Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0D029103.501ON2691647851e-105
Kpol_480.83.501ON2391192298e-22
Kwal_47.189053.501ON2361332234e-21
NCAS0F036003.501ON2371202227e-21
TBLA0C045303.501ON2221122131e-19
KLLA0E03873g3.501ON2201332121e-19
KLTH0G02332g3.501ON2331152122e-19
SAKL0F02486g3.501ON2301122122e-19
AFR320W3.501ON2571132123e-19
Smik_16.4063.501ON2121412084e-19
TPHA0A057203.501ON2201122094e-19
NDAI0B059203.501ON2351122061e-18
TDEL0D056903.501ON2011311997e-18
Skud_16.4483.501ON2081231971e-17
KNAG0A079903.501ON2211161981e-17
YPR154W (PIN3)3.501ON2151231972e-17
KNAG0B007503.501ON2171161953e-17
ZYRO0D09702g3.501ON158631862e-16
Suva_16.4823.501ON2351171903e-16
KAFR0G037403.501ON2341391884e-16
Smik_6.2323.501ON2411231806e-15
CAGL0F04829g3.501ON2021151779e-15
YGR136W (LSB1)3.501ON2411251753e-14
Ecym_12283.501ON2531121745e-14
Suva_7.4243.501ON2491261674e-13
Skud_7.4473.501ON2381301594e-12
TPHA0O012801.356ON454991635e-12
ZYRO0G20372gsingletonON150591511e-11
AEL017W1.356ON416821591e-11
TDEL0D022401.356ON433681555e-11
Kwal_55.212875.470ON461781546e-11
KNAG0C020401.356ON464951538e-11
CAGL0I08965g1.356ON4371001521e-10
KAFR0C044001.356ON459621502e-10
Kwal_0.3711.356ON217721453e-10
Ecym_27471.356ON452611483e-10
Suva_15.1991.356ON457561475e-10
KLLA0A08360g1.356ON423731475e-10
KLTH0F15114g5.470ON435741475e-10
NCAS0B072501.356ON441521458e-10
Smik_8.811.356ON468521458e-10
NCAS0A089901.356ON434521451e-09
TBLA0D049501.356ON468591441e-09
NDAI0G059601.356ON423541441e-09
Smik_7.3351.356ON460711431e-09
YHR016C (YSC84)1.356ON468851432e-09
Skud_8.681.356ON475521422e-09
SAKL0D09702g1.356ON428801422e-09
YFR024C-A (LSB3)1.356ON459751422e-09
TBLA0F034901.356ON511521422e-09
KLTH0H12980g1.356ON399691404e-09
Suva_6.961.356ON455751395e-09
NDAI0B045801.356ON424611395e-09
ZYRO0G00792g1.356ON469701396e-09
Skud_6.1081.356ON459751371e-08
SAKL0G03454g5.470ON468741361e-08
TPHA0A022101.356ON397581352e-08
Kpol_1008.251.356ON449811352e-08
TBLA0B096202.319ON941681343e-08
NCAS0A119205.470ON463691324e-08
SAKL0E06820g2.319ON905571316e-08
Ecym_33662.319ON906591282e-07
KAFR0A009701.356ON396521272e-07
ADL288C2.319ON925581272e-07
KAFR0E036405.470ON441581272e-07
TBLA0A025705.470ON493661272e-07
NDAI0A043505.470ON459681262e-07
KLLA0E09043g2.319ON814541254e-07
Ecym_23165.470ON421741244e-07
Skud_4.6615.470ON460541244e-07
CAGL0M01650g5.470ON466551235e-07
YDR388W (RVS167)5.470ON482551236e-07
KLTH0D06138g2.502ON489691227e-07
KNAG0C046305.470ON516701228e-07
Smik_4.6585.470ON472551228e-07
Skud_4.1372.319ON887961228e-07
Smik_4.1192.319ON887591229e-07
ZYRO0D11110g5.470ON459541211e-06
Suva_4.1292.319ON887581211e-06
NDAI0B033302.319ON919581211e-06
KAFR0A068702.319ON854581211e-06
TDEL0A033405.470ON473541201e-06
AFR140C5.470ON388751201e-06
Ecym_24402.502ON459501201e-06
TBLA0B054702.502ON539501192e-06
NCAS0B060202.319ON864561202e-06
ZYRO0A02662g2.319ON886581183e-06
Kwal_23.34162.319ON883651183e-06
Kpol_440.105.470ON470801173e-06
YDL117W (CYK3)2.319ON885581174e-06
TDEL0G024902.319ON850621165e-06
KNAG0A054902.319ON882631165e-06
Kpol_534.62.319ON886641157e-06
ABR008C2.502ON4431011147e-06
TPHA0C040202.502ON485501147e-06
KLLA0E03059g5.470ON428761131e-05
TDEL0A027802.502ON451501131e-05
CAGL0H10516g2.319ON880581131e-05
KLTH0F09240g2.319ON888581131e-05
TPHA0E015005.470ON457641121e-05
Smik_8.472.502ON447811112e-05
CAGL0K02761g2.502ON450551112e-05
KNAG0I015801.356ON581511112e-05
TPHA0G009302.319ON824531112e-05
ZYRO0B01298g2.502ON411531093e-05
Kpol_1056.372.502ON501501084e-05
KAFR0D033602.502ON455541076e-05
NCAS0A050802.502ON450501076e-05
Suva_8.512.502ON456501076e-05
Kwal_26.79022.502ON5321111068e-05
Kwal_47.178942.159ON621611051e-04
SAKL0E02200g2.502ON511501041e-04
KLLA0B13475g2.502ON508501032e-04
NDAI0K021302.502ON459501032e-04
Suva_2.564singletonON4335912e-04
CAGL0A02145g1.356ON391531013e-04
YHL002W (HSE1)2.502ON452501013e-04
Skud_8.432.502ON45450995e-04
ACR266W2.159ON62671989e-04
YHR114W (BZZ1)2.159ON63352950.002
KLTH0E09790g2.159ON62257940.002
KNAG0A067102.502ON41979920.005
AGR306C5.170ON92364910.007
TDEL0B052202.159ON61352890.010
TDEL0E055204.45ON158956880.015
Kpol_538.255.170ON70774860.025
KLLA0D16874g8.344ON22760840.031
TPHA0F031007.365ON38161840.034
Ecym_23082.591ON67859850.036
ABR082W2.591ON68359840.049
NCAS0D019505.170ON93961840.051
TPHA0K006807.419ON35557830.057
CAGL0K00517g1.515ON2471111830.061
NCAS0A145707.419ON35563820.061
SAKL0E10780g2.159ON62552820.069
Smik_8.1922.159ON63352820.080
Suva_15.3102.159ON63472820.085
KLLA0E06953g7.419ON35757810.091
TBLA0C055602.159ON67350810.10
KLTH0B04818g7.365ON38068810.10
KNAG0H035002.159ON63452810.11
TPHA0B028902.159ON63452810.11
KLLA0D09306g4.45ON153772810.12
Kpol_1072.562.159ON63752800.13
KAFR0L018807.413ON93071800.13
SAKL0H10098g8.539ON55583790.17
KLLA0E23365g8.539ON57555790.18
KLLA0F23848g2.159ON64956780.23
NDAI0A015007.413ON104794780.24
KAFR0K020007.419ON33258770.25
Ecym_54262.159ON67250780.26
KLTH0D16434g4.335ON46158770.26
Kwal_23.64376.366ON63166780.27
SAKL0G17600g4.335ON44195770.27
NDAI0B043202.159ON63252780.28
SAKL0H24222g4.45ON152656780.30
NDAI0A014707.419ON36754770.31
KAFR0L015807.365ON34461760.35
Ecym_47107.365ON39964760.35
Ecym_11678.539ON55065770.35
Skud_12.2567.365ON40361760.36
Suva_5.2357.413ON104379770.37
KLLA0F14575g5.170ON85158760.40
Skud_8.1752.159ON63352750.55
YLL017WsingletonOFF10338700.61
Ecym_71347.419ON33257740.64
CAGL0I02750g2.159ON61950740.72
Ecym_82195.170ON102460740.74
NCAS0B069802.159ON63977740.75
AGL286C7.419ON33059730.76
TPHA0F003804.45ON161843740.78
NDAI0E043907.365ON44564730.90
TDEL0C028107.419ON33761730.92
KNAG0C033907.419ON34257721.00
KLTH0C06028g7.419ON34257721.1
ACR230C7.365ON39864721.1
KAFR0J005805.170ON90269721.2
Scer_YGOB_SDC25 (SDC25)4.45ON125238721.4
Kpol_1045.217.419ON35862711.6
TBLA0H011608.344ON22450701.7
AER140C4.335ON41440711.8
Ecym_72314.108ON114665712.0
Kwal_27.107077.419ON34357702.0
Kpol_325.126.366ON57058702.1
KLTH0B02354g5.170ON121481712.1
KLTH0H09416g4.45ON152878702.2
YLR191W (PEX13)7.365ON38661702.3
Suva_5.2397.419ON36847692.4
SAKL0F12958g7.413ON102774702.4
Smik_12.2517.365ON38861692.4
KAFR0F007502.159ON60258702.5
TBLA0I010507.419ON37157692.7
AGL237C6.366ON57852692.7
AGL293C7.413ON98466702.8
Kwal_47.169434.335ON46045692.8
KLTH0E12518g8.539ON55290693.0
SAKL0H21912g4.108ON125366693.0
Suva_10.2877.365ON39261683.3
CAGL0E02783g4.108ON120358693.3
ZYRO0F13882g8.344ON28859683.3
Ecym_42288.344ON26159683.3
Smik_2.357.413ON98568693.5
Kwal_53.194498.344ON19960673.8
Skud_5.2657.413ON104372683.8
TBLA0F002806.366ON57676683.9
Suva_2.337.413ON98259684.0
ZYRO0B16214g2.159ON65969684.2
SAKL0A00594g6.366ON63652684.6
KLTH0A07348g6.366ON62652684.7
KAFR0B058608.344ON24959664.9
NDAI0I002206.366ON61555675.0
ZYRO0C14454g5.347ON17667655.3
Smik_4.4068.344ON23557665.4
ZYRO0B04004g7.419ON37157675.4
Smik_5.2637.419ON36854666.5
YER114C (BOI2)7.413ON104072676.5
TDEL0A078106.366ON55822667.4
KAFR0J026506.366ON55322667.6
YER118C (SHO1)7.419ON36732657.6
Skud_4.4208.344ON23366657.8
KNAG0B022307.413ON90450667.8
KNAG0I027006.366ON57522658.3
AEL241W8.539ON54990658.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0D02910
         (269 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0D02910 Chr4 complement(717010..717819) [810 bp, 269 aa] {ON...   306   e-105
Kpol_480.8 s480 complement(17610..18329) [720 bp, 239 aa] {ON} c...    93   8e-22
Kwal_47.18905 s47 (1021428..1022138) [711 bp, 236 aa] {ON} YPR15...    91   4e-21
NCAS0F03600 Chr6 (715784..716497) [714 bp, 237 aa] {ON} Anc_3.50...    90   7e-21
TBLA0C04530 Chr3 (1097179..1097847) [669 bp, 222 aa] {ON} Anc_3....    87   1e-19
KLLA0E03873g Chr5 complement(354700..355362) [663 bp, 220 aa] {O...    86   1e-19
KLTH0G02332g Chr7 complement(184383..185084) [702 bp, 233 aa] {O...    86   2e-19
SAKL0F02486g Chr6 complement(216399..217091) [693 bp, 230 aa] {O...    86   2e-19
AFR320W Chr6 (1014675..1015448) [774 bp, 257 aa] {ON} Syntenic h...    86   3e-19
Smik_16.406 Chr16 (706485..707123) [639 bp, 212 aa] {ON} YPR154W...    85   4e-19
TPHA0A05720 Chr1 (1293214..1293876) [663 bp, 220 aa] {ON} Anc_3....    85   4e-19
NDAI0B05920 Chr2 (1429564..1430271) [708 bp, 235 aa] {ON} Anc_3....    84   1e-18
TDEL0D05690 Chr4 (1022136..1022741) [606 bp, 201 aa] {ON} Anc_3....    81   7e-18
Skud_16.448 Chr16 (788136..788762) [627 bp, 208 aa] {ON} YPR154W...    80   1e-17
KNAG0A07990 Chr1 (1272958..1273623) [666 bp, 221 aa] {ON} Anc_3....    81   1e-17
YPR154W Chr16 (834565..835212) [648 bp, 215 aa] {ON}  PIN3Protei...    80   2e-17
KNAG0B00750 Chr2 complement(140620..141273) [654 bp, 217 aa] {ON...    80   3e-17
ZYRO0D09702g Chr4 complement(823900..824376) [477 bp, 158 aa] {O...    76   2e-16
Suva_16.482 Chr16 (830850..831557) [708 bp, 235 aa] {ON} YPR154W...    78   3e-16
KAFR0G03740 Chr7 (767426..768130) [705 bp, 234 aa] {ON} Anc_3.50...    77   4e-16
Smik_6.232 Chr6 (380319..381044) [726 bp, 241 aa] {ON} YGR136W (...    74   6e-15
CAGL0F04829g Chr6 (487684..488292) [609 bp, 202 aa] {ON} similar...    73   9e-15
YGR136W Chr7 (762428..763153) [726 bp, 241 aa] {ON}  LSB1Protein...    72   3e-14
Ecym_1228 Chr1 complement(473518..474279) [762 bp, 253 aa] {ON} ...    72   5e-14
Suva_7.424 Chr7 (732619..733368) [750 bp, 249 aa] {ON} YGR136W (...    69   4e-13
Skud_7.447 Chr7 (741615..742331) [717 bp, 238 aa] {ON} YGR136W (...    66   4e-12
TPHA0O01280 Chr15 complement(252746..254110) [1365 bp, 454 aa] {...    67   5e-12
ZYRO0G20372g Chr7 (1680364..1680816) [453 bp, 150 aa] {ON} weakl...    63   1e-11
AEL017W Chr5 (603303..603349,603451..604654) [1251 bp, 416 aa] {...    66   1e-11
TDEL0D02240 Chr4 (431160..431206,431314..432568) [1302 bp, 433 a...    64   5e-11
Kwal_55.21287 s55 complement(768495..769880) [1386 bp, 461 aa] {...    64   6e-11
KNAG0C02040 Chr3 complement(397447..398841) [1395 bp, 464 aa] {O...    64   8e-11
CAGL0I08965g Chr9 complement(869942..871255) [1314 bp, 437 aa] {...    63   1e-10
KAFR0C04400 Chr3 (868668..868714,868802..870134) [1380 bp, 459 a...    62   2e-10
Kwal_0.371 s0 complement(179002..179655) [654 bp, 217 aa] {ON} Y...    60   3e-10
Ecym_2747 Chr2 complement(1449887..1451198,1451401..1451447) [13...    62   3e-10
Suva_15.199 Chr15 complement(345409..346735,346904..346950) [137...    61   5e-10
KLLA0A08360g Chr1 complement(739092..740316,740718..740764) [127...    61   5e-10
KLTH0F15114g Chr6 complement(1238921..1240228) [1308 bp, 435 aa]...    61   5e-10
NCAS0B07250 Chr2 complement(1371597..1372875,1373026..1373072) [...    60   8e-10
Smik_8.81 Chr8 complement(117184..118543,118714..118760) [1407 b...    60   8e-10
NCAS0A08990 Chr1 complement(1780800..1782036,1782134..1782201) [...    60   1e-09
TBLA0D04950 Chr4 complement(1216633..1218039) [1407 bp, 468 aa] ...    60   1e-09
NDAI0G05960 Chr7 (1474282..1475553) [1272 bp, 423 aa] {ON} Anc_1...    60   1e-09
Smik_7.335 Chr7 complement(563424..564759,564853..564899) [1383 ...    60   1e-09
YHR016C Chr8 complement(136881..138240,138409..138455) [1407 bp,...    60   2e-09
Skud_8.68 Chr8 complement(118475..119855,120025..120071) [1428 b...    59   2e-09
SAKL0D09702g Chr4 complement(805912..807151,807326..807372) [128...    59   2e-09
YFR024C-A Chr6 complement(201960..203292,203387..203433) [1380 b...    59   2e-09
TBLA0F03490 Chr6 (859156..859202,859415..860903) [1536 bp, 511 a...    59   2e-09
KLTH0H12980g Chr8 complement(1110123..1111259,1111344..1111406) ...    59   4e-09
Suva_6.96 Chr6 complement(167266..168586,168693..168739) [1368 b...    58   5e-09
NDAI0B04580 Chr2 complement(1138779..1140053) [1275 bp, 424 aa] ...    58   5e-09
ZYRO0G00792g Chr7 (61277..61323,61435..62797) [1410 bp, 469 aa] ...    58   6e-09
Skud_6.108 Chr6 complement(197616..198948,199044..199090) [1380 ...    57   1e-08
SAKL0G03454g Chr7 (284017..285423) [1407 bp, 468 aa] {ON} some s...    57   1e-08
TPHA0A02210 Chr1 (455888..457081) [1194 bp, 397 aa] {ON} Anc_1.3...    57   2e-08
Kpol_1008.25 s1008 complement(50905..52207,52597..52643) [1350 b...    57   2e-08
TBLA0B09620 Chr2 complement(2277581..2280406) [2826 bp, 941 aa] ...    56   3e-08
NCAS0A11920 Chr1 (2363750..2365141) [1392 bp, 463 aa] {ON} Anc_5...    55   4e-08
SAKL0E06820g Chr5 complement(556960..559677) [2718 bp, 905 aa] {...    55   6e-08
Ecym_3366 Chr3 complement(695872..698592) [2721 bp, 906 aa] {ON}...    54   2e-07
KAFR0A00970 Chr1 (181162..182352) [1191 bp, 396 aa] {ON} Anc_1.3...    54   2e-07
ADL288C Chr4 complement(194687..197464) [2778 bp, 925 aa] {ON} S...    54   2e-07
KAFR0E03640 Chr5 complement(731325..732650) [1326 bp, 441 aa] {O...    54   2e-07
TBLA0A02570 Chr1 complement(622892..624373) [1482 bp, 493 aa] {O...    54   2e-07
NDAI0A04350 Chr1 complement(979014..980393) [1380 bp, 459 aa] {O...    53   2e-07
KLLA0E09043g Chr5 complement(807159..809603) [2445 bp, 814 aa] {...    53   4e-07
