_16.429 Chr16 (739867..740730) [864 bp, 287 aa] {ON} YPR103W
           (REAL)
          Length = 287

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/169 (21%), Positives = 73/169 (43%), Gaps = 4/169 (2%)

Query: 29  ISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILI 88
           I+H  T++    + GIV+  + + T+         +K+ +++  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQL 148
                  + + +   E I V    K LS++   Y   G      +  +  GY    GP +
Sbjct: 132 TWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAG----LSMGTMVCGYTKKEGPTI 187

Query: 149 YTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMELGLKTL 197
           Y  +  G         +G+  + A  +L  +YK D+++ DA+ LG +++
Sbjct: 188 YYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRSI 236

>CAGL0F04477g Chr6 complement(446420..447148) [729 bp, 242 aa] {ON}
           highly similar to uniprot|P23724 Saccharomyces
           cerevisiae YBL041w PRE7
          Length = 242

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 69/158 (43%), Gaps = 15/158 (9%)

Query: 32  AGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILINIA 91
            GT +GI  +D  VL  + + T+          K++   D I ++  G  AD E L+   
Sbjct: 29  GGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDNIIMSANGFAADGEALVKRF 88

Query: 92  RQFAQNYLMTYNEEIPVEILVKKLSDIKQSYT-QH--GGLR--PFGVSFIYAGYDDILGP 146
           +   + Y   +N+        KKLS    +   QH   G R  P+ V  I AG DD    
Sbjct: 89  KNSIKWYHFDHND--------KKLSISSAARNIQHLLYGKRFFPYYVHTIIAGLDDEGKG 140

Query: 147 QLYTSNPSGNYTGWKAISIGANTSAAQTLL--QMDYKD 182
            +Y+ +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 141 AVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 178

>NCAS0A14880 Chr1 complement(2932325..2933050) [726 bp, 241 aa] {ON}
           Anc_7.480 YBL041W
          Length = 241

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 75/173 (43%), Gaps = 6/173 (3%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSD 71
           +S E R   +E+     S + GT +GI  +D  VL  + + T+          K++   D
Sbjct: 8   YSSEVRNTPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 67

Query: 72  KITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPF 131
            I ++  G  AD E L+   +   + Y   +N++   ++ +   +   Q         P+
Sbjct: 68  NIVISANGFAADGEALVKRFKNSLKWYHFDHNDK---KLAMSSAARNIQHLLYGKRFFPY 124

Query: 132 GVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLL--QMDYKD 182
            V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 125 YVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>NDAI0J00600 Chr10 (125252..125977) [726 bp, 241 aa] {ON} Anc_7.480
           YBL041W
          Length = 241

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 39/175 (22%), Positives = 76/175 (43%), Gaps = 6/175 (3%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSD 71
           +S E     +E+A    + + GT +GI  +D  +L  + + T+          K++   D
Sbjct: 8   YSSEVNSTPIEHAFNPYTDNGGTILGIAGEDFAILAGDTRHTTDYSINSRYEPKVFDCGD 67

Query: 72  KITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPF 131
            I ++  G  AD E L+   +   + Y   +N++   ++ +K  +   Q         P+
Sbjct: 68  NIVISANGFAADGEALVKRFKNSLKWYHFDHNDK---KLSMKSAARNIQHLLYGKRFFPY 124

Query: 132 GVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLL--QMDYKDDM 184
            V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+  
Sbjct: 125 YVHTIIAGLDENGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQF 179

>YPR103W Chr16 (732349..733212) [864 bp, 287 aa] {ON}  PRE2Beta 5
           subunit of the 20S proteasome, responsible for the
           chymotryptic activity of the proteasome
          Length = 287

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/169 (20%), Positives = 73/169 (43%), Gaps = 4/169 (2%)

Query: 29  ISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILI 88
           I+H  T++    + GI++  + + T+         +K+ +++  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQL 148
                  + + +   E I V    K LS++   Y   G      +  +  GY    GP +
Sbjct: 132 TWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTRKEGPTI 187

Query: 149 YTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMELGLKTL 197
           Y  +  G         +G+  + A  +L  +YK D+++ DA+ LG +++
Sbjct: 188 YYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRSI 236

>AEL326C Chr5 complement(37422..38279) [858 bp, 285 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR103W
           (PRE2)
          Length = 285

 Score = 42.4 bits (98), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/169 (20%), Positives = 73/169 (43%), Gaps = 4/169 (2%)

Query: 29  ISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILI 88
           I+H  T++    + GIV+  + + T+         +K+ +++  +   +AG  AD +   
Sbjct: 70  IAHGTTTLAFRFQGGIVVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQYWE 129

Query: 89  NIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQL 148
                  + + +   E I V    K LS++   Y   G      +  +  GY    GP +
Sbjct: 130 TWLGAQCRLHELKEKERISVAAASKILSNLVYEYKGAG----LSMGTMICGYTKKEGPTI 185

Query: 149 YTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMELGLKTL 197
           Y  +  G         +G+  + A  +L  +Y+ D+++ DA+ LG +++
Sbjct: 186 YYVDSDGTRLKGDLFCVGSGQTFAYGVLDTNYRWDLSVEDALYLGKRSI 234

>TBLA0F01760 Chr6 complement(439214..440077) [864 bp, 287 aa] {ON}
           Anc_3.417 YPR103W
          Length = 287

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 37/173 (21%), Positives = 73/173 (42%), Gaps = 4/173 (2%)

Query: 29  ISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILI 88
           I+H  T++    K GIV+  + + T+         +K+ +++  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFKGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQL 148
                  + + +   E I V    K LS++   Y   G      +  +  GY    GP +
Sbjct: 132 TWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGPTI 187

Query: 149 YTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMELGLKTLSKTT 201
           Y  +  G         +G+  + A  +L  +YK D+ + +A+ LG +++   T
Sbjct: 188 YYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLTVEEALYLGKRSILAAT 240

>KLLA0E05633g Chr5 complement(502868..503590) [723 bp, 240 aa] {ON}
           highly similar to uniprot|P23724 Saccharomyces
           cerevisiae YBL041W PRE7 20S proteasome beta-type subunit
          Length = 240

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 32/145 (22%), Positives = 62/145 (42%), Gaps = 4/145 (2%)

Query: 32  AGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILINIA 91
            GT +GI  +D  VL  + + T+          K+++  D I ++  G  AD E L+   
Sbjct: 28  GGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFECEDNILISANGFAADGEALVKRF 87

Query: 92  RQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQLYTS 151
           +     Y   +N+++ ++   + +    Q       + P+ V  I AG D+     +Y+ 
Sbjct: 88  KNSQMWYHFNHNKKLTIKSAARNI----QHLLYGKRMFPYYVHTIIAGLDEEGKGAVYSF 143