Ecym_2316 Chr2 complement(619368..620633) [1266 bp, 421 aa] {ON}...    52   4e-07
Skud_4.661 Chr4 (1170843..1172225) [1383 bp, 460 aa] {ON} YDR388...    52   4e-07
CAGL0M01650g Chr13 complement(184085..185485) [1401 bp, 466 aa] ...    52   5e-07
YDR388W Chr4 (1250186..1251634) [1449 bp, 482 aa] {ON}  RVS167Ac...    52   6e-07
KLTH0D06138g Chr4 (544661..546130) [1470 bp, 489 aa] {ON} simila...    52   7e-07
KNAG0C04630 Chr3 (908312..909862) [1551 bp, 516 aa] {ON} Anc_5.4...    52   8e-07
Smik_4.658 Chr4 (1170707..1172125) [1419 bp, 472 aa] {ON} YDR388...    52   8e-07
Skud_4.137 Chr4 (244217..246880) [2664 bp, 887 aa] {ON} YDL117W ...    52   8e-07
Smik_4.119 Chr4 (225256..227919) [2664 bp, 887 aa] {ON} YDL117W ...    52   9e-07
ZYRO0D11110g Chr4 (939064..940443) [1380 bp, 459 aa] {ON} simila...    51   1e-06
Suva_4.129 Chr4 (237039..239702) [2664 bp, 887 aa] {ON} YDL117W ...    51   1e-06
NDAI0B03330 Chr2 (848506..851265) [2760 bp, 919 aa] {ON} Anc_2.3...    51   1e-06
KAFR0A06870 Chr1 complement(1387865..1390429) [2565 bp, 854 aa] ...    51   1e-06
TDEL0A03340 Chr1 (592752..594173) [1422 bp, 473 aa] {ON} Anc_5.4...    51   1e-06
AFR140C Chr6 complement(692042..693208) [1167 bp, 388 aa] {ON} S...    51   1e-06
Ecym_2440 Chr2 (858070..859449) [1380 bp, 459 aa] {ON} similar t...    51   1e-06
TBLA0B05470 Chr2 complement(1301018..1302637) [1620 bp, 539 aa] ...    50   2e-06
NCAS0B06020 Chr2 (1138359..1140953) [2595 bp, 864 aa] {ON} Anc_2...    51   2e-06
ZYRO0A02662g Chr1 (213322..215982) [2661 bp, 886 aa] {ON} simila...    50   3e-06
Kwal_23.3416 s23 (280746..283397) [2652 bp, 883 aa] {ON} YDL117W...    50   3e-06
Kpol_440.10 s440 (25697..27109) [1413 bp, 470 aa] {ON} (25697..2...    50   3e-06
YDL117W Chr4 (248581..251238) [2658 bp, 885 aa] {ON}  CYK3SH3-do...    50   4e-06
TDEL0G02490 Chr7 (478524..481076) [2553 bp, 850 aa] {ON} Anc_2.3...    49   5e-06
KNAG0A05490 Chr1 (812680..815328) [2649 bp, 882 aa] {ON} Anc_2.3...    49   5e-06
Kpol_534.6 s534 (20451..23111) [2661 bp, 886 aa] {ON} (20451..23...    49   7e-06
ABR008C Chr2 complement(406780..408111) [1332 bp, 443 aa] {ON} S...    49   7e-06
TPHA0C04020 Chr3 complement(861629..863086) [1458 bp, 485 aa] {O...    49   7e-06
KLLA0E03059g Chr5 (281543..282829) [1287 bp, 428 aa] {ON} simila...    48   1e-05
TDEL0A02780 Chr1 (504696..506051) [1356 bp, 451 aa] {ON} Anc_2.5...    48   1e-05
CAGL0H10516g Chr8 complement(1024427..1027069) [2643 bp, 880 aa]...    48   1e-05
KLTH0F09240g Chr6 (799558..802224) [2667 bp, 888 aa] {ON} simila...    48   1e-05
TPHA0E01500 Chr5 complement(304130..305503) [1374 bp, 457 aa] {O...    48   1e-05
Smik_8.47 Chr8 (81503..82846) [1344 bp, 447 aa] {ON} YHL002W (REAL)    47   2e-05
CAGL0K02761g Chr11 (249893..251245) [1353 bp, 450 aa] {ON} simil...    47   2e-05
KNAG0I01580 Chr9 (306534..306580,306733..308431) [1746 bp, 581 a...    47   2e-05
TPHA0G00930 Chr7 (179525..181999) [2475 bp, 824 aa] {ON} Anc_2.3...    47   2e-05
ZYRO0B01298g Chr2 (110004..111239) [1236 bp, 411 aa] {ON} simila...    47   3e-05
Kpol_1056.37 s1056 (92852..94357) [1506 bp, 501 aa] {ON} (92852....    46   4e-05
KAFR0D03360 Chr4 complement(658469..659836) [1368 bp, 455 aa] {O...    46   6e-05
NCAS0A05080 Chr1 (1011572..1012924) [1353 bp, 450 aa] {ON} Anc_2...    46   6e-05
Suva_8.51 Chr8 (98991..100361) [1371 bp, 456 aa] {ON} YHL002W (R...    46   6e-05
Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W...    45   8e-05
Kwal_47.17894 s47 (597826..599691) [1866 bp, 621 aa] {ON} YHR114...    45   1e-04
SAKL0E02200g Chr5 complement(171315..172850) [1536 bp, 511 aa] {...    45   1e-04
KLLA0B13475g Chr2 complement(1178856..1180382) [1527 bp, 508 aa]...    44   2e-04
NDAI0K02130 Chr11 (481352..482731) [1380 bp, 459 aa] {ON} Anc_2....    44   2e-04
Suva_2.564 Chr2 (1002523..1002651) [129 bp, 43 aa] {ON} YDR388W ...    40   2e-04
CAGL0A02145g Chr1 (224026..224036,225280..226444) [1176 bp, 391 ...    44   3e-04
YHL002W Chr8 (102612..103970) [1359 bp, 452 aa] {ON}  HSE1Subuni...    44   3e-04
Skud_8.43 Chr8 (84125..85489) [1365 bp, 454 aa] {ON} YHL002W (REAL)    43   5e-04
ACR266W Chr3 (838689..840569) [1881 bp, 626 aa] {ON} Syntenic ho...    42   9e-04
YHR114W Chr8 (338083..339984) [1902 bp, 633 aa] {ON}  BZZ1SH3 do...    41   0.002
KLTH0E09790g Chr5 (881284..883152) [1869 bp, 622 aa] {ON} simila...    41   0.002
KNAG0A06710 Chr1 complement(1045213..1046472) [1260 bp, 419 aa] ...    40   0.005
AGR306C Chr7 complement(1305647..1308418) [2772 bp, 923 aa] {ON}...    40   0.007
TDEL0B05220 Chr2 complement(918098..919939) [1842 bp, 613 aa] {O...    39   0.010
TDEL0E05520 Chr5 (1015520..1020289) [4770 bp, 1589 aa] {ON} Anc_...    39   0.015
Kpol_538.25 s538 (50807..52930) [2124 bp, 707 aa] {ON} (50807..5...    38   0.025
KLLA0D16874g Chr4 complement(1430953..1431636) [684 bp, 227 aa] ...    37   0.031
TPHA0F03100 Chr6 complement(680407..681552) [1146 bp, 381 aa] {O...    37   0.034
Ecym_2308 Chr2 complement(597163..599199) [2037 bp, 678 aa] {ON}...    37   0.036
ABR082W Chr2 (537500..539551) [2052 bp, 683 aa] {ON} Syntenic ho...    37   0.049
NCAS0D01950 Chr4 (358938..361757) [2820 bp, 939 aa] {ON} Anc_5.170     37   0.051
TPHA0K00680 Chr11 (134675..135742) [1068 bp, 355 aa] {ON} Anc_7....    37   0.057
CAGL0K00517g Chr11 complement(55747..63162) [7416 bp, 2471 aa] {...    37   0.061
NCAS0A14570 Chr1 complement(2869713..2870780) [1068 bp, 355 aa] ...    36   0.061
SAKL0E10780g Chr5 (897714..899591) [1878 bp, 625 aa] {ON} simila...    36   0.069
Smik_8.192 Chr8 (314456..316357) [1902 bp, 633 aa] {ON} YHR114W ...    36   0.080
Suva_15.310 Chr15 (540462..542366) [1905 bp, 634 aa] {ON} YHR114...    36   0.085
KLLA0E06953g Chr5 (629777..630850) [1074 bp, 357 aa] {ON} unipro...    36   0.091
TBLA0C05560 Chr3 complement(1346488..1348509) [2022 bp, 673 aa] ...    36   0.10 
KLTH0B04818g Chr2 complement(395490..396632) [1143 bp, 380 aa] {...    36   0.10 
KNAG0H03500 Chr8 (652236..654140) [1905 bp, 634 aa] {ON} Anc_2.1...    36   0.11 
TPHA0B02890 Chr2 complement(659614..661518) [1905 bp, 634 aa] {O...    36   0.11 
KLLA0D09306g Chr4 (783852..788465) [4614 bp, 1537 aa] {ON} simil...    36   0.12 
Kpol_1072.56 s1072 complement(127771..129684) [1914 bp, 637 aa] ...    35   0.13 
KAFR0L01880 Chr12 complement(348028..350820) [2793 bp, 930 aa] {...    35   0.13 
SAKL0H10098g Chr8 (865874..865882,865987..867645) [1668 bp, 555 ...    35   0.17 
KLLA0E23365g Chr5 complement(2077042..2078760,2078979..2078987) ...    35   0.18 
KLLA0F23848g Chr6 (2224951..2226900) [1950 bp, 649 aa] {ON} simi...    35   0.23 
NDAI0A01500 Chr1 (331951..335094) [3144 bp, 1047 aa] {ON} Anc_7....    35   0.24 
KAFR0K02000 Chr11 complement(410316..411314) [999 bp, 332 aa] {O...    34   0.25 
Ecym_5426 Chr5 (877285..879303) [2019 bp, 672 aa] {ON} similar t...    35   0.26 
KLTH0D16434g Chr4 complement(1358785..1360170) [1386 bp, 461 aa]...    34   0.26 
Kwal_23.6437 s23 (1581839..1583734) [1896 bp, 631 aa] {ON} YCR08...    35   0.27 
SAKL0G17600g Chr7 complement(1523623..1524948) [1326 bp, 441 aa]...    34   0.27 
NDAI0B04320 Chr2 (1084783..1086681) [1899 bp, 632 aa] {ON} Anc_2...    35   0.28 
SAKL0H24222g Chr8 complement(2089734..2094314) [4581 bp, 1526 aa...    35   0.30 
NDAI0A01470 Chr1 (326531..327634) [1104 bp, 367 aa] {ON} Anc_7.4...    34   0.31 
KAFR0L01580 Chr12 complement(286684..287718) [1035 bp, 344 aa] {...    34   0.35 
Ecym_4710 Chr4 (1391055..1392254) [1200 bp, 399 aa] {ON} similar...    34   0.35 
Ecym_1167 Chr1 (341453..341461,341739..343382) [1653 bp, 550 aa]...    34   0.35 
Skud_12.256 Chr12 (483859..485070) [1212 bp, 403 aa] {ON} YLR191...    34   0.36 
Suva_5.235 Chr5 complement(366285..369416) [3132 bp, 1043 aa] {O...    34   0.37 
KLLA0F14575g Chr6 complement(1351796..1354351) [2556 bp, 851 aa]...    34   0.40 
Skud_8.175 Chr8 (311857..313758) [1902 bp, 633 aa] {ON} YHR114W ...    33   0.55 
YLL017W Chr12 (112234..112545) [312 bp, 103 aa] {OFF} Non-essent...    32   0.61 
Ecym_7134 Chr7 (266402..267400) [999 bp, 332 aa] {ON} similar to...    33   0.64 
CAGL0I02750g Chr9 complement(242879..244738) [1860 bp, 619 aa] {...    33   0.72 
Ecym_8219 Chr8 (447011..450085) [3075 bp, 1024 aa] {ON} similar ...    33   0.74 
NCAS0B06980 Chr2 (1328203..1330122) [1920 bp, 639 aa] {ON} Anc_2...    33   0.75 
AGL286C Chr7 complement(174535..175527) [993 bp, 330 aa] {ON} Sy...    33   0.76 
TPHA0F00380 Chr6 (85560..90416) [4857 bp, 1618 aa] {ON} Anc_4.45...    33   0.78 
NDAI0E04390 Chr5 (993398..994735) [1338 bp, 445 aa] {ON} Anc_7.3...    33   0.90 
TDEL0C02810 Chr3 complement(498625..499638) [1014 bp, 337 aa] {O...    33   0.92 
KNAG0C03390 Chr3 (667055..668083) [1029 bp, 342 aa] {ON} Anc_7.4...    32   1.00 
KLTH0C06028g Chr3 (520445..521473) [1029 bp, 342 aa] {ON} simila...    32   1.1  
ACR230C Chr3 complement(763430..764626) [1197 bp, 398 aa] {ON} S...    32   1.1  
KAFR0J00580 Chr10 (99508..102216) [2709 bp, 902 aa] {ON} Anc_5.1...    32   1.2  
Scer_YGOB_SDC25 Chr12 (112234..112506,112508..115993) [3759 bp, ...    32   1.4  
Kpol_1045.21 s1045 (44318..45394) [1077 bp, 358 aa] {ON} (44320....    32   1.6  
TBLA0H01160 Chr8 (259004..259678) [675 bp, 224 aa] {ON} Anc_8.34...    32   1.7  
AER140C Chr5 complement(901101..902345) [1245 bp, 414 aa] {ON} N...    32   1.8  
Ecym_7231 Chr7 complement(480473..483913) [3441 bp, 1146 aa] {ON...    32   2.0  
Kwal_27.10707 s27 (457482..458513) [1032 bp, 343 aa] {ON} YER118...    32   2.0  
Kpol_325.12 s325 (19571..21283) [1713 bp, 570 aa] {ON} (19571..2...    32   2.1  
KLTH0B02354g Chr2 (186128..189772) [3645 bp, 1214 aa] {ON} weakl...    32   2.1  
KLTH0H09416g Chr8 (806836..811422) [4587 bp, 1528 aa] {ON} simil...    32   2.2  
YLR191W Chr12 (537272..538432) [1161 bp, 386 aa] {ON}  PEX13Inte...    32   2.3  
Suva_5.239 Chr5 complement(373672..374778) [1107 bp, 368 aa] {ON...    31   2.4  
SAKL0F12958g Chr6 complement(1019015..1022098) [3084 bp, 1027 aa...    32   2.4  
Smik_12.251 Chr12 (484225..485391) [1167 bp, 388 aa] {ON} YLR191...    31   2.4  
KAFR0F00750 Chr6 complement(145999..147807) [1809 bp, 602 aa] {O...    32   2.5  
TBLA0I01050 Chr9 (210595..211710) [1116 bp, 371 aa] {ON} Anc_7.4...    31   2.7  
AGL237C Chr7 complement(254636..256372) [1737 bp, 578 aa] {ON} S...    31   2.7  
AGL293C Chr7 complement(156902..159856) [2955 bp, 984 aa] {ON} S...    32   2.8  
Kwal_47.16943 s47 (182308..183690) [1383 bp, 460 aa] {ON} YDR388...    31   2.8  
KLTH0E12518g Chr5 complement(1109548..1111197,1111361..1111369) ...    31   3.0  
SAKL0H21912g Chr8 complement(1913307..1917068) [3762 bp, 1253 aa...    31   3.0  
Suva_10.287 Chr10 (509884..511062) [1179 bp, 392 aa] {ON} YLR191...    31   3.3  
CAGL0E02783g Chr5 (261665..265276) [3612 bp, 1203 aa] {ON} simil...    31   3.3  
ZYRO0F13882g Chr6 complement(1143280..1144146) [867 bp, 288 aa] ...    31   3.3  
Ecym_4228 Chr4 (475985..476770) [786 bp, 261 aa] {ON} similar to...    31   3.3  
Smik_2.35 Chr2 (57476..60433) [2958 bp, 985 aa] {ON} YBL085W (REAL)    31   3.5  
Kwal_53.19449 s53 (58..657) [600 bp, 199 aa] {ON} YDR162C (NBP2)...    30   3.8  
Skud_5.265 Chr5 (427799..430930) [3132 bp, 1043 aa] {ON} YER114C...    31   3.8  
TBLA0F00280 Chr6 complement(58186..59916) [1731 bp, 576 aa] {ON}...    31   3.9  
Suva_2.33 Chr2 (60529..63477) [2949 bp, 982 aa] {ON} YBL085W (REAL)    31   4.0  
ZYRO0B16214g Chr2 (1312950..1314929) [1980 bp, 659 aa] {ON} simi...    31   4.2  
SAKL0A00594g Chr1 complement(68426..70336) [1911 bp, 636 aa] {ON...    31   4.6  
KLTH0A07348g Chr1 (610049..611929) [1881 bp, 626 aa] {ON} simila...    31   4.7  
KAFR0B05860 Chr2 complement(1210822..1211571) [750 bp, 249 aa] {...    30   4.9  
NDAI0I00220 Chr9 (32281..34128) [1848 bp, 615 aa] {ON} Anc_6.366...    30   5.0  
ZYRO0C14454g Chr3 (1130631..1131161) [531 bp, 176 aa] {ON} some ...    30   5.3  
Smik_4.406 Chr4 complement(738389..739096) [708 bp, 235 aa] {ON}...    30   5.4  
ZYRO0B04004g Chr2 complement(337594..338709) [1116 bp, 371 aa] {...    30   5.4  
Smik_5.263 Chr5 complement(407025..408131) [1107 bp, 368 aa] {ON...    30   6.5  
YER114C Chr5 complement(390590..393712) [3123 bp, 1040 aa] {ON} ...    30   6.5  
TDEL0A07810 Chr1 (1355773..1357449) [1677 bp, 558 aa] {ON} Anc_6...    30   7.4  
KAFR0J02650 Chr10 complement(510356..512017) [1662 bp, 553 aa] {...    30   7.6  
YER118C Chr5 complement(397952..399055) [1104 bp, 367 aa] {ON}  ...    30   7.6  
Skud_4.420 Chr4 complement(749749..750450) [702 bp, 233 aa] {ON}...    30   7.8  
KNAG0B02230 Chr2 (431524..434238) [2715 bp, 904 aa] {ON} Anc_7.4...    30   7.8  
KNAG0I02700 Chr9 complement(531880..533607) [1728 bp, 575 aa] {O...    30   8.3  
AEL241W Chr5 (184639..184647,184836..186476) [1650 bp, 549 aa] {...    30   8.7  

>TBLA0D02910 Chr4 complement(717010..717819) [810 bp, 269 aa] {ON}
           Anc_3.501 YPR154W
          Length = 269

 Score =  306 bits (785), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 149/164 (90%), Positives = 149/164 (90%)

Query: 1   MSADRREAAIKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHKRRSPSASSYSNPTKG 60
           MSADRREAAIKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHKRRSPSASSYSNPTKG
Sbjct: 1   MSADRREAAIKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHKRRSPSASSYSNPTKG 60

Query: 61  ALSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYV 120
           ALSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYV
Sbjct: 61  ALSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYV 120

Query: 121 KLYSSDDRDSNYQRTGIKTPVPTXXXXXXXXXXXXXXXEDYDYT 164
           KLYSSDDRDSNYQRTGIKTPVPT               EDYDYT
Sbjct: 121 KLYSSDDRDSNYQRTGIKTPVPTSAPHSAPHSAPPPSHEDYDYT 164

>Kpol_480.8 s480 complement(17610..18329) [720 bp, 239 aa] {ON}
           complement(17610..18329) [720 nt, 240 aa]
          Length = 239

 Score = 92.8 bits (229), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 74/119 (62%), Gaps = 16/119 (13%)

Query: 8   AAIKDAYTEIRRCLELLIDTKEISENDYDEIQDIL--RHKRRSPSASSYSNPTKGALSPR 65
           A+I  + T ++  LE L D+  IS   +D+I ++L  RH           +P++ +L+  
Sbjct: 4   ASINRSLTSVKTELEFLRDSNVISGEAFDQINNLLPDRH-----------DPSRESLATN 52

Query: 66  NGP---QYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVK 121
           N     +YVEAIY +  +Q GDL + PGD I+V+ K SP+WY+G+ NGKVGVFP+NYVK
Sbjct: 53  NSSPNLEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGKCNGKVGVFPSNYVK 111

>Kwal_47.18905 s47 (1021428..1022138) [711 bp, 236 aa] {ON} YPR154W
           (PIN3) -  [contig 189] FULL
          Length = 236

 Score = 90.5 bits (223), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 78/133 (58%), Gaps = 9/133 (6%)

Query: 8   AAIKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHKRRSPSASSYSNPTKGALSPRNG 67
           ++I  + + +R  LE L ++  I+E  Y +I  +L  +   P     S PT     P + 
Sbjct: 4   SSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPPR----STPTV----PSSQ 55

Query: 68  PQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVKLYSSDD 127
            ++VEAIYA+  +Q GDL L  GD IEV+ K SP+WY+GR NG+VG+FP+NYVK   S  
Sbjct: 56  SEFVEAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSGS 115

Query: 128 RDSNYQRTGIKTP 140
            +++ +R  +  P
Sbjct: 116 -NASLERPNVPAP 127

>NCAS0F03600 Chr6 (715784..716497) [714 bp, 237 aa] {ON} Anc_3.501
           YGR136W
          Length = 237

 Score = 90.1 bits (222), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 50/120 (41%), Positives = 74/120 (61%), Gaps = 11/120 (9%)

Query: 8   AAIKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHK-----RRSPSASSYSNPTKGAL 62
           ++I  +   IR  L+ L ++  IS+  +D+I   L  K      R+PS  S +N      
Sbjct: 4   SSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPDASRAPSIHSSNN-----N 58

Query: 63  SPRN-GPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVK 121
            P++ G ++VEAIY +  +Q+GDL L PGD IEVI K SP+W++GR NG+ G+FP+NYVK
Sbjct: 59  QPQDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVK 118

>TBLA0C04530 Chr3 (1097179..1097847) [669 bp, 222 aa] {ON} Anc_3.501
           YPR154W
          Length = 222

 Score = 86.7 bits (213), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 67/112 (59%), Gaps = 7/112 (6%)

Query: 10  IKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHKRRSPSASSYSNPTKGALSPRNGPQ 69
           I  + + I   L+ L+ +  I +  Y +I D+L   RR+P       P++   +     +
Sbjct: 6   INKSLSTIDTELDFLLKSNAIDKKTYSKIHDLL--PRRAPEV-----PSRQQSNSSKNEE 58

Query: 70  YVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVK 121
           +VEAIY +  +Q GDL+L PGD I V  K SP+W++G+ NGKVGVFP+NYV+
Sbjct: 59  WVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVR 110

>KLLA0E03873g Chr5 complement(354700..355362) [663 bp, 220 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 220

 Score = 86.3 bits (212), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 50/133 (37%), Positives = 78/133 (58%), Gaps = 12/133 (9%)

Query: 9   AIKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHKRRSPSASSYSNPTKGALSPRNGP 68
           +++++   I+  L+ L +   ++E  Y +I+ +L   R  P       P    +   N  
Sbjct: 3   SVEESVATIKSELKYLKEQGALAELAYKDIESLLPRVRPQP-------PVADTMGQNN-- 53

Query: 69  QYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVKLYSSDDR 128
           + VEA+YA+  +Q GDL L PGD IE++ K SP+WY+G+ NG+VGVFP+NYVK  S D +
Sbjct: 54  EIVEALYAFQPQQDGDLALKPGDKIEILEKLSPEWYKGKCNGQVGVFPSNYVK--SVDTK 111

Query: 129 DSNYQRTGIKTPV 141
           D   +R+   TPV
Sbjct: 112 DVE-KRSSSATPV 123

>KLTH0G02332g Chr7 complement(184383..185084) [702 bp, 233 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 233

 Score = 86.3 bits (212), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 70/115 (60%), Gaps = 10/115 (8%)

Query: 8   AAIKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHKRRSPSASSYSNPTKGALSPR-N 66
           ++I  + + +R  LE L ++  I+EN Y +I   L  +          +P++G   P   
Sbjct: 4   SSINRSLSTVRTELEFLRESDVITENSYRDILSALPERY---------DPSRGPQQPSAT 54

Query: 67  GPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVK 121
             ++VEAIYA+  +Q GDL L  GD +EV+ K SP+W++G+ NG+VG+FP+NYVK
Sbjct: 55  QGEFVEAIYAFQAQQDGDLNLQVGDKVEVLEKPSPEWFKGKCNGRVGMFPSNYVK 109

>SAKL0F02486g Chr6 complement(216399..217091) [693 bp, 230 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 230

 Score = 86.3 bits (212), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/112 (42%), Positives = 69/112 (61%), Gaps = 8/112 (7%)

Query: 10  IKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHKRRSPSASSYSNPTKGALSPRNGPQ 69
           I  + T IR  L+ L +++ ISE  + +I + L  +R  P+A+       G  S     +
Sbjct: 6   INRSLTTIRTELDFLRESEVISEETFQQISNSL-PQRYDPNAN-------GNRSSSPSLE 57

Query: 70  YVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVK 121
           YVEAIYA+  +Q GDL L PGD I+V+ K S +WY+G+ NG VG+FP+NYVK
Sbjct: 58  YVEAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVK 109

>AFR320W Chr6 (1014675..1015448) [774 bp, 257 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR136W (LSB1) and
           YPR154W (PIN3)
          Length = 257

 Score = 86.3 bits (212), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 45/113 (39%), Positives = 67/113 (59%), Gaps = 10/113 (8%)

Query: 10  IKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHKRRSPSASSYSNPTKGALSPRNGP- 68
           I  +   IR  L  L+D+  I+    ++I+  L +   +          +GA +   GP 
Sbjct: 6   INRSLATIRTELAFLVDSGVITRQQSEQIESNLPNPNEA---------LRGAPANNAGPV 56

Query: 69  QYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVK 121
           +YVEA+YA+  +Q GDL+   G+ IEV+ K SP+WY+GR NGKVG+FP+NYVK
Sbjct: 57  EYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVK 109

>Smik_16.406 Chr16 (706485..707123) [639 bp, 212 aa] {ON} YPR154W
           (REAL)
          Length = 212

 Score = 84.7 bits (208), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 53/141 (37%), Positives = 79/141 (56%), Gaps = 16/141 (11%)

Query: 10  IKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHKRRSPSASSYSNPTKGALSPRNGPQ 69
           I  + T IR  L+ L ++  IS + +D+I   L  +   PSAS  ++ T          +
Sbjct: 6   INRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRWDPPSASRNTSSTSL--------E 57

Query: 70  YVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVK-LYSSDDR 128
           YVEA+Y +  +Q GDL L PGD I+++ K SP+WY+G  NG+ G+FP NYVK  +S  + 
Sbjct: 58  YVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSNG 117

Query: 129 DSN------YQRTGIKTPVPT 143
            SN      Y+   ++ PVPT
Sbjct: 118 QSNLPPPPQYKAQELQ-PVPT 137

>TPHA0A05720 Chr1 (1293214..1293876) [663 bp, 220 aa] {ON} Anc_3.501
           YPR154W
          Length = 220

 Score = 85.1 bits (209), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 49/112 (43%), Positives = 67/112 (59%), Gaps = 2/112 (1%)

Query: 10  IKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHKRRSPSASSYSNPTKGALSPRNGPQ 69
           I  + T IR  LE L ++K IS++ + EI   L  +    +A S  + T    S     +
Sbjct: 6   INRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDPSNAPSMLSATTTRDS--TALE 63

Query: 70  YVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVK 121
           YVEAIY +  +Q GDL + PGD I+V+ K SP+WY+G  NGKVGVFP+NY K
Sbjct: 64  YVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTK 115

>NDAI0B05920 Chr2 (1429564..1430271) [708 bp, 235 aa] {ON} Anc_3.501
          Length = 235

 Score = 84.0 bits (206), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 70/112 (62%), Gaps = 6/112 (5%)

Query: 10  IKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHKRRSPSASSYSNPTKGALSPRNGPQ 69
           I  + T IR  L+ L ++  ISE  +++I + L  +R  P+ S  S  ++         +
Sbjct: 6   INRSLTNIRTELDFLKESNVISEETFNQINNQLP-QRYDPNGSRESVSSQAPTL-----E 59

Query: 70  YVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVK 121
           YVEAIY +  +Q+GDL L  GD I+VI K SP+W++G+ NG+VG+FP+NYV+
Sbjct: 60  YVEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVR 111

>TDEL0D05690 Chr4 (1022136..1022741) [606 bp, 201 aa] {ON} Anc_3.501
           YPR154W
          Length = 201

 Score = 81.3 bits (199), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 70/131 (53%), Gaps = 22/131 (16%)

Query: 1   MSADRREAAIKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHKRRSPSASSYSNPTKG 60
           MSA +    I  +   +R  L+ L ++  IS+  YD +   L      P  +S       
Sbjct: 1   MSASQ----INRSLATVRTELDFLRESNVISQEIYDMVNQSL------PQNAS------- 43

Query: 61  ALSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYV 120
                 G +Y+EA+Y +  +Q GDL L PGD IEV+ K S +W++GR NG+VG+FP NYV
Sbjct: 44  ----NKGGEYMEALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYV 99

Query: 121 K-LYSSDDRDS 130
           K  YS  DR S
Sbjct: 100 KAAYSGSDRPS 110

>Skud_16.448 Chr16 (788136..788762) [627 bp, 208 aa] {ON} YPR154W
           (REAL)
          Length = 208

 Score = 80.5 bits (197), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 72/123 (58%), Gaps = 9/123 (7%)

Query: 10  IKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHKRRSPSASSYSNPTKGALSPRNGPQ 69
           I  + T IR  L+ L ++  IS + +D+I   L   R +PS+++    +          +
Sbjct: 6   INRSLTTIRTELDFLKESNVISSDVFDQINKSLP-VRWNPSSAARDTSSASL-------E 57

Query: 70  YVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVK-LYSSDDR 128
           YVEA+Y +  +Q GDL L PGD ++++ K SP+WY+G  NG+VG+FP NYVK  +S  + 
Sbjct: 58  YVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPAFSGSNG 117

Query: 129 DSN 131
            SN
Sbjct: 118 SSN 120

>KNAG0A07990 Chr1 (1272958..1273623) [666 bp, 221 aa] {ON} Anc_3.501
           YPR154W
          Length = 221

 Score = 80.9 bits (198), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 45/116 (38%), Positives = 71/116 (61%), Gaps = 10/116 (8%)

Query: 10  IKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHK----RRSPSASSYSNPTKGALSPR 65
           I  + T +R  L+ L +++ ISE  +++I   L  K    + + + S  S+ +   L   
Sbjct: 6   INRSLTNVRTELDFLRESEVISEETFNKIMHSLPQKYDPNQHNDNRSRDSSESHAKL--- 62

Query: 66  NGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVK 121
              +YVEA+YA+  +Q GDLEL PGD I+V+ K S +WY+G+  G+VG+FP+NYVK
Sbjct: 63  ---EYVEALYAFQPQQDGDLELRPGDKIQVLEKPSAEWYKGKCGGQVGMFPSNYVK 115

>YPR154W Chr16 (834565..835212) [648 bp, 215 aa] {ON}  PIN3Protein
           that induces appearance of [PIN+] prion when
           overproduced
          Length = 215

 Score = 80.5 bits (197), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 68/123 (55%), Gaps = 9/123 (7%)