Query: 152 NPSGNYTGWKAISIGANTSAAQTLL 176
           +P G+Y   +  + G+  S     L
Sbjct: 144 DPVGSYEREQCRAGGSAASLIMPFL 168

>NCAS0A11440 Chr1 (2263605..2264468) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 35/169 (20%), Positives = 72/169 (42%), Gaps = 4/169 (2%)

Query: 29  ISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILI 88
           I+H  T++    + GI++  + + T+         +K+ +++  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQL 148
                  + + +   E I V    K LS++   Y   G      +  +  GY    GP +
Sbjct: 132 TWLGSQCRLHELKEKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGPTI 187

Query: 149 YTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMELGLKTL 197
           Y  +  G         +G+  + A  +L  +YK D+ + DA+ LG +++
Sbjct: 188 YYVDSDGTRLKGDIFCVGSGQTFAYGVLDTNYKWDLTVEDALYLGKRSI 236

>TDEL0C05540 Chr3 (988954..989817) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 36/173 (20%), Positives = 74/173 (42%), Gaps = 4/173 (2%)

Query: 29  ISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILI 88
           I+H  T++    + GIV+  + + T+         +K+ +++  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGSWIASQTVKKVIEINPFLLGTMAGGAADCQYWE 131

Query: 89  NIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQL 148
                  + + +   E I V    K LS++   Y   G      +  +  GY    GP +
Sbjct: 132 TWLGAQCRLHELKEKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGPTV 187

Query: 149 YTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMELGLKTLSKTT 201
           Y  +  G         +G+  + A  +L  +YK ++ + +A+ELG +++   T
Sbjct: 188 YYVDSDGTRLKGDLFCVGSGQTFAYGVLDANYKWELGVEEALELGKRSILAAT 240

>KLTH0D03058g Chr4 complement(293867..294730) [864 bp, 287 aa] {ON}
           highly similar to uniprot|P30656 Saccharomyces
           cerevisiae YPR103W PRE2 20S proteasome beta-type subunit
          Length = 287

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 36/173 (20%), Positives = 74/173 (42%), Gaps = 4/173 (2%)

Query: 29  ISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILI 88
           I+H  T++    + GIV+  + + T+         +K+ +++  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGSWIASQTVKKVIEINPFLLGTLAGGAADCQFWE 131

Query: 89  NIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQL 148
                  + + +   E I V    K LS++   Y   G      +  +  GY    GP +
Sbjct: 132 TWLGTQCRLHELKEKERISVAAASKILSNLVYQYKGAG----LSMGTMVCGYTKKEGPTI 187

Query: 149 YTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMELGLKTLSKTT 201
           Y  +  G         +G+  + A  +L  +YK D+++ +A+ LG +++   T
Sbjct: 188 YYVDSDGTRLKGDMFCVGSGQTFAYGVLDSNYKWDLSVEEALYLGKRSILAAT 240

>TDEL0C03440 Chr3 complement(603757..604482) [726 bp, 241 aa] {ON}
           Anc_7.480 YBL041W
          Length = 241

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 47/180 (26%), Positives = 73/180 (40%), Gaps = 23/180 (12%)

Query: 20  YQVEYALESISH--------AGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSD 71
           Y  E A   I H         GT +GI  +D  VL  + + T+          K++   D
Sbjct: 8   YSNEVAHTPIQHQFNPYTDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRHESKVFDCGD 67

Query: 72  KITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLS-DIKQSYTQH--GGL 128
            I ++  G  AD E L+   +   + Y   +N+        KKLS        QH   G 
Sbjct: 68  NIVMSANGFAADGEALVKRFKNSVKWYHFDHND--------KKLSLSSAARNIQHLLYGK 119

Query: 129 R--PFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLL--QMDYKDDM 184
           R  P+ V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+  
Sbjct: 120 RFFPYYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQF 179

>ZYRO0B10142g Chr2 complement(793497..794079,794163..794227) [648
           bp, 215 aa] {ON} highly similar to uniprot|P38624
           YJL001W Saccharomyces cerevisiae PRE3 20S proteasome
           beta-type subunit
          Length = 215

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 75/171 (43%), Gaps = 13/171 (7%)

Query: 33  GTSIGIMS-KDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILINIA 91
           GTSI  +S KDG++L A+ + T      + + +KL ++ DK+    +G  AD + + +I 
Sbjct: 19  GTSIMAVSFKDGVILGADSRTTMGPYVANRVTDKLTRVHDKVWCCRSGSAADTQAVADIV 78

Query: 92  RQFAQNYLMTYNE---EIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQL 148
           + +   Y   Y E        I  +   + K + T            I AGYD+    ++
Sbjct: 79  QYYLDLYTAQYGEPSTRTAAAIFQQLCYENKDALT---------AGIIVAGYDEKNQGEV 129

Query: 149 YTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMELGLKTLSK 199
           Y+    G+    K    G+ ++        +YKD M  ++ ++    +LS+
Sbjct: 130 YSIPIGGSLHKQKYAIAGSGSTFIYGYCDKNYKDGMTKDETVDFIKHSLSQ 180

>TBLA0F02680 Chr6 complement(643543..644268) [726 bp, 241 aa] {ON}
           Anc_7.480 YBL041W
          Length = 241

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/153 (22%), Positives = 66/153 (43%), Gaps = 5/153 (3%)

Query: 32  AGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILINIA 91
            GT +GI  +D  VL  + +  +          K++   D I ++  G  AD E L+   
Sbjct: 28  GGTILGIAGEDFAVLAGDTRNITDYSINSRFEPKVFDCGDNIVISANGFAADGEALVQRF 87

Query: 92  RQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQLYTS 151
           +   + Y   +N++   ++ +K  +   Q         P+ V  I AG D+     +Y+ 
Sbjct: 88  KNSIKWYHFDHNDK---KLTMKSAARNIQHLLYGKRFFPYYVHTIIAGLDEEGKGAVYSF 144

Query: 152 NPSGNYTGWKAISIGANTSAAQTLL--QMDYKD 182
           +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 145 DPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>TPHA0M01750 Chr13 (361278..362138) [861 bp, 286 aa] {ON} Anc_3.417
           YPR103W
          Length = 286

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/169 (20%), Positives = 72/169 (42%), Gaps = 4/169 (2%)

Query: 29  ISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILI 88
           I+H  T++    + GI++  + + T+          K+ +++  +   +AG  AD +   
Sbjct: 71  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVNKVIRINPFLLGTMAGGAADCQYWE 130

Query: 89  NIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQL 148
                  + + +   E I V    K LS++   Y   G      +  +  GY    GP +
Sbjct: 131 TWLGSQCRLHELKEKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGPTV 186

Query: 149 YTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMELGLKTL 197
           Y  +  G         +G+  + A  +L  +YK D+ +++A+ LG +++
Sbjct: 187 YYVDSDGTRLKGNVFCVGSGQTFAYGVLDSNYKWDLTVDEALYLGKRSI 235

>Kwal_33.15193 s33 (1004538..1005119) [582 bp, 193 aa] {ON} YJL001W
           (PRE3) - Subunit of 20S proteasome [contig 94] FULL
          Length = 193

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/167 (19%), Positives = 73/167 (43%), Gaps = 12/167 (7%)

Query: 36  IGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILINIARQFA 95
           + +  KDG++L A+ + T+     + + +KL ++ DK+    +G  AD + + +I + + 
Sbjct: 1   MAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKVWCCRSGSAADTQAVADIVQHYL 60

Query: 96  QNYLMTYNE---EIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQLYTSN 152
           + Y   + E   +    I      + K + T            I AG+DD    ++Y+  
Sbjct: 61  ELYTAQFGEPSTKTAASIFKTLCYENKDNLT---------AGIIVAGFDDKNKGEVYSIP 111

Query: 153 PSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMELGLKTLSK 199
             G+    K    G+ ++        ++K+DM  ++ +     +LS+
Sbjct: 112 LGGSVHKQKYAIAGSGSTFIYGYCDKNFKEDMTKDETISFMKNSLSQ 158

>Ecym_8276 Chr8 complement(558691..559273,559391..559455) [648 bp,
           215 aa] {ON} similar to Ashbya gossypii AAL172C 1-intron
          Length = 215

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 72/168 (42%), Gaps = 7/168 (4%)

Query: 33  GTSI-GIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILINIA 91
           GTSI  +  KDG++L A+ + T+     + + +KL ++ DKI    +G  AD + + +I 
Sbjct: 19  GTSIMAVTYKDGVILGADSRTTTGTYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQLYTS 151
           +     Y   Y E   V       S I   Y     L       I AGYDD    ++YT 
Sbjct: 79  QHHLDLYAAQYGEP-SVNTAASLFSTI--CYENKDFLTA---GIIVAGYDDKNKGEVYTI 132

Query: 152 NPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMELGLKTLSK 199
              G+         G+ ++        ++K++M+  + +     +LS+
Sbjct: 133 PLGGSVHKAPYAIAGSGSTFIYGYCDKNFKENMSKEETIRFMKHSLSQ 180

>Suva_2.77 Chr2 (141199..141924) [726 bp, 241 aa] {ON} YBL041W
           (REAL)
          Length = 241

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 70/159 (44%), Gaps = 15/159 (9%)

Query: 31  HAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILINI 90
           + GT +GI  +D  VL  + +  +          K++   DKI ++  G  AD + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDKIVMSANGFAADGDALVKR 86

Query: 91  ARQFAQNYLMTYNEEIPVEILVKKLS-DIKQSYTQH--GGLR--PFGVSFIYAGYDDILG 145
            +   + Y   +N+        KKLS +      QH   G R  P+ V  I AG D+   
Sbjct: 87  FKNSVKWYHFDHND--------KKLSINSAARNIQHLLYGKRFFPYYVHTIIAGLDEDGK 138

Query: 146 PQLYTSNPSGNYTGWKAISIGANTSAAQTLL--QMDYKD 182
             +Y+ +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 139 GAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>KLLA0F08228g Chr6 complement(770578..771435) [858 bp, 285 aa] {ON}
           highly similar to uniprot|P30656 Saccharomyces
           cerevisiae YPR103W PRE2 20S proteasome beta-type subunit
          Length = 285

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/169 (19%), Positives = 73/169 (43%), Gaps = 4/169 (2%)

Query: 29  ISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILI 88
           I+H  T++    K GI++  + + T+         +K+ +++  +   +AG  AD +   
Sbjct: 69  IAHGTTTLAFRFKGGIIVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQFWE 128

Query: 89  NIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQL 148
                  + + +   E I V    K LS++   Y   G      +  +  GY    GP +
Sbjct: 129 TWLGSQCRLHELREKERISVAAASKILSNLVYEYKGAG----LSMGTMICGYTKKEGPTI 184

Query: 149 YTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMELGLKTL 197
           Y  +  G         +G+  + A  +L  +Y+ D+++ +A+ +G +++
Sbjct: 185 YYVDSDGTRLQGDLFCVGSGQTFAYGVLDANYRWDLSVEEALYIGKRSI 233

>SAKL0F15092g Chr6 (1215605..1216390) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P23724 Saccharomyces cerevisiae
           YBL041W PRE7 20S proteasome beta-type subunit
          Length = 261

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/178 (25%), Positives = 77/178 (43%), Gaps = 16/178 (8%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSD 71
           +S E +   +E+     S + GT +GI  +D  VL  + + T+          K++   D
Sbjct: 28  YSNETKNVPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 87

Query: 72  KITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLS-DIKQSYTQH--GGL 128
            I ++  G  AD E L+   +   + Y   +N+        +KLS        QH   G 
Sbjct: 88  NILISANGFAADGEALVKRFQNSLKWYHFNHND--------RKLSLSSAARNIQHLLYGK 139

Query: 129 R--PFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLL--QMDYKD 182
           R  P+ V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 140 RFFPYYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 197

>Smik_10.278 Chr10 (432298..432362,432479..433064) [651 bp, 216 aa]
           {ON} YJL001W (REAL)
          Length = 216

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/171 (22%), Positives = 75/171 (43%), Gaps = 13/171 (7%)

Query: 33  GTSI-GIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILINIA 91
           GTSI  +  KDG++L A+ + T+     + + +KL ++ DKI    +G  AD + + +I 
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIV 78

Query: 92  RQFAQNYLMTY---NEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQL 148
           +   + Y   Y   + E    +  +   + K + T            I AGYDD    ++
Sbjct: 79  QYHLELYTSQYGTPSTETAASVFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMELGLKTLSK 199
           YT    G+         G+ ++        +++D+M+  + +     +LS+
Sbjct: 130 YTIPIGGSVHKLPYAIAGSGSTFIYGYCDKNFRDNMSKEETVNFIKHSLSQ 180

>NDAI0A04860 Chr1 complement(1110021..1110884) [864 bp, 287 aa] {ON}
           Anc_3.417
          Length = 287

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/169 (20%), Positives = 71/169 (42%), Gaps = 4/169 (2%)

Query: 29  ISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILI 88
           I+H  T++    K GIV+  + + T+         +K+ +++  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFKGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQL 148
                  + + +     I V    K LS++   Y   G      +  +  GY    GP +
Sbjct: 132 TWLGSQCRLHELKEKNRISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGPTI 187