Query: 10  IKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHKRRSPSASSYSNPTKGALSPRNGPQ 69
           I  + T IR  L+ L  +  IS + YD+I   L  K    +A   ++P           +
Sbjct: 6   INRSLTNIRTELDFLKGSNVISNDVYDQINKSLPAKWDPANAPRNASPASL--------E 57

Query: 70  YVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVK-LYSSDDR 128
           YVEA+Y +  +Q GDL L PGD ++++ K SP+WY+G  NG+ G+FP NYVK  +S  + 
Sbjct: 58  YVEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSNG 117

Query: 129 DSN 131
            SN
Sbjct: 118 PSN 120

>KNAG0B00750 Chr2 complement(140620..141273) [654 bp, 217 aa] {ON}
           Anc_3.501 YPR154W
          Length = 217

 Score = 79.7 bits (195), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 47/116 (40%), Positives = 67/116 (57%), Gaps = 9/116 (7%)

Query: 8   AAIKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHKRRSPSASSYSNPTKGA--LSPR 65
            ++  + T IR  LE L+++K IS + +DE        R+ P       P  GA    P 
Sbjct: 4   GSVNRSITNIRTELEYLLESKVISRDTFDEFN------RKLPDNWD-GKPIGGAGEKHPP 56

Query: 66  NGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVK 121
           + P+YVEAI+ +  ++K DLEL  GD +E++ K S  WY G+  GKVGVFP+NYVK
Sbjct: 57  HEPEYVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVK 112

>ZYRO0D09702g Chr4 complement(823900..824376) [477 bp, 158 aa] {ON}
           weakly similar to uniprot|Q06449 Saccharomyces
           cerevisiae YPR154W PIN3 Protein that induces appearance
           of [PIN ] prion when overproduced
          Length = 158

 Score = 76.3 bits (186), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 35/63 (55%), Positives = 46/63 (73%)

Query: 67  GPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVKLYSSD 126
           G ++VEAIY +  +Q+GDL L PGD IEV+ K SP+W+ GR NG+VG+FP+NYVK   S 
Sbjct: 2   GGEFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAFSG 61

Query: 127 DRD 129
             D
Sbjct: 62  GFD 64

>Suva_16.482 Chr16 (830850..831557) [708 bp, 235 aa] {ON} YPR154W
           (REAL)
          Length = 235

 Score = 77.8 bits (190), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 67/117 (57%), Gaps = 8/117 (6%)

Query: 10  IKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHKRRSPSASSYSNPTKGALSPRNGPQ 69
           +  + T IR  L+ L ++  IS++ +D+I   L  K    SA   SN    +L      +
Sbjct: 24  VNRSLTNIRTELDFLKESNVISDDVFDQINKSLPVKWDPSSAPRGSN--SASL------E 75

Query: 70  YVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVKLYSSD 126
           YVEA+Y +  +Q GDL L  GD ++++ K SP+WY+G  NG+ G+FP NYVK   SD
Sbjct: 76  YVEAVYQFDPQQDGDLGLKQGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPVFSD 132

>KAFR0G03740 Chr7 (767426..768130) [705 bp, 234 aa] {ON} Anc_3.501
           YPR154W
          Length = 234

 Score = 77.0 bits (188), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 69/139 (49%), Gaps = 20/139 (14%)

Query: 8   AAIKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHKRRSPSASSYSNP---------- 57
           A I  A T I+  L+ L +++ I++   DEI   L  K    S  + SN           
Sbjct: 4   ALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTVNAA 63

Query: 58  ----------TKGALSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGR 107
                           P N  +YVEA+YA+  +Q+GDL L  GD ++++ K S +WY+G 
Sbjct: 64  ANSSSASVDHASATPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWYKGT 123

Query: 108 LNGKVGVFPTNYVKLYSSD 126
            NG++G+FP NYVK  + D
Sbjct: 124 CNGQIGMFPANYVKPVTKD 142

>Smik_6.232 Chr6 (380319..381044) [726 bp, 241 aa] {ON} YGR136W
           (REAL)
          Length = 241

 Score = 73.9 bits (180), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 69/123 (56%), Gaps = 17/123 (13%)

Query: 1   MSADRREAAIKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHKRRSPSASSYSNPTKG 60
           MSA     ++K+    IR  LE L ++  IS + +D I   L  K        +++ T+ 
Sbjct: 1   MSATLVNRSLKN----IRNELEFLRESNVISGDIFDLINSKLPEK--------WNDNTR- 47

Query: 61  ALSPRNG--PQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTN 118
             SP N    +YVEA+Y +  +Q GDL L  GD I+V+ K SP WY+G+ N +VG+FP N
Sbjct: 48  --SPNNADTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPAN 105

Query: 119 YVK 121
           YVK
Sbjct: 106 YVK 108

>CAGL0F04829g Chr6 (487684..488292) [609 bp, 202 aa] {ON} similar to
           uniprot|Q06449 Saccharomyces cerevisiae YPR154w
          Length = 202

 Score = 72.8 bits (177), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 41/115 (35%), Positives = 62/115 (53%), Gaps = 12/115 (10%)

Query: 7   EAAIKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHKRRSPSASSYSNPTKGALSPRN 66
           ++AI  +   IR  L+ L ++  ISE  + EI   L     SP            + P  
Sbjct: 3   QSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLPSNGASP------------VPPPM 50

Query: 67  GPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVK 121
             +YVEA+Y +  +Q GDL +  GD I+V+ K S +WY G +NG+ G+FP+NYV+
Sbjct: 51  SLEYVEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVR 105

>YGR136W Chr7 (762428..763153) [726 bp, 241 aa] {ON}  LSB1Protein
           containing an N-terminal SH3 domain; binds Las17p, which
           is a homolog of human Wiskott-Aldrich Syndrome protein
           involved in actin patch assembly and actin
           polymerization
          Length = 241

 Score = 72.0 bits (175), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 66/125 (52%), Gaps = 21/125 (16%)

Query: 1   MSADRREAAIKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHK----RRSPSASSYSN 56
           MSA     ++K+    IR  LE L ++  IS + ++ I   L  K    +RSP  +    
Sbjct: 1   MSASLVNRSLKN----IRNELEFLKESNVISGDIFELINSKLPEKWDGNQRSPQNA---- 52

Query: 57  PTKGALSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFP 116
                    +  +YVEA+Y +  +Q GDL L  GD I+V+ K SP WY G+ N K+G+FP
Sbjct: 53  ---------DTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFP 103

Query: 117 TNYVK 121
            NYVK
Sbjct: 104 ANYVK 108

>Ecym_1228 Chr1 complement(473518..474279) [762 bp, 253 aa] {ON}
           similar to Ashbya gossypii AFR320W
          Length = 253

 Score = 71.6 bits (174), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 65/112 (58%), Gaps = 9/112 (8%)

Query: 10  IKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHKRRSPSASSYSNPTKGALSPRNGPQ 69
           I  +   I+  LE L+++  IS++   +I  +L + R           T  A S +   +
Sbjct: 6   INRSLANIKTELEFLVESNVISQSQSQQILSMLSNPREG---------TMKAASQQVLKE 56

Query: 70  YVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVK 121
           YVEA+YA+  +Q GDLE   GD IEV+ K S  WY+G+ NG+VG+FP+NYVK
Sbjct: 57  YVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVK 108

>Suva_7.424 Chr7 (732619..733368) [750 bp, 249 aa] {ON} YGR136W
           (REAL)
          Length = 249

 Score = 68.9 bits (167), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 44/126 (34%), Positives = 68/126 (53%), Gaps = 23/126 (18%)

Query: 1   MSADRREAAIKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHK-----RRSPSASSYS 55
           MSA     ++K+    IR  L+ L +++ IS++ ++ I   L  K     R  P+AS   
Sbjct: 1   MSASLINRSLKN----IRNELDFLKESEVISDDIFNLINSKLPEKWDVNLRPVPNASVE- 55

Query: 56  NPTKGALSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVF 115
                        ++VEA+Y +  +Q+GDL L  GD I+++ K SP WY G+ N +VG+F
Sbjct: 56  -------------EFVEALYDFEPQQEGDLPLKTGDKIQILEKISPDWYRGKANNRVGIF 102

Query: 116 PTNYVK 121
           P NYVK
Sbjct: 103 PANYVK 108

>Skud_7.447 Chr7 (741615..742331) [717 bp, 238 aa] {ON} YGR136W
           (REAL)
          Length = 238

 Score = 65.9 bits (159), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 66/130 (50%), Gaps = 9/130 (6%)

Query: 10  IKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHKRRSPSASSYSNPTKGALSPRNGPQ 69
           I  +   IR  LE L ++  IS   +  I   L  K    S S+ +  T+         +
Sbjct: 6   INRSLNNIRNELEFLKESNVISGELFHFIDSNLPGKWDENSKSANNASTE---------E 56

Query: 70  YVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVKLYSSDDRD 129
           YVEA+Y +  +Q GDL L  GD I+++ K S  WY+G+ N  +G+FP NYVK   +    
Sbjct: 57  YVEALYDFEAQQDGDLSLKTGDKIQILEKISLDWYKGKANDMIGIFPANYVKPAFTRSTS 116

Query: 130 SNYQRTGIKT 139
            ++++T + +
Sbjct: 117 PDFEKTPLSS 126

>TPHA0O01280 Chr15 complement(252746..254110) [1365 bp, 454 aa] {ON}
           Anc_1.356 YFR024C-A
          Length = 454

 Score = 67.4 bits (163), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 57/99 (57%), Gaps = 9/99 (9%)

Query: 32  ENDYDEIQDILRHKRRSPSASSYSNPTKGALSPRN------GPQYVEAIYAWSGEQKGDL 85
           EN+ D++ +     R S + +S +   + + S  N      GP+ V A+Y +SGE+ GDL
Sbjct: 356 ENNVDDVSNRFSRARISSNNNSANRERRASRSSYNDGVSHAGPKAV-ALYTFSGEESGDL 414

Query: 86  ELCPGDIIEVITKKSPQ--WYEGRLNGKVGVFPTNYVKL 122
               GD+I ++ K   Q  W+ GR+NGK G+FP NYV+L
Sbjct: 415 SFKKGDVIAILKKSDSQDDWWTGRVNGKEGIFPANYVEL 453

>ZYRO0G20372g Chr7 (1680364..1680816) [453 bp, 150 aa] {ON} weakly
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 150

 Score = 62.8 bits (151), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 38/59 (64%)

Query: 69  QYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVKLYSSDD 127
           +YVE +Y +  + K DL + PGD +EV+ K S  WY+G+ NGK G+FP NYVK     D
Sbjct: 15  EYVEVLYEFKPQNKEDLHIKPGDKVEVVEKLSADWYKGKCNGKEGMFPANYVKPVGGGD 73

>AEL017W Chr5 (603303..603349,603451..604654) [1251 bp, 416 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR024C-A
           (LSB3) and YHR016C (YSC84); 1-intron
          Length = 416

 Score = 65.9 bits (159), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 52/82 (63%), Gaps = 5/82 (6%)

Query: 45  KRRSPSASSYSNPTKGALSPRNG--PQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQ 102
           +RR+P+  + + P  G+ S  +G  P+ V A+Y + GEQKGDL    GD+I ++ +   Q
Sbjct: 335 QRRAPARPTSAKPDFGSHSTSSGAIPKAV-ALYTFKGEQKGDLPFRKGDVIMILKRTESQ 393

Query: 103 --WYEGRLNGKVGVFPTNYVKL 122
             W+ GR+NG+ G+FP NYV L
Sbjct: 394 DDWWTGRINGQEGIFPANYVDL 415

>TDEL0D02240 Chr4 (431160..431206,431314..432568) [1302 bp, 433 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 433

 Score = 64.3 bits (155), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 45/68 (66%), Gaps = 3/68 (4%)

Query: 57  PTKGALSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQ--WYEGRLNGKVGV 114
           P  G+ S  N P+ V A+Y+++GE+ GDL    GD+I ++ K   Q  W+ GR+NG+ G+
Sbjct: 366 PDFGSPSSSNAPKAV-ALYSFAGEESGDLPFRKGDVITILKKSESQDDWWTGRVNGREGI 424

Query: 115 FPTNYVKL 122
           FP NYV+L
Sbjct: 425 FPANYVEL 432

>Kwal_55.21287 s55 complement(768495..769880) [1386 bp, 461 aa] {ON}
           YDR388W (RVS167) - 1:1 [contig 130] FULL
          Length = 461

 Score = 63.9 bits (154), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 35/78 (44%), Positives = 48/78 (61%), Gaps = 7/78 (8%)

Query: 48  SPSASSYSNPTKGALSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQ---WY 104
           SP AS+Y+ PT   LS    P+ V A+Y +  + +GDL    G IIEV+ +++P    W+
Sbjct: 386 SPYASTYTPPTTAPLS---APETVTALYDYQAQAEGDLTFPAGAIIEVV-ERTPDVNGWW 441

Query: 105 EGRLNGKVGVFPTNYVKL 122
            GR NG  GVFP NYV+L
Sbjct: 442 TGRYNGYQGVFPGNYVQL 459

>KNAG0C02040 Chr3 complement(397447..398841) [1395 bp, 464 aa] {ON}
           Anc_1.356 YFR024C-A
          Length = 464

 Score = 63.5 bits (153), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 36/95 (37%), Positives = 55/95 (57%), Gaps = 5/95 (5%)

Query: 33  NDYDEIQDILRHKRRSPSASS--YSNPTKGALSPR-NGPQYVEAIYAWSGEQKGDLELCP 89
           ND D++ +     R S +  S   +  TK + SP  +G     A+Y+++GE+ GDL    
Sbjct: 369 NDVDDLSNRFSKSRISSNGGSAGVNRSTKPSSSPSISGAPKAVALYSFTGEESGDLPFRK 428

Query: 90  GDIIEVITKKSPQ--WYEGRLNGKVGVFPTNYVKL 122
           GD+I V+ K   Q  W+ GR+NG+ G+FP NYV+L
Sbjct: 429 GDVITVLKKSDSQNDWWTGRVNGREGIFPANYVEL 463

>CAGL0I08965g Chr9 complement(869942..871255) [1314 bp, 437 aa] {ON}
           highly similar to uniprot|P43603 Saccharomyces
           cerevisiae YFR024ca or uniprot|P32793 Saccharomyces
           cerevisiae YHR016c YSC84
          Length = 437

 Score = 63.2 bits (152), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 55/100 (55%), Gaps = 8/100 (8%)

Query: 31  SENDYDEIQDILRHKRRSPSASS--YSNPTKGALSPR----NGPQYVEAIYAWSGEQKGD 84
           S  D D++ +     R SP A++   SN       PR    +G     A+Y+++GE+ GD
Sbjct: 337 SRRDVDDLSNRFSKSRISPGATNNGRSNSRPADEPPRRDASSGAPKAVALYSFAGEEAGD 396

Query: 85  LELCPGDIIEVITKKSPQ--WYEGRLNGKVGVFPTNYVKL 122
           L    GD+I +I K   Q  W+ G++NG+ G+FP NYV+L
Sbjct: 397 LSFRKGDVITIIKKSDSQNDWWTGKVNGREGIFPANYVEL 436

>KAFR0C04400 Chr3 (868668..868714,868802..870134) [1380 bp, 459 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 459

 Score = 62.4 bits (150), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 42/62 (67%), Gaps = 3/62 (4%)

Query: 63  SPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQ--WYEGRLNGKVGVFPTNYV 120
           S  N P+ V A+Y+++GE+ GDL    GD+I ++ K   Q  W+ GR+NG+ G+FP NYV
Sbjct: 398 SSSNAPKAV-ALYSFAGEESGDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYV 456

Query: 121 KL 122
           +L
Sbjct: 457 EL 458

>Kwal_0.371 s0 complement(179002..179655) [654 bp, 217 aa] {ON}
           YFR024C - Hypothetical ORF [contig 89] FULL
          Length = 217

 Score = 60.5 bits (145), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 44/72 (61%), Gaps = 3/72 (4%)

Query: 53  SYSNPTKGALSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQ--WYEGRLNG 110
           SY++  K   +    P+ V A+Y ++GEQ GDL    GD+I ++ K   Q  W+ GR NG
Sbjct: 146 SYADERKVRSTSSGAPKAV-ALYTFNGEQSGDLPFRKGDVITILKKSESQDDWWTGRNNG 204

Query: 111 KVGVFPTNYVKL 122
           + G+FP NYV+L
Sbjct: 205 QEGIFPANYVEL 216

>Ecym_2747 Chr2 complement(1449887..1451198,1451401..1451447) [1359
           bp, 452 aa] {ON} similar to Ashbya gossypii AEL017W
           1-intron
          Length = 452

 Score = 61.6 bits (148), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 39/61 (63%), Gaps = 2/61 (3%)