Query: 149 YTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMELGLKTL 197
           Y  +  G         +G+  + A  +L  +YK D+ + +A+ LG +++
Sbjct: 188 YYVDSDGTRLQGDLFCVGSGQTFAYGVLDSNYKWDLTVEEALYLGKRSI 236

>SAKL0B09262g Chr2 (784068..784931) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P30656 Saccharomyces cerevisiae
           YPR103W PRE2 20S proteasome beta-type subunit
          Length = 287

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/169 (19%), Positives = 71/169 (42%), Gaps = 4/169 (2%)

Query: 29  ISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILI 88
           I+H  T++    + GI++  + + T+         +K+ +++  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGSWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQL 148
                  + + +   + I V    K L ++   Y   G      +  +  GY    GP +
Sbjct: 132 TWLGTQCRLHELKEKQRISVAAASKILGNLVYEYKGAG----LSMGTMICGYTKKEGPTI 187

Query: 149 YTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMELGLKTL 197
           Y  +  G         +G+  + A  +L  +YK D+ + DA+ LG +++
Sbjct: 188 YYVDSDGTRLKGDLFCVGSGQTFAYGVLDTNYKWDLTIEDALYLGKRSI 236

>CAGL0G01804g Chr7 complement(166048..166908) [861 bp, 286 aa] {ON}
           highly similar to uniprot|P30656 Saccharomyces
           cerevisiae YPR103w PRE2
          Length = 286

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/169 (20%), Positives = 72/169 (42%), Gaps = 4/169 (2%)

Query: 29  ISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILI 88
           I+H  T++    + GIV+  + + T+         +K+ +++  +   +AG  AD +   
Sbjct: 71  IAHGTTTLAFRFQGGIVVAVDSRATAGQWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 130

Query: 89  NIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQL 148
                  + + +   E I V    K L ++   Y   G      +  +  GY    GP +
Sbjct: 131 TWLGSQCRLHELKEKERISVAAASKILGNLVYQYKGAG----LSMGTMICGYTKKEGPTI 186

Query: 149 YTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMELGLKTL 197
           Y  +  G         +G+  + A  +L  +YK D+++ +A+ LG +++
Sbjct: 187 YYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLSVEEALYLGKRSI 235

>Kwal_26.7273 s26 complement(291172..292035) [864 bp, 287 aa] {ON}
           YPR103W (PRE2) - proteasome subunit [contig 47] FULL
          Length = 287

 Score = 39.7 bits (91), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/169 (20%), Positives = 72/169 (42%), Gaps = 4/169 (2%)

Query: 29  ISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILI 88
           ++H  T++    + GIV+  + + T+         +K+ +++  +   +AG  AD +   
Sbjct: 72  LAHGTTTLAFRFQGGIVVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQL 148
                  + + +   E I V    K LS++   Y   G      +  +  GY    GP +
Sbjct: 132 TWLGTQCRLHELKEKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTRKEGPTI 187

Query: 149 YTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMELGLKTL 197
           Y  +  G         +G+  + A  +L  +YK D+ + +A+ LG +++
Sbjct: 188 YYVDSDGTRLQGDLFCVGSGQTFAYGVLDANYKWDLTVEEALYLGKRSI 236

>ZYRO0G17842g Chr7 complement(1467229..1467963) [735 bp, 244 aa]
           {ON} highly similar to uniprot|P23724 Saccharomyces
           cerevisiae YBL041W PRE7 20S proteasome beta-type subunit
          Length = 244

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 63/151 (41%), Gaps = 13/151 (8%)

Query: 31  HAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILINI 90
           + GT +GI  +D  VL  + + T+          K++   D I +   G  AD E L+  
Sbjct: 30  NGGTVLGIAGEDFAVLAGDTRHTTDYSINSRYESKVFDCGDNIVITANGYAADGEALVKR 89

Query: 91  ARQFAQNYLMTYNEEIPVEILVKKLS-DIKQSYTQH--GGLR--PFGVSFIYAGYDDILG 145
            +   + Y   +N+        KKLS +      QH   G R  P+ V  I AG D+   
Sbjct: 90  FKNSVKWYHFDHND--------KKLSLNSAARNIQHLLYGKRFFPYYVQTIIAGLDEEGK 141

Query: 146 PQLYTSNPSGNYTGWKAISIGANTSAAQTLL 176
             +Y+ +P G+Y   +  + GA  S     L
Sbjct: 142 GAVYSFDPVGSYEREQCRAGGAAASLIMPFL 172

>KNAG0F03590 Chr6 complement(674528..675274) [747 bp, 248 aa] {ON}
           Anc_7.480 YBL041W
          Length = 248

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 68/158 (43%), Gaps = 15/158 (9%)

Query: 32  AGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILINIA 91
            GT +GI  +D  VL  + + T+          K++ + D I ++  G  AD+  L+   
Sbjct: 37  GGTILGIAGEDFAVLAGDTRHTTDYSINSRSESKVFDVGDGIVISANGFAADSTALVKRF 96

Query: 92  RQFAQNYLMTYNEEIPVEILVKKLS-DIKQSYTQH--GGLR--PFGVSFIYAGYDDILGP 146
           R   + Y    NE        K+LS        QH   G R  P+ V  I AG D+    
Sbjct: 97  RNSLKWYHFNENE--------KRLSLSAAARNIQHLLYGKRFFPYYVHTIIAGLDEEGKG 148

Query: 147 QLYTSNPSGNYTGWKAISIGANTSAAQTLL--QMDYKD 182
            +Y+ +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 149 AVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 186

>NDAI0C02420 Chr3 complement(555130..555780) [651 bp, 216 aa] {ON}
           Anc_5.216 YJL001W
          Length = 216

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/170 (24%), Positives = 74/170 (43%), Gaps = 10/170 (5%)

Query: 33  GTSI-GIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILINIA 91
           GTSI  +  KDG++L A+ + T+     + + +KL K+ DKI    +G  AD + + +I 
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTKVHDKIWCCRSGSAADTQAVADI- 77

Query: 92  RQFAQNYLMTYNEEIPVEILVKKLSDIKQ-SYTQHGGLRPFGVSFIYAGYDDILGP-QLY 149
               Q +L  Y+ +          S  K   Y     L       I AG+DD     ++Y
Sbjct: 78  ---VQYHLDIYSTQFGTPSTKTAASVFKTLCYENKDNLTA---GIIVAGFDDATNKGEVY 131

Query: 150 TSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMELGLKTLSK 199
           +    G+    K    G+ ++        ++KDDM  ++ +     +LS+
Sbjct: 132 SVPLGGSIHKQKYAIAGSGSTFIYGYCDKNFKDDMTKDETVHFIKHSLSQ 181

>Skud_10.222 Chr10 (402675..402739,402859..403441) [648 bp, 215 aa]
           {ON} YJL001W (REAL)
          Length = 215

 Score = 38.9 bits (89), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 37/171 (21%), Positives = 76/171 (44%), Gaps = 13/171 (7%)

Query: 33  GTSI-GIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILINIA 91
           GTSI  +  KDG++L A+ + T+     + + +KL ++ DKI    +G  AD + + +I 
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIV 78

Query: 92  RQFAQNYLMTY---NEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQL 148
           +   + Y   Y   + E    +  +   + K + T            I AGYDD    ++
Sbjct: 79  QYHLELYTSQYGPPSTETAASVFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMELGLKTLSK 199
           YT    G+         G+ ++        +++++M+  + ++    +LS+
Sbjct: 130 YTIPIGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLSQ 180

>TDEL0E04130 Chr5 complement(771594..772188,772248..772312) [660 bp,
           219 aa] {ON} Anc_5.216 YJL001W
          Length = 219

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/168 (20%), Positives = 73/168 (43%), Gaps = 12/168 (7%)

Query: 35  SIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILINIARQF 94
           S+ +  KDG++L A+ + T+     + + +KL ++ +KI    +G  AD + + +I +  
Sbjct: 26  SMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHEKIWCCRSGSAADTQAIADIVQYH 85

Query: 95  AQNYLMTYNE---EIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQLYTS 151
              Y   Y E   +    +  +   + K + T            I AGYD+    ++Y+ 
Sbjct: 86  LDLYTAQYGEPSTKTAAAVFKELCYENKDNLT---------AGIIVAGYDEKNKGEVYSI 136

Query: 152 NPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMELGLKTLSK 199
              G+    K    G+ ++        ++KDDM  ++ +     +LS+
Sbjct: 137 PLGGSMHKQKYAIAGSGSTFIYGYCDKNFKDDMTKDETVNFMKNSLSQ 184

>YBL041W Chr2 (141247..141972) [726 bp, 241 aa] {ON}  PRE7Beta 6
           subunit of the 20S proteasome
          Length = 241

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 77/177 (43%), Gaps = 17/177 (9%)

Query: 31  HAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILINI 90
           + GT +GI  +D  VL  + +  +          K++   D I ++  G  AD + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVKR 86

Query: 91  ARQFAQNYLMTYNEEIPVEILVKKLS-DIKQSYTQH--GGLR--PFGVSFIYAGYDDILG 145
            +   + Y   +N+        KKLS +      QH   G R  P+ V  I AG D+   
Sbjct: 87  FKNSVKWYHFDHND--------KKLSINSAARNIQHLLYGKRFFPYYVHTIIAGLDEDGK 138

Query: 146 PQLYTSNPSGNYTGWKAISIGANTSAAQTLL--QMDYKD--DMNLNDAMELGLKTLS 198
             +Y+ +P G+Y   +  + GA  S     L  Q+++K+  +   N  ++  LK LS
Sbjct: 139 GAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTNGKVKKPLKYLS 195

>KLTH0B03102g Chr2 complement(242293..242875,242960..243024) [648
           bp, 215 aa] {ON} highly similar to uniprot|P38624
           YJL001W Saccharomyces cerevisiae PRE3 20S proteasome
           beta-type subunit
          Length = 215

 Score = 38.5 bits (88), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 35/171 (20%), Positives = 77/171 (45%), Gaps = 13/171 (7%)

Query: 33  GTSI-GIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILINIA 91
           GTSI  +  +DG++L A+ + T+     + + +KL ++ +K+    +G  AD + + +I 
Sbjct: 19  GTSIMAVTFRDGVILGADSRTTTGAYIANRVTDKLTRVHEKVWCCRSGSAADTQAVADIV 78

Query: 92  RQFAQNYLMTYNE---EIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQL 148
           + + + Y   + E   +    I      + K + T            I AGYD+    ++
Sbjct: 79  QHYLELYTAQFGEPSTKTAASIFKTLCYENKDNLT---------AGIIVAGYDEKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMELGLKTLSK 199
           Y+    G+    K    G+ ++        +YK++M+ ++ +     +LS+
Sbjct: 130 YSIPLGGSVHKQKYAIAGSGSTFIYGYCDKNYKENMSKDETVSFMKNSLSQ 180

>Smik_2.73 Chr2 (135009..135734) [726 bp, 241 aa] {ON} YBL041W
           (REAL)
          Length = 241

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 45/177 (25%), Positives = 77/177 (43%), Gaps = 17/177 (9%)

Query: 31  HAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILINI 90
           + GT +GI  +D  VL  + +  +          K++   D I ++  G  AD + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVKR 86

Query: 91  ARQFAQNYLMTYNEEIPVEILVKKLS-DIKQSYTQH--GGLR--PFGVSFIYAGYDDILG 145
            +   + Y   +N+        KKLS +      QH   G R  P+ V  I AG D+   
Sbjct: 87  FKNSVKWYHFDHND--------KKLSLNSAARNIQHLLYGKRFFPYYVHTIIAGLDENGK 138

Query: 146 PQLYTSNPSGNYTGWKAISIGANTSAAQTLL--QMDYKD--DMNLNDAMELGLKTLS 198
             +Y+ +P G+Y   +  + GA  S     L  Q+++K+  +   N  ++  LK LS
Sbjct: 139 GAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTNGKVKKPLKYLS 195

>TPHA0N00740 Chr14 (164750..165400) [651 bp, 216 aa] {ON} Anc_5.216
           YJL001W
          Length = 216

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 39/172 (22%), Positives = 76/172 (44%), Gaps = 14/172 (8%)

Query: 33  GTSI-GIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILINIA 91
           GTSI  +  KDG++L A+ + T+     + + +KL ++ DKI    +G  AD + + +I 
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGSYIANRVTDKLTRVQDKIWCCRSGSAADTQAVADIV 78

Query: 92  RQFAQNYLMTYNE---EIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGP-Q 147
           +   + Y   + E   ++   I      D K + +            I AG+DD     +
Sbjct: 79  QYQLELYTAQFGEPSTKVAASIFKTMCYDNKDNLS---------AGIIVAGFDDKENKGE 129

Query: 148 LYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMELGLKTLSK 199
           +Y+    G+    K    G+ ++        ++KDDM  ++ +     +LS+
Sbjct: 130 VYSIPLGGSLHKQKYAIAGSGSAFIYGYCDKNFKDDMTKDETVNFMKHSLSQ 181

>YJL001W Chr10 (435163..435227,435344..435926) [648 bp, 215 aa] {ON}
            PRE3Beta 1 subunit of the 20S proteasome, responsible
           for cleavage after acidic residues in peptides
          Length = 215