Query: 64  PRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQ--WYEGRLNGKVGVFPTNYVK 121
           P +G     A+Y + GEQ GDL    GD+I ++ K + Q  W+ GR+NG+ G+FP NYV+
Sbjct: 391 PSSGTPKAVALYTFKGEQDGDLPFRTGDVIAILKKSNSQDDWWTGRVNGQEGIFPANYVE 450

Query: 122 L 122
           L
Sbjct: 451 L 451

>Suva_15.199 Chr15 complement(345409..346735,346904..346950) [1374
           bp, 457 aa] {ON} YHR016C (REAL)
          Length = 457

 Score = 61.2 bits (147), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 2/56 (3%)

Query: 69  QYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQ--WYEGRLNGKVGVFPTNYVKL 122
           Q   A+Y ++GEQ GDL    GD+I ++ K   Q  W+ GR+NGK G+FP NYV++
Sbjct: 401 QTAVALYNFAGEQSGDLAFKKGDVITILKKSDSQNDWWTGRVNGKEGIFPANYVRV 456

>KLLA0A08360g Chr1 complement(739092..740316,740718..740764) [1272
           bp, 423 aa] {ON} similar to Saccharomyces cerevisiae
           YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 423

 Score = 61.2 bits (147), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 45/73 (61%), Gaps = 7/73 (9%)

Query: 52  SSYSNPTKGALSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQ--WYEGRLN 109
           SS ++P + + +P+       A+Y + GE+ GDL    GD+I +I K   Q  W+ GR+N
Sbjct: 355 SSANSPARNSGAPK-----AVALYTFKGEESGDLPFRKGDVISIIKKSESQDDWWTGRVN 409

Query: 110 GKVGVFPTNYVKL 122
           GK G+FP NYV+L
Sbjct: 410 GKEGIFPANYVEL 422

>KLTH0F15114g Chr6 complement(1238921..1240228) [1308 bp, 435 aa]
           {ON} some similarities with uniprot|P39743 Saccharomyces
           cerevisiae YDR388W RVS167 BAR adaptor protein subunit of
           a complex (Rvs161p-Rvs167p) that regulates actin
           endocytosis and viability following starvation or
           osmotic stress
          Length = 435

 Score = 61.2 bits (147), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 31/74 (41%), Positives = 44/74 (59%), Gaps = 2/74 (2%)

Query: 51  ASSYSNPTKGALSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVI--TKKSPQWYEGRL 108
           AS+Y+  T    +P + P+ V A+Y +  + +GDL    G IIEV+  T  +  W+ GR 
Sbjct: 360 ASAYTAYTPPTTAPASAPETVTALYDYQAQAEGDLTFPAGAIIEVVERTNDTNGWWTGRY 419

Query: 109 NGKVGVFPTNYVKL 122
           NG  GVFP NYV+L
Sbjct: 420 NGYQGVFPGNYVQL 433

>NCAS0B07250 Chr2 complement(1371597..1372875,1373026..1373072)
           [1326 bp, 441 aa] {ON} Anc_1.356 YFR024C-A
          Length = 441

 Score = 60.5 bits (145), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 37/52 (71%), Gaps = 2/52 (3%)

Query: 73  AIYAWSGEQKGDLELCPGDIIEVITKKSPQ--WYEGRLNGKVGVFPTNYVKL 122
           A+Y++SGE+ GDL    GD+I ++ K   Q  W+ GR+NG+ G+FP NYV+L
Sbjct: 389 ALYSFSGEESGDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYVEL 440

>Smik_8.81 Chr8 complement(117184..118543,118714..118760) [1407 bp,
           468 aa] {ON} YHR016C (REAL)
          Length = 468

 Score = 60.5 bits (145), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 35/52 (67%), Gaps = 2/52 (3%)

Query: 73  AIYAWSGEQKGDLELCPGDIIEVITKKSPQ--WYEGRLNGKVGVFPTNYVKL 122
           A+Y ++GEQ GDL    GD+I ++ K   Q  W+ GR NGK G+FP NYV++
Sbjct: 416 ALYNFAGEQSGDLAFKKGDVISILKKSDSQNDWWTGRANGKEGIFPANYVRV 467

>NCAS0A08990 Chr1 complement(1780800..1782036,1782134..1782201)
           [1305 bp, 434 aa] {ON} Anc_1.356 YFR024C-A
          Length = 434

 Score = 60.5 bits (145), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 36/52 (69%), Gaps = 2/52 (3%)

Query: 73  AIYAWSGEQKGDLELCPGDIIEVITKKSPQ--WYEGRLNGKVGVFPTNYVKL 122
           A+Y ++GEQKGDL    GD I ++ +   Q  W+ GR+NGK G+FP NYV+L
Sbjct: 382 ALYRFTGEQKGDLSFQKGDKITILKRTESQNDWWSGRVNGKEGIFPANYVEL 433

>TBLA0D04950 Chr4 complement(1216633..1218039) [1407 bp, 468 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 468

 Score = 60.1 bits (144), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 39/59 (66%), Gaps = 3/59 (5%)

Query: 66  NGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQ--WYEGRLNGKVGVFPTNYVKL 122
           N P+ V A+Y + GE++GDL    GDII +I K   Q  W+ GR NG+ G+FP NYV+L
Sbjct: 410 NLPKAV-ALYTFDGEERGDLSFRKGDIIVIIKKSESQDDWWSGRCNGEEGIFPANYVEL 467

>NDAI0G05960 Chr7 (1474282..1475553) [1272 bp, 423 aa] {ON}
           Anc_1.356
          Length = 423

 Score = 60.1 bits (144), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/54 (53%), Positives = 35/54 (64%), Gaps = 2/54 (3%)

Query: 71  VEAIYAWSGEQKGDLELCPGDIIEVITKKSPQ--WYEGRLNGKVGVFPTNYVKL 122
           V A+Y + GEQKGDL    GDII VI K   Q  W+ G+L  K G+FP NYV+L
Sbjct: 369 VVALYTFVGEQKGDLAFKKGDIITVIKKTKSQDDWWTGKLGNKEGIFPANYVEL 422

>Smik_7.335 Chr7 complement(563424..564759,564853..564899) [1383 bp,
           460 aa] {ON} YFR024C-A (REAL)
          Length = 460

 Score = 59.7 bits (143), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 43/71 (60%), Gaps = 6/71 (8%)

Query: 54  YSNPTKGALSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQ--WYEGRLNGK 111
           ++ PT    SP        A+Y+++GE+ GDL    GD+I ++ K   Q  W+ GR+NG+
Sbjct: 393 FTAPT----SPSTSSPKAVALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGR 448

Query: 112 VGVFPTNYVKL 122
            G+FP NYV+L
Sbjct: 449 EGIFPANYVEL 459

>YHR016C Chr8 complement(136881..138240,138409..138455) [1407 bp,
           468 aa] {ON}  YSC84Actin-binding protein involved in
           bundling of actin filaments and endocytosis of actin
           cortical patches; activity stimulated by Las17p;
           contains SH3 domain similar to Rvs167p
          Length = 468

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 45/85 (52%), Gaps = 8/85 (9%)

Query: 40  DILRHKRRSPSASSYSNPTKGALSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKK 99
           D L HK       + S  T  A      P  V A+Y ++GEQ GDL    GD+I ++ K 
Sbjct: 389 DDLSHKMSKTGLGNESTATNSAT-----PTAV-ALYNFAGEQPGDLAFKKGDVITILKKS 442

Query: 100 SPQ--WYEGRLNGKVGVFPTNYVKL 122
             Q  W+ GR NGK G+FP NYV++
Sbjct: 443 DSQNDWWTGRTNGKEGIFPANYVRV 467

>Skud_8.68 Chr8 complement(118475..119855,120025..120071) [1428 bp,
           475 aa] {ON} YHR016C (REAL)
          Length = 475

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 35/52 (67%), Gaps = 2/52 (3%)

Query: 73  AIYAWSGEQKGDLELCPGDIIEVITKKSPQ--WYEGRLNGKVGVFPTNYVKL 122
           A+Y ++GEQ GDL    GD I ++ K   Q  W+ GR+NGK G+FP NYV++
Sbjct: 423 ALYNFAGEQPGDLAFKKGDAISILKKSDSQNDWWTGRINGKEGIFPANYVRV 474

>SAKL0D09702g Chr4 complement(805912..807151,807326..807372) [1287
           bp, 428 aa] {ON} similar to Saccharomyces cerevisiae
           YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 428

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/80 (37%), Positives = 46/80 (57%), Gaps = 3/80 (3%)

Query: 46  RRSPSASSYSNPTKGALSP-RNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQ-- 102
           + +P+    S+P     SP  +G     A+Y + GEQ GDL    GD++ ++ K   Q  
Sbjct: 348 KTNPNNKGISSPPVSRRSPASSGAPKAVALYTFKGEQSGDLPFRKGDVVTILKKSDSQDD 407

Query: 103 WYEGRLNGKVGVFPTNYVKL 122
           W+ GR+NG+ G+FP NYV+L
Sbjct: 408 WWTGRVNGQEGIFPANYVEL 427

>YFR024C-A Chr6 complement(201960..203292,203387..203433) [1380 bp,
           459 aa] {ON}  LSB3Protein containing a C-terminal SH3
           domain; binds Las17p, which is a homolog of human
           Wiskott-Aldrich Syndrome protein involved in actin patch
           assembly and actin polymerization
          Length = 459

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 44/75 (58%), Gaps = 6/75 (8%)

Query: 50  SASSYSNPTKGALSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQ--WYEGR 107
           S   ++ PT    SP        A+Y+++GE+ GDL    GD+I ++ K   Q  W+ GR
Sbjct: 388 SQGRFTAPT----SPSTSSPKAVALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGR 443

Query: 108 LNGKVGVFPTNYVKL 122
           +NG+ G+FP NYV+L
Sbjct: 444 VNGREGIFPANYVEL 458

>TBLA0F03490 Chr6 (859156..859202,859415..860903) [1536 bp, 511 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 511

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 38/52 (73%), Gaps = 2/52 (3%)

Query: 73  AIYAWSGEQKGDLELCPGDIIEVITKKSPQ--WYEGRLNGKVGVFPTNYVKL 122
           A+Y+++GE++GDL    GD+I +I K   Q  W+ GR++G+ G+FP NYV+L
Sbjct: 459 ALYSFTGEERGDLSFRKGDVITIIKKSESQNDWWTGRVSGREGIFPANYVEL 510

>KLTH0H12980g Chr8 complement(1110123..1111259,1111344..1111406)
           [1200 bp, 399 aa] {ON} similar to Saccharomyces
           cerevisiae YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 399

 Score = 58.5 bits (140), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 41/69 (59%), Gaps = 2/69 (2%)

Query: 56  NPTKGALSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQ--WYEGRLNGKVG 113
           +P+  + +  +G     A+Y + GEQ GDL    GD+I ++ K   Q  W+ GR NG+ G
Sbjct: 330 SPSAHSRTASSGAPKAVALYTFKGEQSGDLPFRKGDVITILKKSESQDDWWTGRNNGQEG 389

Query: 114 VFPTNYVKL 122
           +FP NYV+L
Sbjct: 390 IFPANYVEL 398

>Suva_6.96 Chr6 complement(167266..168586,168693..168739) [1368 bp,
           455 aa] {ON} YFR024C-A (REAL)
          Length = 455

 Score = 58.2 bits (139), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 44/75 (58%), Gaps = 6/75 (8%)

Query: 50  SASSYSNPTKGALSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQ--WYEGR 107
           S   ++ PT    SP        A+++++GE+ GDL    GD++ ++ K   Q  W+ GR
Sbjct: 384 SQGRFAAPT----SPSTSSPKAVALFSFAGEESGDLPFRKGDVVTILKKSDSQNDWWTGR 439

Query: 108 LNGKVGVFPTNYVKL 122
           +NG+ G+FP NYV+L
Sbjct: 440 VNGREGIFPANYVEL 454

>NDAI0B04580 Chr2 complement(1138779..1140053) [1275 bp, 424 aa]
           {ON} Anc_1.356
          Length = 424

 Score = 58.2 bits (139), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 41/61 (67%), Gaps = 3/61 (4%)

Query: 64  PRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQ--WYEGRLNGKVGVFPTNYVK 121
           P + P+ V A+Y+++GE+  DL    GD+I ++ K   Q  W+ GR+NG+ G+FP NYV+
Sbjct: 364 PSSAPKAV-ALYSFAGEETDDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYVE 422

Query: 122 L 122
           L
Sbjct: 423 L 423

>ZYRO0G00792g Chr7 (61277..61323,61435..62797) [1410 bp, 469 aa]
           {ON} similar to Saccharomyces cerevisiae YFR024C-A LSB3
           or to YHR016C uniprot|P32793 Saccharomyces cerevisiae
           YHR016C YSC84
          Length = 469

 Score = 58.2 bits (139), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 41/70 (58%), Gaps = 7/70 (10%)

Query: 60  GALSPRNGPQYVE-----AIYAWSGEQKGDLELCPGDIIEVITKKSPQ--WYEGRLNGKV 112
           GA SP  G  +       A+Y +SGE+ GDL    GD+I ++ K   Q  W+ GR+ G+ 
Sbjct: 399 GAASPSAGDTFSNTPKAVALYTFSGEEYGDLPFRKGDVITILKKSDSQDDWWTGRVGGRE 458

Query: 113 GVFPTNYVKL 122
           G+FP NYV+L
Sbjct: 459 GIFPANYVEL 468

>Skud_6.108 Chr6 complement(197616..198948,199044..199090) [1380 bp,
           459 aa] {ON} YFR024C-A (REAL)
          Length = 459

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 43/75 (57%), Gaps = 6/75 (8%)

Query: 50  SASSYSNPTKGALSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQ--WYEGR 107
           S   ++ PT    SP        A+Y ++GE+ GDL    GD+I ++ K   Q  W+ GR
Sbjct: 388 SQGRFTAPT----SPSTSSPKAVALYTFAGEESGDLPFRKGDVITILKKSDSQNDWWTGR 443

Query: 108 LNGKVGVFPTNYVKL 122
           ++G+ G+FP NYV+L
Sbjct: 444 VSGREGIFPANYVEL 458

>SAKL0G03454g Chr7 (284017..285423) [1407 bp, 468 aa] {ON} some
           similarities with uniprot|P39743 Saccharomyces
           cerevisiae YDR388W RVS167 BAR adaptor protein subunit of
           a complex (Rvs161p-Rvs167p) that regulates actin
           endocytosis and viability following starvation or
           osmotic stress
          Length = 468

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 45/74 (60%), Gaps = 5/74 (6%)

Query: 51  ASSYSNPTKGALSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVI--TKKSPQWYEGRL 108
            S+Y+ PT G L P  G + V A+Y +  + +GDL    G IIEV+  T  +  W+ GR 
Sbjct: 395 GSTYTPPTTG-LQP--GVETVTALYDYQAQAEGDLTFPVGAIIEVVERTTDTNGWWTGRY 451

Query: 109 NGKVGVFPTNYVKL 122
           NG+ GVFP NYV++
Sbjct: 452 NGQQGVFPGNYVQI 465

>TPHA0A02210 Chr1 (455888..457081) [1194 bp, 397 aa] {ON} Anc_1.356
           YFR024C-A
          Length = 397

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 38/58 (65%), Gaps = 3/58 (5%)

Query: 67  GPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQ--WYEGRLNGKVGVFPTNYVKL 122
           GP+ + A++ + GEQ GDL    GD++ ++ K   Q  W+ GR+N + G+FP NYV+L
Sbjct: 340 GPKAI-ALFRFKGEQAGDLSFNKGDVVTILKKTDTQNDWWTGRVNNQEGIFPANYVEL 396

>Kpol_1008.25 s1008 complement(50905..52207,52597..52643) [1350 bp,
           449 aa] {ON} complement(50905..52207,52597..52643) [1350
           nt, 450 aa]
          Length = 449

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 45/81 (55%), Gaps = 7/81 (8%)

Query: 44  HKRRSPSASSYSNPTKGALSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQ- 102
           H R +    S+    + + +P+       A+Y+++GE+ GDL    GD+I ++ K   Q 
Sbjct: 373 HSRPAAEKPSFGGTRQSSSTPK-----AIALYSFAGEESGDLRFKKGDVITILKKSDSQD 427

Query: 103 -WYEGRLNGKVGVFPTNYVKL 122
            W+ GR+N   G+FP NYV+L
Sbjct: 428 DWWTGRVNTSEGIFPANYVEL 448

>TBLA0B09620 Chr2 complement(2277581..2280406) [2826 bp, 941 aa]
           {ON} Anc_2.319 YDL117W
          Length = 941

 Score = 56.2 bits (134), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 40/68 (58%), Gaps = 4/68 (5%)

Query: 58  TKGALSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRL--NGKV-GV 114
           T    +P   P  V+A Y WSG+ KGDL    GD++EV TK +  WY GRL  N K  G 
Sbjct: 2   TSLEFAPLAPPFKVKAKYGWSGQAKGDLGFLEGDVMEV-TKITGDWYYGRLLRNRKCSGY 60

Query: 115 FPTNYVKL 122
           FP N+VK+
Sbjct: 61  FPNNFVKI 68

>NCAS0A11920 Chr1 (2363750..2365141) [1392 bp, 463 aa] {ON}
           Anc_5.470
          Length = 463

 Score = 55.5 bits (132), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 44/69 (63%), Gaps = 6/69 (8%)

Query: 57  PTKGALSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSP---QWYEGRLNGKVG 113
           PT G+++   G + V A+Y +  +  GDL    G +IE++ +++P   +W+ GR NG+ G
Sbjct: 395 PTAGSMTA--GGETVTALYEYQAQAAGDLSFPAGAVIEIV-ERTPDVNEWWTGRYNGQQG 451

Query: 114 VFPTNYVKL 122
           VFP NYV+L
Sbjct: 452 VFPGNYVQL 460

>SAKL0E06820g Chr5 complement(556960..559677) [2718 bp, 905 aa] {ON}
           similar to uniprot|Q07533 Saccharomyces cerevisiae
           YDL117W CYK3 SH3-domain protein located in the
           mother-bud neck and the cytokinetic actin ring mutant
           phenotype and genetic interactions suggest a role in
           cytokinesis
          Length = 905

 Score = 55.1 bits (131), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 36/57 (63%), Gaps = 3/57 (5%)

Query: 68  PQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRL--NGKVGVFPTNYVKL 122
           P  V+AIY+WSGE++ DL     DIIEV TK    WY GRL  N K G FP NYV +
Sbjct: 9   PFKVKAIYSWSGEKEYDLGFIEEDIIEV-TKAKGGWYYGRLLRNKKSGSFPANYVTI 64

>Ecym_3366 Chr3 complement(695872..698592) [2721 bp, 906 aa] {ON}
           similar to Ashbya gossypii ADL288C
          Length = 906

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/59 (50%), Positives = 34/59 (57%), Gaps = 3/59 (5%)

Query: 66  NGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRL--NGKVGVFPTNYVKL 122
           N P  V A+Y+WSGEQ  DL     D+IEV TK    W  GRL  N K G FP  YV+L
Sbjct: 7   NTPFKVRALYSWSGEQGQDLGFLESDLIEV-TKVKGDWLYGRLLRNKKTGYFPLGYVQL 64

>KAFR0A00970 Chr1 (181162..182352) [1191 bp, 396 aa] {ON} Anc_1.356
           YFR024C-A
          Length = 396

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 35/52 (67%), Gaps = 2/52 (3%)

Query: 73  AIYAWSGEQKGDLELCPGDIIEVITKKSPQ--WYEGRLNGKVGVFPTNYVKL 122
           A+Y + G+++GDL    GDII ++ +   Q  W+ G LNGK G+FP NYV++
Sbjct: 344 ALYNFGGKEEGDLIFKRGDIIAIVKRSDSQYDWWTGNLNGKEGLFPANYVEI 395

>ADL288C Chr4 complement(194687..197464) [2778 bp, 925 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL117W
           (CYK3)
          Length = 925

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 35/58 (60%), Gaps = 3/58 (5%)

Query: 67  GPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRL--NGKVGVFPTNYVKL 122
            P  V+A+Y+WSGE + DL     DIIEV TK    W  GRL  N K G FP NYV++
Sbjct: 8   APFKVKAVYSWSGEHEQDLGFLESDIIEV-TKVKGNWLYGRLLRNKKSGYFPVNYVQV 64

>KAFR0E03640 Chr5 complement(731325..732650) [1326 bp, 441 aa] {ON}
           Anc_5.470 YDR388W
          Length = 441

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 67  GPQYVEAIYAWSGEQKGDLELCPGDIIEVI--TKKSPQWYEGRLNGKVGVFPTNYVKL 122
           G + V A+Y +  +  GDL    G +IE++  T    +W+ GR NG+ GVFP NYV+L
Sbjct: 382 GMETVTALYEYQAQAAGDLSFPAGAVIEIVQRTANENEWWTGRYNGQQGVFPGNYVQL 439

>TBLA0A02570 Chr1 complement(622892..624373) [1482 bp, 493 aa] {ON}
           Anc_5.470 YDR388W
          Length = 493

 Score = 53.5 bits (127), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 41/66 (62%), Gaps = 4/66 (6%)

Query: 64  PRNGPQY--VEAIYAWSGEQKGDLELCPGDIIEVITKKS--PQWYEGRLNGKVGVFPTNY 119
           P++ P +  V A+Y +  + +GDL    G +IE++ + +   +W+ G+ NG+ GVFP NY
Sbjct: 428 PQSAPAFETVTALYEYQAQAEGDLSFPAGAVIEIVQRTADINEWWTGKYNGQQGVFPGNY 487

Query: 120 VKLYSS 125
           VK+  S
Sbjct: 488 VKINKS 493

>NDAI0A04350 Chr1 complement(979014..980393) [1380 bp, 459 aa] {ON}
           Anc_5.470
          Length = 459

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 42/68 (61%), Gaps = 3/68 (4%)

Query: 57  PTKGALSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVI--TKKSPQWYEGRLNGKVGV 114
           PT G+++   G + V A+Y +  +  GDL    G +IE++  T  + +W+ G+ NG+ GV
Sbjct: 390 PTAGSMA-APGVETVTALYDYQAQAAGDLSFPAGAVIEIVERTSDANEWWTGKYNGQQGV 448

Query: 115 FPTNYVKL 122
           FP NYV++
Sbjct: 449 FPGNYVQV 456

>KLLA0E09043g Chr5 complement(807159..809603) [2445 bp, 814 aa] {ON}
           similar to uniprot|Q07533 Saccharomyces cerevisiae
           YDL117W CYK3 SH3-domain protein located in the
           mother-bud neck and the cytokinetic actin ring mutant
           phenotype and genetic interactions suggest a role in
           cytokinesis
          Length = 814

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 35/54 (64%), Gaps = 3/54 (5%)

Query: 71  VEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRL--NGKVGVFPTNYVKL 122
           V+  +AWSGE+K DL    GD IEV T+ +  WY G+L  N K G FP+NYV +
Sbjct: 11  VKTNFAWSGEKKDDLGFLEGDFIEV-TRVTGDWYFGKLIRNKKQGYFPSNYVSI 63

>Ecym_2316 Chr2 complement(619368..620633) [1266 bp, 421 aa] {ON}
           similar to Ashbya gossypii AFR140C
          Length = 421

 Score = 52.4 bits (124), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 43/74 (58%), Gaps = 3/74 (4%)

Query: 50  SASSYSNPTKGALSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKK-SPQWYEGRL 108
           S S Y+  T  + +P   P+   ++YA++ + K DL      +IE++ +  S  W+ GR 
Sbjct: 347 SPSPYTAYTTPSTAP--APETCTSLYAFAAQDKADLTFPANAVIEILDRADSSGWWTGRY 404

Query: 109 NGKVGVFPTNYVKL 122
           NG+ G+FP NYV+L
Sbjct: 405 NGQEGLFPGNYVRL 418

>Skud_4.661 Chr4 (1170843..1172225) [1383 bp, 460 aa] {ON} YDR388W
           (REAL)
          Length = 460

 Score = 52.4 bits (124), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 34/54 (62%), Gaps = 2/54 (3%)

Query: 71  VEAIYAWSGEQKGDLELCPGDIIEVI--TKKSPQWYEGRLNGKVGVFPTNYVKL 122
           V A+Y +  +  GDL    G +IE++  T  + +W+ GR NG+ GVFP NYV+L
Sbjct: 404 VSALYDYQAQAAGDLSFPAGAVIEIVQRTPDANEWWTGRYNGQQGVFPGNYVQL 457

>CAGL0M01650g Chr13 complement(184085..185485) [1401 bp, 466 aa]
           {ON} highly similar to uniprot|P39743 Saccharomyces
           cerevisiae YDR388w RVS167
          Length = 466

 Score = 52.0 bits (123), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 36/55 (65%), Gaps = 4/55 (7%)

Query: 71  VEAIYAWSGEQKGDLELCPGDIIEVITKKSP---QWYEGRLNGKVGVFPTNYVKL 122
           V A+Y +  +  GDL    G +IEV+ +++P   +W+ GR NG+ GVFP NYV+L
Sbjct: 412 VTALYDYQAQAAGDLSFPAGAVIEVV-QRTPDVNEWWTGRYNGQQGVFPGNYVQL 465

>YDR388W Chr4 (1250186..1251634) [1449 bp, 482 aa] {ON}
           RVS167Actin-associated protein with roles in endocytosis
           and exocytosis; interacts with Rvs161p to regulate actin
           cytoskeleton, endocytosis, and viability following
           starvation or osmotic stress; recruited to bud tips by
           Gyl1p and Gyp5p during polarized growth; homolog of
           mammalian amphiphysin
          Length = 482

 Score = 52.0 bits (123), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 36/55 (65%), Gaps = 4/55 (7%)

Query: 71  VEAIYAWSGEQKGDLELCPGDIIEVITKKSP---QWYEGRLNGKVGVFPTNYVKL 122
           V A+Y +  +  GDL    G +IE++ +++P   +W+ GR NG+ GVFP NYV+L
Sbjct: 426 VTALYDYQAQAAGDLSFPAGAVIEIV-QRTPDVNEWWTGRYNGQQGVFPGNYVQL 479

>KLTH0D06138g Chr4 (544661..546130) [1470 bp, 489 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002W HSE1
           Subunit of the endosomal Vps27p- Hse1p complex required
           for sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 489

 Score = 51.6 bits (122), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 40/69 (57%), Gaps = 4/69 (5%)

Query: 52  SSYSNPTKGALSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGK 111
           SS+ N ++     +N  + V A++  +G +  +L    GDII VI +    W+ GRL G+
Sbjct: 202 SSHHNESQT----QNTVRKVRALHDLTGRESDELSFRKGDIIVVIEQVYKDWWRGRLRGR 257

Query: 112 VGVFPTNYV 120
           VG+FP NYV
Sbjct: 258 VGIFPLNYV 266

>KNAG0C04630 Chr3 (908312..909862) [1551 bp, 516 aa] {ON} Anc_5.470
           YDR388W
          Length = 516

 Score = 51.6 bits (122), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 38/70 (54%), Gaps = 2/70 (2%)

Query: 55  SNPTKGALSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKS--PQWYEGRLNGKV 112
           + P  GA     G + V A+Y +  +  GDL    G  IE++ + +   +W+ GR NG+ 
Sbjct: 445 AQPGMGAAPMPTGVETVTALYDYQAQAAGDLSFPAGATIEIVQRTADVNEWWTGRYNGQQ 504

Query: 113 GVFPTNYVKL 122
           GVFP NYV+ 
Sbjct: 505 GVFPGNYVQF 514

>Smik_4.658 Chr4 (1170707..1172125) [1419 bp, 472 aa] {ON} YDR388W
           (REAL)
          Length = 472

 Score = 51.6 bits (122), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 36/55 (65%), Gaps = 4/55 (7%)

Query: 71  VEAIYAWSGEQKGDLELCPGDIIEVITKKSP---QWYEGRLNGKVGVFPTNYVKL 122
           V A+Y +  +  GDL    G +IE++ +++P   +W+ GR NG+ GVFP NYV+L
Sbjct: 416 VTALYDYQAQAAGDLSFPAGAVIEIV-QRTPDVNEWWTGRYNGQQGVFPGNYVQL 469

>Skud_4.137 Chr4 (244217..246880) [2664 bp, 887 aa] {ON} YDL117W
           (REAL)
          Length = 887

 Score = 51.6 bits (122), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 50/96 (52%), Gaps = 22/96 (22%)

Query: 68  PQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRL--NGKV-GVFPTNYVKLY- 123
           P  V+A Y WSG+ KGDL    GDI+EV T+ +  W+ GRL  N K  G FP N+V L  
Sbjct: 11  PFKVKARYGWSGQTKGDLGFLEGDIMEV-TRIAGSWFYGRLLRNKKCSGYFPHNFVILLE 69

Query: 124 --------SSDDRDSNYQRTGIKT--------PVPT 143
                   S  DR S+ + TGI+         PVP+
Sbjct: 70  ERLNSKSVSESDRQSS-KTTGIQEQSDKIVIPPVPS 104

>Smik_4.119 Chr4 (225256..227919) [2664 bp, 887 aa] {ON} YDL117W
           (REAL)
          Length = 887

 Score = 51.6 bits (122), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 36/59 (61%), Gaps = 4/59 (6%)

Query: 67  GPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRL--NGKV-GVFPTNYVKL 122
            P  V+A Y WSG+ KGDL    GDI+EV T+ +  W+ GRL  N K  G FP N+V L
Sbjct: 10  APFKVKARYGWSGQTKGDLGFLEGDIMEV-TRIAGSWFYGRLLRNKKCSGYFPHNFVIL 67

>ZYRO0D11110g Chr4 (939064..940443) [1380 bp, 459 aa] {ON} similar
           to DEHA0G12903g and some similarites with YDR388W
           uniprot|P39743 Saccharomyces cerevisiae YDR388W RVS167
           BAR adaptor protein subunit of a complex (Rvs161p-
           Rvs167p) that regulates actin endocytosis and viability
           following starvation or osmotic stress
          Length = 459

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 35/54 (64%), Gaps = 2/54 (3%)

Query: 71  VEAIYAWSGEQKGDLELCPGDIIEVI--TKKSPQWYEGRLNGKVGVFPTNYVKL 122
           V A+Y +  +  GDL      +IE++  T+ + +W+ GR +G+VGVFP NYV+L
Sbjct: 403 VTALYDYQAQAPGDLSFPANAVIEIVQRTQDTNEWWTGRYHGQVGVFPGNYVQL 456

>Suva_4.129 Chr4 (237039..239702) [2664 bp, 887 aa] {ON} YDL117W
           (REAL)
          Length = 887

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 36/58 (62%), Gaps = 4/58 (6%)

Query: 68  PQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRL--NGKV-GVFPTNYVKL 122
           P  V+A Y WSG+ KGDL    GDI+EV T+ +  W+ GRL  N K  G FP N+V L
Sbjct: 11  PFKVKARYGWSGQTKGDLGFLEGDIMEV-TRIAGSWFYGRLLRNKKCSGYFPHNFVIL 67

>NDAI0B03330 Chr2 (848506..851265) [2760 bp, 919 aa] {ON} Anc_2.319
           YDL117W
          Length = 919

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 35/58 (60%), Gaps = 4/58 (6%)

Query: 68  PQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRL--NGK-VGVFPTNYVKL 122
           P  V A Y WSG+ KGDL    GDI+EV T+ +  W+ G+L  N K  G FP N+V L
Sbjct: 12  PFKVRAKYGWSGQAKGDLGFLEGDIMEV-TRVAGDWFYGKLLRNRKCAGYFPNNFVTL 68

>KAFR0A06870 Chr1 complement(1387865..1390429) [2565 bp, 854 aa]
           {ON} Anc_2.319 YDL117W
          Length = 854

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 36/58 (62%), Gaps = 4/58 (6%)

Query: 68  PQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRL--NGK-VGVFPTNYVKL 122
           P  V+A YAWSGE K DL    GDI+EV T+ +  WY G+L  N K  G FP N+V +
Sbjct: 10  PFNVKAKYAWSGESKSDLGFLEGDIMEV-TRVTGDWYFGKLLRNRKCTGYFPNNFVTV 66

>TDEL0A03340 Chr1 (592752..594173) [1422 bp, 473 aa] {ON} Anc_5.470
           YDR388W
          Length = 473

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 33/54 (61%), Gaps = 2/54 (3%)

Query: 71  VEAIYAWSGEQKGDLELCPGDIIEVI--TKKSPQWYEGRLNGKVGVFPTNYVKL 122
           V A+Y +  +  GDL    G +IEV+  T    +W+ GR NG+ GVFP NYV++
Sbjct: 417 VTALYDYQAQAPGDLSFTAGAVIEVVQRTDDPNEWWTGRYNGQQGVFPGNYVQV 470

>AFR140C Chr6 complement(692042..693208) [1167 bp, 388 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR388W
           (RVS167)
          Length = 388

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 41/75 (54%), Gaps = 5/75 (6%)

Query: 53  SYSNPTKGALSPR----NGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKK-SPQWYEGR 107
           +YS P+ G+ S        P+   A+Y ++ +  GDL      IIE++ +  +  W+ GR
Sbjct: 312 AYSEPSYGSSSASPATTAAPETCIALYDFAAQADGDLSFPVNAIIEILDRSDAAGWWTGR 371