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 37/171 (21%), Positives = 76/171 (44%), Gaps = 13/171 (7%)

Query: 33  GTSI-GIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILINIA 91
           GTSI  +  KDG++L A+ + T+     + + +KL ++ DKI    +G  AD + + +I 
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIV 78

Query: 92  RQFAQNYLMTY---NEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQL 148
           +   + Y   Y   + E    +  +   + K + T            I AGYDD    ++
Sbjct: 79  QYHLELYTSQYGTPSTETAASVFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMELGLKTLSK 199
           YT    G+         G+ ++        +++++M+  + ++    +LS+
Sbjct: 130 YTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLSQ 180

>ZYRO0C17688g Chr3 (1375873..1376736) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P30656 Saccharomyces cerevisiae
           YPR103W PRE2 20S proteasome beta-type subunit
          Length = 287

 Score = 38.5 bits (88), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 33/173 (19%), Positives = 74/173 (42%), Gaps = 4/173 (2%)

Query: 29  ISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILI 88
           I+H  T++    + GI++  + + ++         +K+ +++  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRASAGSWVASQTVKKVIEINPFLLGTMAGGAADCQYWE 131

Query: 89  NIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQL 148
                  + + +   E I V    K L ++   Y  +G      +  +  GY    GP +
Sbjct: 132 TWLGAQCRLHELKEKERISVAAASKILCNLVYEYKGYG----LSMGTMICGYTKKEGPTV 187

Query: 149 YTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMELGLKTLSKTT 201
           Y  +  G         +G+  + A  +L  +YK D+++ +A+ LG +++   T
Sbjct: 188 YYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEEALYLGKRSIIAAT 240

>Suva_12.80 Chr12 (117572..117636,117754..118336) [648 bp, 215 aa]
           {ON} YJL001W (REAL)
          Length = 215

 Score = 38.1 bits (87), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 38/171 (22%), Positives = 76/171 (44%), Gaps = 13/171 (7%)

Query: 33  GTSI-GIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILINIA 91
           GTSI  +  KDG++L A+ + T+     + + +KL ++ DKI    +G  AD + + +I 
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGSYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RQFAQNYLMTY---NEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQL 148
           +   + Y   Y   + E    I  +   + K + T            I AGYDD    ++
Sbjct: 79  QYHLELYTSQYGTPSTETAAAIFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMELGLKTLSK 199
           YT    G+         G+ ++        +++++M+  + ++    +LS+
Sbjct: 130 YTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLSQ 180

>Kwal_55.19882 s55 (163845..164573) [729 bp, 242 aa] {ON} YBL041W
           (PRE7) - proteasome subunit [contig 159] FULL
          Length = 242

 Score = 38.1 bits (87), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 35/153 (22%), Positives = 66/153 (43%), Gaps = 5/153 (3%)

Query: 32  AGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILINIA 91
            GT +GI  +D  VL  + + T+          K++   D I ++  G  AD   L+   
Sbjct: 29  GGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDNILISANGFAADGTALVKRF 88

Query: 92  RQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQLYTS 151
           +   + Y   +N++   ++ +K  +   Q         P+ V  I AG D+     +Y+ 
Sbjct: 89  QNSLKWYHFDHNDK---KLSMKSAARNIQHLLYGKRFFPYYVHTIIAGLDEEGKGAVYSF 145

Query: 152 NPSGNYTGWKAISIGANTSAAQTLL--QMDYKD 182
           +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 146 DPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 178

>Ecym_2614 Chr2 (1185603..1186460) [858 bp, 285 aa] {ON} similar to
           Ashbya gossypii AEL326C
          Length = 285

 Score = 38.1 bits (87), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 34/169 (20%), Positives = 71/169 (42%), Gaps = 4/169 (2%)

Query: 29  ISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILI 88
           I+H  T++    + GIV+  + + T+         +K+ +++  +   +AG  AD +   
Sbjct: 70  IAHGTTTLAFRFQGGIVVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQYWE 129

Query: 89  NIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQL 148
                  + + +   E I V    K L ++   Y   G      +  +  GY    GP +
Sbjct: 130 TWLGAQCRLHELKEKERISVAAASKILGNLVYEYKGAG----LSMGTMICGYTKKEGPTI 185

Query: 149 YTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMELGLKTL 197
           Y  +  G         +G+  + A  +L  +YK D+ + +A+ LG +++
Sbjct: 186 YYVDSDGMRLKGDLFCVGSGQTFAYGVLDTNYKWDLTVEEALYLGKRSI 234

>TBLA0C06200 Chr3 (1503862..1504512) [651 bp, 216 aa] {ON} Anc_5.216
           YJL001W
          Length = 216

 Score = 37.7 bits (86), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 74/170 (43%), Gaps = 10/170 (5%)

Query: 33  GTSI-GIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILINIA 91
           GTSI  +  KDG++L A+ + T      + + +KL ++ DKI    +G  AD + + +I 
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTMGSYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPF-GVSFIYAGYDDILGPQLYT 150
           +   + Y   Y   IP     +  + + QS       + F     I AG+DD        
Sbjct: 79  QYHLEVYTSQYG--IPS---TRTAASVFQSLCYEN--KDFLSAGIIVAGFDDKSEKGEVY 131

Query: 151 SNPSGNYTGWKAISIGANTSA-AQTLLQMDYKDDMNLNDAMELGLKTLSK 199
           S P G     +  +I  + SA        +YK DM  ++ +E    +LS+
Sbjct: 132 SIPLGGSIHKQPYAIAGSGSAFIYGYCDKNYKPDMTKDETVEFMKHSLSQ 181

>Kpol_1018.144 s1018 complement(382038..382904) [867 bp, 288 aa]
           {ON} complement(382038..382904) [867 nt, 289 aa]
          Length = 288

 Score = 38.1 bits (87), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 33/169 (19%), Positives = 72/169 (42%), Gaps = 4/169 (2%)

Query: 29  ISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILI 88
           I+H  T++    + GI++  + + T+         +K+ +++  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQL 148
                  + + +     I V    K LS++   Y   G      +  +  GY    GP +
Sbjct: 132 TWLGSQCRLHELKEKSRISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGPTI 187

Query: 149 YTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMELGLKTL 197
           Y  +  G         +G+  + A  +L  +YK D+ +++A+ LG +++
Sbjct: 188 YYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLTVDEALYLGKRSI 236

>Ecym_7171 Chr7 complement(353212..353940) [729 bp, 242 aa] {ON}
           similar to Ashbya gossypii AGL324W
          Length = 242

 Score = 37.7 bits (86), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 34/153 (22%), Positives = 67/153 (43%), Gaps = 5/153 (3%)

Query: 32  AGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILINIA 91
            GT +GI  +D  V+  + + T+          K++   D I ++  G  AD + L+   
Sbjct: 29  GGTILGIAGEDFAVIAGDTRHTTGYSINSRNEPKVFDCGDNILISANGFAADGDALV--- 85

Query: 92  RQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQLYTS 151
           ++F  N    + +    ++ +K  +   Q       + P+ V  I AG D+     +Y+ 
Sbjct: 86  KKFKNNLKWYHFDHNNKKMTLKSAARNIQHLLYGKRMFPYYVHTIIAGLDEDGKGAVYSF 145

Query: 152 NPSGNYTGWKAISIGANTSAAQTLL--QMDYKD 182
           +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 146 DPVGSYEREQCRAGGAAASIIMPFLDNQVNFKN 178

>Kpol_1028.92 s1028 (211095..211823) [729 bp, 242 aa] {ON}
           (211095..211823) [729 nt, 243 aa]
          Length = 242

 Score = 37.7 bits (86), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 69/158 (43%), Gaps = 13/158 (8%)

Query: 31  HAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILINI 90
           + GT +GI  +D  VL  + + T+          K++   D I ++  G  AD E L+  
Sbjct: 28  NGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDNIVISANGFAADGEALVKR 87

Query: 91  ARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQH--GGLR--PFGVSFIYAGYDDILGP 146
            +   + Y    N++         LS   ++  QH   G R  P+ V  I AG D+    
Sbjct: 88  FKNSIKWYHFDNNDK------TLSLSSAARN-IQHLLYGKRFFPYYVHTIIAGLDEEGKG 140

Query: 147 QLYTSNPSGNYTGWKAISIGANTSAAQTLL--QMDYKD 182
            +Y+ +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 141 AVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 178

>KLTH0E01826g Chr5 (173841..174569) [729 bp, 242 aa] {ON} highly
           similar to uniprot|P23724 Saccharomyces cerevisiae
           YBL041W PRE7 20S proteasome beta-type subunit
          Length = 242

 Score = 37.7 bits (86), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 68/158 (43%), Gaps = 15/158 (9%)

Query: 32  AGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILINIA 91
            GT +GI  +D  VL  + + T+          K++   D I ++  G  AD   L+   
Sbjct: 29  GGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDNILISANGFAADGNALVKRF 88

Query: 92  RQFAQNYLMTYNEEIPVEILVKKLSDIKQSYT-QH--GGLR--PFGVSFIYAGYDDILGP 146
           +   + Y   +N+        KKLS    +   QH   G R  P+ V  I AG D+    
Sbjct: 89  QNSLKWYHFDHND--------KKLSMRSAARNIQHLLYGKRFFPYYVHTIIAGLDEEGKG 140

Query: 147 QLYTSNPSGNYTGWKAISIGANTSAAQTLL--QMDYKD 182
            +Y+ +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 141 AVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 178

>KAFR0D04210 Chr4 (829098..829961) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 37.7 bits (86), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 33/169 (19%), Positives = 72/169 (42%), Gaps = 4/169 (2%)

Query: 29  ISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILI 88
           I+H  T++    + GI++  + + T+         +K+ +++  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQYWE 131

Query: 89  NIARQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQL 148
                  + + +   + I V    K LS++   Y   G      +  +  GY    GP +
Sbjct: 132 TWLGSQCRLHELKEKDRISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGPTV 187

Query: 149 YTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMELGLKTL 197
           Y  +  G         +G+  + A  +L  +YK D+ + +A+ LG +++
Sbjct: 188 YYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLTVEEALYLGKRSI 236

>TPHA0E02990 Chr5 complement(628441..629091) [651 bp, 216 aa] {ON}
           Anc_5.216 YJL001W
          Length = 216

 Score = 37.4 bits (85), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 38/172 (22%), Positives = 77/172 (44%), Gaps = 14/172 (8%)

Query: 33  GTSI-GIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILINIA 91
           GTSI  +  KDG++L A+ + T+     + + +KL ++ DKI    +G  AD + + +I 
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVQDKIWCCRSGSAADTQAVADIV 78

Query: 92  RQFAQNYLMTYNE---EIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGP-Q 147
           +   + Y   + E   ++   I      D K + +            I AG+DD     +
Sbjct: 79  QYQLELYTAQFGEPSTKVAASIFKTMCYDNKDNLS---------AGIIVAGFDDKENKGE 129

Query: 148 LYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMELGLKTLSK 199
           +Y+    G+    K    G+ ++        +YK++M  ++ ++    +LS+
Sbjct: 130 VYSIPLGGSLHKQKYAIAGSGSTFIYGYCDKNYKENMTKDETVDFMKHSLSQ 181

>Skud_2.61 Chr2 (125091..125816) [726 bp, 241 aa] {ON} YBL041W
           (REAL)
          Length = 241

 Score = 37.4 bits (85), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 69/159 (43%), Gaps = 15/159 (9%)

Query: 31  HAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILINI 90
           + GT +GI  +D  VL  + +  +          K++   D + ++  G  AD + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNLVMSANGFAADGDALVKR 86

Query: 91  ARQFAQNYLMTYNEEIPVEILVKKLS-DIKQSYTQH--GGLR--PFGVSFIYAGYDDILG 145
            +   + Y   +N+        KKLS +      QH   G R  P+ V  I AG D+   
Sbjct: 87  FKNSVKWYHFDHND--------KKLSINSAARNIQHLLYGKRFFPYYVHTIIAGLDENGK 138

Query: 146 PQLYTSNPSGNYTGWKAISIGANTSAAQTLL--QMDYKD 182
             +Y+ +P G+Y   +  + GA  S     L  Q+++K+
Sbjct: 139 GAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKN 177

>SAKL0G12584g Chr7 complement(1072410..1072992,1073073..1073137)
           [648 bp, 215 aa] {ON} similar to uniprot|P38624
           Saccharomyces cerevisiae YJL001W PRE3 20S proteasome
           beta-type subunit, responsible for cleavage after acidic
           residues in peptides
          Length = 215

 Score = 36.6 bits (83), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 39/73 (53%), Gaps = 1/73 (1%)

Query: 33  GTSI-GIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILINIA 91
           GTSI  +  KDG++L A+ + T+     + + +KL ++ DKI    +G  AD + + +I 
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RQFAQNYLMTYNE 104
           +   + Y   Y E
Sbjct: 79  QYHLELYDSQYGE 91

>TPHA0E00420 Chr5 (71900..72625) [726 bp, 241 aa] {ON} Anc_7.480
           YBL041W
          Length = 241

 Score = 36.6 bits (83), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 35/153 (22%), Positives = 64/153 (41%), Gaps = 5/153 (3%)