Query: 108 LNGKVGVFPTNYVKL 122
            NG+ G+FP NYV L
Sbjct: 372 YNGREGLFPANYVAL 386

>Ecym_2440 Chr2 (858070..859449) [1380 bp, 459 aa] {ON} similar to
           Ashbya gossypii ABR008C
          Length = 459

 Score = 50.8 bits (120), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 30/50 (60%)

Query: 71  VEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYV 120
           V A+Y+ +  +  +L    GD+I VI +    W+ G L GKVG+FP NYV
Sbjct: 231 VRAMYSLNASESDELSFVKGDVITVIEQVYKDWWRGTLRGKVGIFPLNYV 280

>TBLA0B05470 Chr2 complement(1301018..1302637) [1620 bp, 539 aa]
           {ON} Anc_2.502 YHL002W
          Length = 539

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 30/50 (60%)

Query: 71  VEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYV 120
           V A+Y  +  + G+L    GDII+VI +    W+ G L G VG+FP NYV
Sbjct: 245 VRAMYDLTASEPGELSFKKGDIIKVIEQVYRDWWRGSLRGTVGIFPLNYV 294

>NCAS0B06020 Chr2 (1138359..1140953) [2595 bp, 864 aa] {ON}
           Anc_2.319 YDL117W
          Length = 864

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 34/56 (60%), Gaps = 4/56 (7%)

Query: 68  PQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRL--NGK-VGVFPTNYV 120
           P  V A Y WSG+ KGDL    GDI+EV T+ +  W+ GRL  N K  G FP N+V
Sbjct: 10  PFKVRARYGWSGQTKGDLGFLEGDIMEV-TRVAGDWFYGRLLRNKKCAGYFPNNFV 64

>ZYRO0A02662g Chr1 (213322..215982) [2661 bp, 886 aa] {ON} similar
           to uniprot|Q07533 Saccharomyces cerevisiae YDL117W CYK3
           SH3-domain protein located in the mother-bud neck and
           the cytokinetic actin ring mutant phenotype and genetic
           interactions suggest a role in cytokinesis
          Length = 886

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 36/58 (62%), Gaps = 4/58 (6%)

Query: 68  PQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRL--NGKV-GVFPTNYVKL 122
           P  V+A Y WSG+ KGDL    GD++EV T+ +  W+ GRL  N K  G FP N+V +
Sbjct: 11  PFKVKARYGWSGQTKGDLGFLEGDVMEV-TRITGDWFYGRLLRNKKCSGYFPNNFVNI 67

>Kwal_23.3416 s23 (280746..283397) [2652 bp, 883 aa] {ON} YDL117W
           (CYK3) - may be involved in cytokinesis [contig 252]
           FULL
          Length = 883

 Score = 50.1 bits (118), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 37/65 (56%), Gaps = 7/65 (10%)

Query: 61  ALSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRL---NGKVGVFPT 117
           AL P   P  V+A Y+WSGE K DL     DII+V TK    W+ G L   + K G FPT
Sbjct: 5   ALQP---PFKVKAHYSWSGETKNDLGFIENDIIQV-TKTKGDWFYGTLLRNSKKYGYFPT 60

Query: 118 NYVKL 122
           N+V +
Sbjct: 61  NFVTI 65

>Kpol_440.10 s440 (25697..27109) [1413 bp, 470 aa] {ON}
           (25697..27109) [1413 nt, 471 aa]
          Length = 470

 Score = 49.7 bits (117), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 39/80 (48%), Gaps = 2/80 (2%)

Query: 45  KRRSPSASSYSNPTKGALSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVI--TKKSPQ 102
           K   P A     P   A S     +   ++Y +  +  GDL    G +IE++  T    +
Sbjct: 389 KSSVPPAQPVQAPGPPAYSAAPQAETCTSLYEYQAQAAGDLSFPAGVLIEIVERTANVNE 448

Query: 103 WYEGRLNGKVGVFPTNYVKL 122
           W+ GR NG+ GVFP NYV++
Sbjct: 449 WWTGRYNGQQGVFPGNYVQM 468

>YDL117W Chr4 (248581..251238) [2658 bp, 885 aa] {ON}
           CYK3SH3-domain protein located in the mother-bud neck
           and the cytokinetic actin ring; mutant phenotype and
           genetic interactions suggest a role in cytokinesis
          Length = 885

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 4/58 (6%)

Query: 68  PQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRL--NGKV-GVFPTNYVKL 122
           P  V+A Y WSG+ KGDL    GDI+EV T+ +  W+ G+L  N K  G FP N+V L
Sbjct: 11  PFKVKARYGWSGQTKGDLGFLEGDIMEV-TRIAGSWFYGKLLRNKKCSGYFPHNFVIL 67

>TDEL0G02490 Chr7 (478524..481076) [2553 bp, 850 aa] {ON} Anc_2.319
           YDL117W
          Length = 850

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 37/62 (59%), Gaps = 4/62 (6%)

Query: 64  PRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRL--NGKV-GVFPTNYV 120
           P   P  V+A Y WSG+ KGDL    GD++EV T+ +  W+ G+L  N K  G FP N+V
Sbjct: 6   PLAPPFKVKARYGWSGQTKGDLGFLEGDVMEV-TRITGDWFYGKLLRNKKCSGYFPNNFV 64

Query: 121 KL 122
            +
Sbjct: 65  NV 66

>KNAG0A05490 Chr1 (812680..815328) [2649 bp, 882 aa] {ON} Anc_2.319
           YDL117W
          Length = 882

 Score = 49.3 bits (116), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 38/63 (60%), Gaps = 7/63 (11%)

Query: 61  ALSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRL--NGK-VGVFPT 117
           AL P   P  V+A Y WSG+ K DL    GDI+EV T+ S +WY G+L  N K  G FP 
Sbjct: 8   ALLP---PFKVKARYGWSGQSKRDLGFLEGDIMEV-TRVSGEWYYGKLLRNRKCAGYFPN 63

Query: 118 NYV 120
           N+V
Sbjct: 64  NFV 66

>Kpol_534.6 s534 (20451..23111) [2661 bp, 886 aa] {ON}
           (20451..23111) [2661 nt, 887 aa]
          Length = 886

 Score = 48.9 bits (115), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 36/64 (56%), Gaps = 4/64 (6%)

Query: 62  LSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRL--NGKV-GVFPTN 118
           +S  N P  V A Y WSG+ KGDL    GD++EV  K +  W+ G L  N K  G FP N
Sbjct: 1   MSQINPPFKVRARYGWSGQTKGDLGFLEGDVMEV-KKITGDWFYGTLLRNKKCSGYFPKN 59

Query: 119 YVKL 122
           +V L
Sbjct: 60  FVNL 63

>ABR008C Chr2 complement(406780..408111) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHL002W
          Length = 443

 Score = 48.5 bits (114), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 53/101 (52%), Gaps = 7/101 (6%)

Query: 24  LIDTKEISENDYDEIQDILRHKR-RSPSASSYSNPTKGALSPRNGPQYV---EAIYAWSG 79
           L +  ++S  +Y++ Q   RH   + P  +  +  ++ +L  +  PQ V   +AI+  + 
Sbjct: 167 LEEALKLSLQEYEQQQ---RHNGGQPPQQAPAALASETSLPEQPQPQIVRRVKAIFDLNA 223

Query: 80  EQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYV 120
            +  +L    GD+I VI +    W+ G L GKVG+FP NYV
Sbjct: 224 SEPDELSFKKGDVITVIEQVYKDWWRGLLRGKVGIFPVNYV 264

>TPHA0C04020 Chr3 complement(861629..863086) [1458 bp, 485 aa] {ON}
           Anc_2.502 YHL002W
          Length = 485

 Score = 48.5 bits (114), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 31/50 (62%)

Query: 71  VEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYV 120
           V A+Y    +++ +L    GD+I V+ +    W+ G L+GK+G+FP NYV
Sbjct: 234 VRAMYELISQEENELSFRKGDVITVLEQVYRDWWRGTLHGKIGIFPLNYV 283

>KLLA0E03059g Chr5 (281543..282829) [1287 bp, 428 aa] {ON} similar
           to uniprot|P39743 Saccharomyces cerevisiae YDR388W
           RVS167 BAR adaptor protein subunit of a complex
           (Rvs161p-Rvs167p) that regulates actin endocytosis and
           viability following starvation or osmotic stress
          Length = 428

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 42/76 (55%), Gaps = 7/76 (9%)

Query: 48  SPSASSYSNPTKGALSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKK-SPQWYEG 106
           + + +SY+ PT        G +   A+Y ++ + +GDL    G II+V+ +  +  W+ G
Sbjct: 356 TATQASYTPPTSA------GVETCTALYDYTAQAEGDLTFPAGAIIQVVDRSDAAGWWVG 409

Query: 107 RLNGKVGVFPTNYVKL 122
             NG  GVFP NYV+L
Sbjct: 410 VYNGVQGVFPGNYVEL 425

>TDEL0A02780 Chr1 (504696..506051) [1356 bp, 451 aa] {ON} Anc_2.502
           YHL002W
          Length = 451

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 30/50 (60%)

Query: 71  VEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYV 120
           V A+Y  S E+  +L    GD+I V+ +    W+ G L GKVG+FP NYV
Sbjct: 228 VRAMYDLSSEEPDELSFRKGDVIVVLEQVYRDWWRGTLCGKVGIFPLNYV 277

>CAGL0H10516g Chr8 complement(1024427..1027069) [2643 bp, 880 aa]
           {ON} similar to uniprot|Q07533 Saccharomyces cerevisiae
           YDL117w CYK3
          Length = 880

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 36/58 (62%), Gaps = 4/58 (6%)

Query: 68  PQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRL--NGK-VGVFPTNYVKL 122
           P  V+A Y WSG+ K DL    GD++EV ++ + +WY GRL  N K  G FP N+V +
Sbjct: 7   PFKVKARYGWSGQAKEDLGFLEGDVMEV-SRVAGEWYYGRLLRNKKCAGYFPNNFVTI 63

>KLTH0F09240g Chr6 (799558..802224) [2667 bp, 888 aa] {ON} similar
           to uniprot|Q07533 Saccharomyces cerevisiae YDL117W CYK3
           SH3-domain protein located in the mother-bud neck and
           the cytokinetic actin ring mutant phenotype and genetic
           interactions suggest a role in cytokinesis
          Length = 888

 Score = 48.1 bits (113), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 34/58 (58%), Gaps = 4/58 (6%)

Query: 68  PQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRL---NGKVGVFPTNYVKL 122
           P  V+A Y+WSGE K DL     D+I+V TK    W+ G L   + K G FPTN+V +
Sbjct: 9   PFKVKAHYSWSGETKNDLGFLENDVIQV-TKIKGNWFYGTLLRNSKKYGYFPTNFVTI 65

>TPHA0E01500 Chr5 complement(304130..305503) [1374 bp, 457 aa] {ON}
           Anc_5.470 YDR388W
          Length = 457

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 36/64 (56%), Gaps = 2/64 (3%)

Query: 61  ALSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKS--PQWYEGRLNGKVGVFPTN 118
           A +     +Y  ++Y +  + +GDL    G +I+++ + +    W+ G  NG+ GVFP N
Sbjct: 392 AYTTAQAGEYCTSLYEYQAQAQGDLSFPAGAVIQIVQRSADVNDWWTGVYNGQQGVFPGN 451

Query: 119 YVKL 122
           YV+L
Sbjct: 452 YVQL 455

>Smik_8.47 Chr8 (81503..82846) [1344 bp, 447 aa] {ON} YHL002W (REAL)
          Length = 447

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 42/81 (51%), Gaps = 8/81 (9%)

Query: 40  DILRHKRRSPSASSYSNPTKGALSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKK 99
           ++L  +R  PSA + S  T          + V A+Y  +  +  +L    GD+I V+ + 
Sbjct: 194 EVLPQQRNQPSAHTTSRQTVV--------KKVRALYDLATNESEELSFRKGDVIIVLEQV 245

Query: 100 SPQWYEGRLNGKVGVFPTNYV 120
              W++G L GK+G+FP NYV
Sbjct: 246 YRDWWKGALRGKMGIFPLNYV 266

>CAGL0K02761g Chr11 (249893..251245) [1353 bp, 450 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002w
          Length = 450

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 34/55 (61%)

Query: 66  NGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYV 120
           +G + V A+Y  +  ++ +L    GD+I V+ +    W+ G L+GK+G+FP NYV
Sbjct: 212 SGIRRVRALYDLNANEQDELSFRKGDVIVVLEQVYRDWWRGSLHGKIGIFPLNYV 266

>KNAG0I01580 Chr9 (306534..306580,306733..308431) [1746 bp, 581 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 581

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 73  AIYAWSGEQKGDLELCPGDIIEVITKKSPQ--WYEGRLNGKVGVFPTNYVK 121
           A++ + G + GDL    GD+I +I +   Q  W+ GR+N + G+FP NYV+
Sbjct: 529 ALFDFGGAEPGDLTFKKGDVITIIKRSQSQNDWWLGRINEREGLFPANYVE 579

>TPHA0G00930 Chr7 (179525..181999) [2475 bp, 824 aa] {ON} Anc_2.319
           YDL117W
          Length = 824

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/53 (50%), Positives = 32/53 (60%), Gaps = 4/53 (7%)

Query: 71  VEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRL--NGKV-GVFPTNYV 120
           V+A Y WSG+ KGDL    GDI+ V TK +  WY G L  N K  G FP N+V
Sbjct: 7   VKARYGWSGQAKGDLGFLEGDIMNV-TKTTGDWYYGFLLRNKKSKGYFPKNFV 58

>ZYRO0B01298g Chr2 (110004..111239) [1236 bp, 411 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002W HSE1
           Subunit of the endosomal Vps27p-Hse1p complex required
           for sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 411

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%)

Query: 68  PQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYV 120
           P+ V+A+Y  +  +  +L    GDII V+ +    W+ G L G +G+FP NYV
Sbjct: 229 PKRVKALYDLASNEPDELAFKKGDIIVVLEQVYRDWWRGSLRGSIGIFPLNYV 281

>Kpol_1056.37 s1056 (92852..94357) [1506 bp, 501 aa] {ON}
           (92852..94357) [1506 nt, 502 aa]
          Length = 501

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 29/50 (58%)

Query: 71  VEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYV 120
           V A+Y  S  +  +L    GDII V+ +    W++G L G +G+FP NYV
Sbjct: 240 VRAMYDLSSNEPDELSFKKGDIITVLEQVYRDWWKGTLRGNIGIFPLNYV 289

>KAFR0D03360 Chr4 complement(658469..659836) [1368 bp, 455 aa] {ON}
           Anc_2.502 YHL002W
          Length = 455

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 31/54 (57%)

Query: 67  GPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYV 120
           G + V A+Y +   +  +L    GDII V+ +    W+ G L G++G+FP NYV
Sbjct: 212 GVKKVRAMYDFPSTEADELSFKKGDIIIVLEQVYRDWWRGSLRGRIGIFPLNYV 265

>NCAS0A05080 Chr1 (1011572..1012924) [1353 bp, 450 aa] {ON}
           Anc_2.502
          Length = 450

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%)

Query: 71  VEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYV 120
           V A+Y  S  +  +L    GD+I V+ +    W+ G L G  G+FP NYV
Sbjct: 220 VRALYDLSSPEADELSFVKGDVITVLEQVYKDWWRGTLRGNTGIFPLNYV 269

>Suva_8.51 Chr8 (98991..100361) [1371 bp, 456 aa] {ON} YHL002W
           (REAL)
          Length = 456

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 30/50 (60%)

Query: 71  VEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYV 120
           V A+Y  S  +  +L    GD+I V+ +    W++G L G++G+FP NYV
Sbjct: 226 VRAMYDLSTNEPDELSFRKGDVITVLEQVYRDWWKGALRGRMGIFPLNYV 275

>Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W
           (HSE1) - Hypothetical ORF [contig 55] FULL
          Length = 532

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 54/111 (48%), Gaps = 12/111 (10%)

Query: 22  ELLIDTKEISENDYDEIQ--DILRHKRRSPSASSYSNPTKGALSPRN-------GP---Q 69
           EL+ +TK   E + +E     IL +++ S   ++ +N    +   ++       GP   +
Sbjct: 168 ELVRETKRNEEQELEEALKLSILEYEKSSAQPTASNNGADASEESKSERPSTNPGPPVVR 227

Query: 70  YVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYV 120
            V A++   G    +L    GD+I V+ +    W+ G L GK+G+FP NYV
Sbjct: 228 KVRALHDLVGRGSDELSFRKGDVIRVMEQVYRDWWRGSLRGKIGIFPLNYV 278