Query: 32  AGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILINIA 91
            GT +GI  +D  VL  + + T+          K++   D I ++  G  AD E L+   
Sbjct: 28  GGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDDIIISANGFAADGEALVKRF 87

Query: 92  RQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQLYTS 151
           +   + Y    N++   ++ +   +   Q         P+ V  I AG D+     +Y+ 
Sbjct: 88  KNSIKWYHFDNNDK---KLALSSAARNIQHLLYGKRFFPYYVHTIIAGLDEEGKGAVYSF 144

Query: 152 NPSGNYTGWKAISIGANTSAAQTLL--QMDYKD 182
           +P G+Y      + GA  S     L  Q+++K+
Sbjct: 145 DPVGSYEREFCRAGGAAASLIMPFLDNQVNFKN 177

>NCAS0A01480 Chr1 complement(288201..288851) [651 bp, 216 aa] {ON}
           Anc_5.216 YJL001W
          Length = 216

 Score = 36.2 bits (82), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 38/72 (52%), Gaps = 1/72 (1%)

Query: 33  GTSI-GIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILINIA 91
           GTSI  +  KDG++L A+ + T+     + + +KL ++ DK+    +G  AD + + +I 
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRIHDKVWCCRSGSAADTQAVADIV 78

Query: 92  RQFAQNYLMTYN 103
           + +   Y   Y 
Sbjct: 79  QYYLDLYTTQYG 90

>KNAG0H02450 Chr8 complement(449110..449695,449971..450035) [651 bp,
           216 aa] {ON} Anc_5.216 YJL001W
          Length = 216

 Score = 35.4 bits (80), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 73/169 (43%), Gaps = 8/169 (4%)

Query: 33  GTSIGIMSKDGIVLL-AERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILINIA 91
           GTSI  ++ DG V+L A+ + T+     + + +KL ++ DKI    +G  AD + + +I 
Sbjct: 19  GTSIMAVTFDGGVILGADSRTTTGAYIANRVTDKLTRIDDKIWCCRSGSAADTQAVADIV 78

Query: 92  RQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYDDILGPQLYTS 151
           +   + Y   Y     +E        +  +Y     L       I AGYDD        S
Sbjct: 79  QYHLELYTSQYGTP-SIETAAAVFKTL--TYENKDALSA---GIIVAGYDDKKKKGEVYS 132

Query: 152 NPSGNYTGWKAISIGANTSA-AQTLLQMDYKDDMNLNDAMELGLKTLSK 199
            P G     +  +I  + SA        +Y+++MN  + +E    +LS+
Sbjct: 133 IPLGGSVHKQKYAIAGSGSAFIYGYCDKNYRENMNKEETVEFVKHSLSQ 181

>CAGL0D03058g Chr4 complement(317022..317669) [648 bp, 215 aa] {ON}
           highly similar to uniprot|P38624 Saccharomyces
           cerevisiae YJL001w PRE3
          Length = 215

 Score = 34.7 bits (78), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 38/73 (52%), Gaps = 1/73 (1%)

Query: 33  GTSI-GIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILINIA 91
           GTSI  +  KDG++L A+ + T+     + + +KL ++ D I    +G  AD + + +I 
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDNIWCCRSGSAADTQAVADIV 78

Query: 92  RQFAQNYLMTYNE 104
           + +   Y   + E
Sbjct: 79  QYYLDMYEGQFGE 91

>KAFR0C06350 Chr3 complement(1270967..1271552,1271634..1271698) [651
           bp, 216 aa] {ON} Anc_5.216 YJL001W
          Length = 216

 Score = 34.7 bits (78), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 38/72 (52%), Gaps = 1/72 (1%)

Query: 33  GTSI-GIMSKDGIVLLAERKITSKLLEQDILNEKLYKLSDKITLAVAGLTADAEILINIA 91
           GTSI  +  KDG++L A+ + T+     + + +KL ++ DKI    +G  AD + + +I 
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RQFAQNYLMTYN 103
           +   + Y   Y 
Sbjct: 79  QYHLELYESQYG 90

>Kwal_23.2949 s23 (85646..90499) [4854 bp, 1617 aa] {ON} YOR093C -
           Hypothetical ORF [contig 247] FULL
          Length = 1617

 Score = 33.5 bits (75), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 34/69 (49%), Gaps = 8/69 (11%)

Query: 7   DSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQDILNEKL 66
           DS   I     RLY+ E A+  I+H     GI S D + L AER      +  ++   KL
Sbjct: 158 DSLPAILRARSRLYERETAILGINHKNKETGI-SWDKLYLRAER------VAHELTKHKL 210

Query: 67  YKLSDKITL 75
           YK+ DK+ L
Sbjct: 211 YKM-DKVLL 218

>Smik_7.173 Chr7 (308539..309588) [1050 bp, 349 aa] {ON} YGL100W
           (REAL)
          Length = 349

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 4   RRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIV 45
           RR++   T+  P+G LY V++A    +H G  +  +  DGI+
Sbjct: 96  RRWNKLCTLNDPKGSLYSVKFA---PAHLGLKLACLGNDGIL 134

>TPHA0C01570 Chr3 complement(360745..361332) [588 bp, 195 aa] {ON}
           Anc_7.162 YER012W
          Length = 195

 Score = 30.0 bits (66), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 72/166 (43%), Gaps = 19/166 (11%)

Query: 36  IGIMSKDGIVLLAERKITS--KLLEQDILNEKLYKLSDKITLAVAGLTAD----AE-ILI 88
           +GI  KD ++L   + +T    +L+ D  ++K  +LS    +   G   D    AE I  
Sbjct: 5   LGIKVKDSVILATSKAVTRGISVLKDD--DDKSRELSTHTLMTFTGEAGDTVQFAEYIQA 62

Query: 89  NIA-RQFAQNYLMTYNEEIPVEILVKKLSDIKQSYTQHGGLRPFGVSFIYAGYD-DILGP 146
           NI      +NY ++ N    V   V++  ++ +S       +PF V+ +  GYD     P
Sbjct: 63  NIQLHDIRENYELSPN---AVSSFVRQ--ELAKSLRTR---KPFQVNVLIGGYDIKTESP 114

Query: 147 QLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDYKDDMNLNDAMEL 192
           +LY  +  G        + G +     +LL   Y+ DM   D ++L
Sbjct: 115 ELYQIDYLGTKVSLPYAAHGYSGFYTFSLLDHHYRSDMTTEDGLKL 160

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.361 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,586,280
Number of extensions: 1004665
Number of successful extensions: 2712
Number of sequences better than 10.0: 233
Number of HSP's gapped: 2494
Number of HSP's successfully gapped: 233
Length of query: 258
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 151
Effective length of database: 41,212,137
Effective search space: 6223032687
Effective search space used: 6223032687
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 64 (29.3 bits)