>Kwal_47.17894 s47 (597826..599691) [1866 bp, 621 aa] {ON} YHR114W
           (BZZ1) - Myo3/5p-Bee1p-Vrp1p actin assembly complex
           component [contig 204] FULL
          Length = 621

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 35/61 (57%), Gaps = 3/61 (4%)

Query: 64  PRNG--PQYVEAIYAWSGEQKGDLELCPGDIIEVI-TKKSPQWYEGRLNGKVGVFPTNYV 120
           PR G   + VEA+Y++  + + +  L  GD+I V+       W  G +NG+ G+FPT+Y 
Sbjct: 561 PRKGGATRTVEAVYSYQAQGEDETSLTEGDVITVLKADDGSGWTYGEVNGEKGLFPTSYC 620

Query: 121 K 121
           K
Sbjct: 621 K 621

>SAKL0E02200g Chr5 complement(171315..172850) [1536 bp, 511 aa] {ON}
           similar to uniprot|P38753 Saccharomyces cerevisiae
           YHL002W HSE1 Subunit of the endosomal Vps27p-Hse1p
           complex required for sorting of ubiquitinated membrane
           proteins into intralumenal vesicles prior to vacuolar
           degradation as well as for recycling of Golgi proteins
           and formation of lumenal membranes
          Length = 511

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%)

Query: 71  VEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYV 120
           V A+Y  +  +  +L    GD+I V+ +    W+ G + G+VG+FP NYV
Sbjct: 233 VRAMYDLTATESDELSFKKGDVITVVEQVYRDWWRGNIRGRVGIFPLNYV 282

>KLLA0B13475g Chr2 complement(1178856..1180382) [1527 bp, 508 aa]
           {ON} similar to uniprot|P38753 Saccharomyces cerevisiae
           YHL002W HSE1 Subunit of the endosomal Vps27p-Hse1p
           complex required for sorting of ubiquitinated membrane
           proteins into intralumenal vesicles prior to vacuolar
           degradation, as well as for recycling of Golgi proteins
           and formation of lumenal membranes
          Length = 508

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 30/50 (60%)

Query: 71  VEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYV 120
           V A+Y ++  ++ +L    GD+I V+ +    W+ G L G VG+FP NYV
Sbjct: 227 VRAMYDFNSTEQDELSFKKGDLICVVEQVYRDWWRGTLAGSVGIFPLNYV 276

>NDAI0K02130 Chr11 (481352..482731) [1380 bp, 459 aa] {ON} Anc_2.502
          Length = 459

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%)

Query: 71  VEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYV 120
           V A+Y  +G    +L    GD+I V+ +    W++G+L  + G+FP NYV
Sbjct: 233 VRALYDLAGSGSDELSFKKGDVIMVLEQVYKDWWKGKLRDQTGIFPLNYV 282

>Suva_2.564 Chr2 (1002523..1002651) [129 bp, 43 aa] {ON} YDR388W
           (REAL)
          Length = 43

 Score = 39.7 bits (91), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 17/35 (48%), Positives = 25/35 (71%), Gaps = 2/35 (5%)

Query: 90  GDIIEVI--TKKSPQWYEGRLNGKVGVFPTNYVKL 122
           G +IE++  T  + +W+ GR NG+ GVFP NYV+L
Sbjct: 6   GAVIEIVQRTPDANEWWTGRYNGQQGVFPGNYVQL 40

>CAGL0A02145g Chr1 (224026..224036,225280..226444) [1176 bp, 391 aa]
           {ON} similar to uniprot|P32793 Saccharomyces cerevisiae
           YHR016c YSC84 and similar to uniprot|P43603
           Saccharomyces cerevisiae YFR024C-A LSB3
          Length = 391

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 33/53 (62%), Gaps = 4/53 (7%)

Query: 71  VEAIYAWSGEQKGDLELCPGDIIEVITKKSPQ---WYEGRLNGKVGVFPTNYV 120
           V A+Y ++G+Q+GDL     DII V+ KK+     W+ G  +G  GVFP NYV
Sbjct: 337 VRALYDFNGQQQGDLSFKKDDII-VVQKKTDSHNDWWYGVAHGVEGVFPANYV 388

>YHL002W Chr8 (102612..103970) [1359 bp, 452 aa] {ON}  HSE1Subunit
           of the endosomal Vps27p-Hse1p complex required for
           sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation, as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 452

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%)

Query: 71  VEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYV 120
           V A+Y  +  +  +L    GD+I V+ +    W++G L G +G+FP NYV
Sbjct: 222 VRALYDLTTNEPDELSFRKGDVITVLEQVYRDWWKGALRGNMGIFPLNYV 271

>Skud_8.43 Chr8 (84125..85489) [1365 bp, 454 aa] {ON} YHL002W (REAL)
          Length = 454

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%)

Query: 71  VEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYV 120
           V A+Y  S  +  +L     D+I V+ +    W++G L GK+G+FP NYV
Sbjct: 225 VRALYDLSTNEPDELSFRKDDVIIVLEQVYRDWWKGALRGKMGIFPLNYV 274

>ACR266W Chr3 (838689..840569) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR114W (BZZ1)
          Length = 626

 Score = 42.4 bits (98), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 4/71 (5%)

Query: 53  SYSNPTKGALSPRNGP---QYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQ-WYEGRL 108
           S   P   A  PR G    + V AIY +S +   ++ +  GD+I+V+   +   W  G +
Sbjct: 554 SIGKPVPRAPPPRKGAAPLKTVTAIYDYSAQDDDEISIRAGDVIKVLRGDTGNGWTYGEV 613

Query: 109 NGKVGVFPTNY 119
           NG  G+FP+NY
Sbjct: 614 NGSKGLFPSNY 624

>YHR114W Chr8 (338083..339984) [1902 bp, 633 aa] {ON}  BZZ1SH3
           domain protein implicated in the regulation of actin
           polymerization, able to recruit actin polymerization
           machinery through its SH3 domains, colocalizes with
           cortical actin patches and Las17p, interacts with type I
           myosins
          Length = 633

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 71  VEAIYAWSGEQKGDLELCPGDIIEVIT-KKSPQWYEGRLNGKVGVFPTNYVK 121
           +EAIYA+  +   ++ + PGDII VI       W  G  +G  G+FPT+Y K
Sbjct: 582 MEAIYAYEAQGDDEISIDPGDIITVIRGDDGSGWTYGECDGLKGLFPTSYCK 633

>KLTH0E09790g Chr5 (881284..883152) [1869 bp, 622 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 622

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 66  NGPQYVEAIYAWSGEQKGDLELCPGDIIEVI-TKKSPQWYEGRLNGKVGVFPTNYVK 121
           N  + V+A++ +  +   ++ +  GD+I V+       W  G LNG+ G+FPTNY +
Sbjct: 566 NAARTVKALFDYEAQGDDEISIRQGDLISVLKADDGSGWTYGELNGQKGLFPTNYCQ 622

>KNAG0A06710 Chr1 complement(1045213..1046472) [1260 bp, 419 aa]
           {ON} Anc_2.502 YHL002W
          Length = 419

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 35/79 (44%), Gaps = 8/79 (10%)

Query: 50  SASSYSNPTKGALSPR--------NGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSP 101
           S  SY+N  + A  P         N  + V A+Y        +L     DII VI +   
Sbjct: 190 SKGSYTNLEQRANQPEVTKRETGTNTIKKVRAMYDLETSDPKELAFRKDDIIVVIEQSYK 249

Query: 102 QWYEGRLNGKVGVFPTNYV 120
            W+ G L  +VG+FP NYV
Sbjct: 250 DWWLGSLGRRVGIFPLNYV 268

>AGR306C Chr7 complement(1305647..1308418) [2772 bp, 923 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL020C
           (BBC1)
          Length = 923

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 31/64 (48%), Gaps = 5/64 (7%)

Query: 68  PQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRL-----NGKVGVFPTNYVKL 122
           P  V A Y +     GDL    G  IEVI+ +  QWY G       N + G+FP NYV++
Sbjct: 10  PFDVIAKYTYESIHDGDLNFEDGQRIEVISIEDNQWYYGHFVDGAGNEQEGIFPKNYVEV 69

Query: 123 YSSD 126
              D
Sbjct: 70  AQDD 73

>TDEL0B05220 Chr2 complement(918098..919939) [1842 bp, 613 aa] {ON}
           Anc_2.159 YHR114W
          Length = 613

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 71  VEAIYAWSGEQKGDLELCPGDIIEVIT-KKSPQWYEGRLNGKVGVFPTNYVK 121
           ++A Y +  +   +L L P D++ VI       W  G LNG+ G+FPT+Y +
Sbjct: 562 MQAQYDYEAQGDDELSLTPNDVVNVIRGDDGSGWTYGELNGEKGLFPTSYCR 613

>TDEL0E05520 Chr5 (1015520..1020289) [4770 bp, 1589 aa] {ON}
           Anc_4.45 Scer_YGOB_SDC25
          Length = 1589

 Score = 38.5 bits (88), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 5/56 (8%)

Query: 71  VEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEG---RLNGKV--GVFPTNYVK 121
           V AI+ ++ + K +L L  GD I VI K    W++G     NGKV  G FP NY +
Sbjct: 51  VVAIFDYNRKGKNELNLQQGDTIYVIGKNESGWWDGLSIEANGKVHRGWFPQNYCR 106

>Kpol_538.25 s538 (50807..52930) [2124 bp, 707 aa] {ON}
           (50807..52930) [2124 nt, 708 aa]
          Length = 707

 Score = 37.7 bits (86), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 38/74 (51%), Gaps = 5/74 (6%)

Query: 62  LSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGK-----VGVFP 116
           +S  + P  V A+ A+  +   DL++  GD I V+  +  +WY GR   K      G+FP
Sbjct: 2   MSQEDVPFEVVAVQAYEPQFTADLKISKGDKITVLYVEDDRWYYGRYVDKDGFTNSGIFP 61

Query: 117 TNYVKLYSSDDRDS 130
           +++VK+    D  S
Sbjct: 62  SSHVKVIEGKDGKS 75

>KLLA0D16874g Chr4 complement(1430953..1431636) [684 bp, 227 aa]
           {ON} similar to uniprot|Q12163 Saccharomyces cerevisiae
           YDR162C NBP2 Protein involved in the HOG (high
           osmolarity glycerol) pathway negatively regulates Hog1p
           by recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex found in the nucleus and cytoplasm contains an
           SH3 domain that binds Pbs2p
          Length = 227

 Score = 37.0 bits (84), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 2/60 (3%)

Query: 73  AIYAWSGEQKGDLELCPGDIIEVITKKSPQWY--EGRLNGKVGVFPTNYVKLYSSDDRDS 130
           A+YA+  E   +LEL  GD++ +  K    W   E     K G+ P  YV+L   D  D+
Sbjct: 67  AMYAFVPENDNELELKEGDVVYISYKHGQGWLVAENHDRSKTGLVPEEYVQLIEDDGEDN 126

>TPHA0F03100 Chr6 complement(680407..681552) [1146 bp, 381 aa] {ON}
           Anc_7.365 YLR191W
          Length = 381

 Score = 37.0 bits (84), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 38/61 (62%), Gaps = 7/61 (11%)

Query: 69  QYVEAIYAWSGE-QKGDLELCPGDIIEVITKKSP-----QWYEGRL-NGKVGVFPTNYVK 121
           ++  A++ ++ E +K +L L  GD++ ++TKK P     +W++ R  NG  G  P+NY++
Sbjct: 307 EFARALFDFNPENRKIELTLTKGDLMAILTKKDPYGNTSKWWKVRTKNGDTGYVPSNYIE 366

Query: 122 L 122
           +
Sbjct: 367 I 367

>Ecym_2308 Chr2 complement(597163..599199) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii ABR082W
          Length = 678

 Score = 37.4 bits (85), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 4/59 (6%)

Query: 70  YVEAIYAWSGEQKGD-LELCPGDIIEVITKKSPQWYEGRL---NGKVGVFPTNYVKLYS 124
           Y +A+Y+++   + D L    GD + +  K +  WY G +   NG+ G+ P NYVK  S
Sbjct: 620 YAKALYSFTEPNENDILNFQMGDHLLLTEKLNTDWYIGEVHNSNGRQGLIPMNYVKFLS 678

>ABR082W Chr2 (537500..539551) [2052 bp, 683 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR032W (HOF1)
          Length = 683

 Score = 37.0 bits (84), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 4/59 (6%)

Query: 70  YVEAIYAWSGEQKGD-LELCPGDIIEVITKKSPQWYEGRL---NGKVGVFPTNYVKLYS 124
           Y  AIY+++     D L    GD + +  K +  WY G +   NGK G+ P NYV+L S
Sbjct: 625 YARAIYSFTEPNDNDILYFEMGDHLLLTEKLNTDWYIGEVHNGNGKQGLIPMNYVELLS 683

>NCAS0D01950 Chr4 (358938..361757) [2820 bp, 939 aa] {ON} Anc_5.170
          Length = 939

 Score = 37.0 bits (84), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 31/61 (50%)

Query: 62  LSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVK 121
           +S  + P  V+A + +  E + DL      II V   +  +WY G    K G+FP ++VK
Sbjct: 1   MSEPDTPFKVQAQFPYKSEYEDDLNFGKDQIITVTNVEDDEWYYGEYADKEGIFPKSFVK 60

Query: 122 L 122
           +
Sbjct: 61  I 61

>TPHA0K00680 Chr11 (134675..135742) [1068 bp, 355 aa] {ON} Anc_7.419
           YER118C
          Length = 355

 Score = 36.6 bits (83), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 68  PQYVEAIYAWSGEQKGDLELC--PGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVKL 122
           P   +A+Y++  +     E+    G+I++V   +   W   R NG+VG+ P+NYV+L
Sbjct: 296 PYTAKALYSYQADDADGYEISFEQGEILKVSDIEGRWWKSKRENGQVGIIPSNYVQL 352

>CAGL0K00517g Chr11 complement(55747..63162) [7416 bp, 2471 aa] {ON}
            similar to uniprot|P32600 Saccharomyces cerevisiae
            YKL203c Phosphatidylinositol 3-kinase
          Length = 2471

 Score = 36.6 bits (83), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 51/111 (45%), Gaps = 17/111 (15%)

Query: 38   IQDILRHKRRSPSASSYSNPTKGALSPRNGPQYVEAIYAWSGEQKGDLELC--------- 88
            I+D+  H     S  ++ + T   +SP   P+Y + + A    ++GD  +          
Sbjct: 1679 IRDLGLHPEHIISNKTFQSKTN--ISPNERPKY-QKLLATCFAKQGDWTIALDPNWSNTD 1735

Query: 89   PGDIIE---VITKKSPQWYEGRLNGKVGVFPTNYVKLYSSDDRDSNYQRTG 136
            PG ++    + T   PQWY+   N  +  F    + + SS ++D+NYQ++ 
Sbjct: 1736 PGSVLSSYLLATHFDPQWYKAWHNWALANFEV--ISMMSSTNKDTNYQKSN 1784

>NCAS0A14570 Chr1 complement(2869713..2870780) [1068 bp, 355 aa]
           {ON} Anc_7.419 YER118C
          Length = 355

 Score = 36.2 bits (82), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 33/63 (52%), Gaps = 2/63 (3%)

Query: 62  LSPRNGPQYVEAIYAWSGEQKGDLELC--PGDIIEVITKKSPQWYEGRLNGKVGVFPTNY 119
           L   N    V+A+Y++  +     EL    GDI++V   +   W   + NG+ G+ P+NY
Sbjct: 291 LEDENFTYTVKALYSYKADDSDAYELSFEQGDILKVSDIEGRWWKARKENGQTGIIPSNY 350

Query: 120 VKL 122
           VKL
Sbjct: 351 VKL 353

>SAKL0E10780g Chr5 (897714..899591) [1878 bp, 625 aa] {ON} similar
           to uniprot|Q75BK5 Ashbya gossypii ACR266W ACR266Wp and
           some similarites with YHR114W uniprot|P38822
           Saccharomyces cerevisiae YHR114W BZZ1 SH3 domain protein
           implicated in the regulation of actin polymerization
           able to recruit actin polymerization machinery through
           its SH3 domains colocalizes with cortical actin patches
           and Las17p interacts with type I myosins
          Length = 625

 Score = 36.2 bits (82), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 71  VEAIYAWSGEQKGDLELCPGDIIEVIT-KKSPQWYEGRLNGKVGVFPTNYVK 121
           +EA+Y +  +   +L +  G +++V+       W  G L+G  G+FPT+Y K
Sbjct: 574 IEALYDYQAQGDDELSIYAGSVVKVLKPDDGSGWTYGELDGAKGLFPTSYCK 625

 Score = 29.6 bits (65), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 13/55 (23%), Positives = 32/55 (58%), Gaps = 3/55 (5%)

Query: 74  IYAWSGEQKGDLELCPGDIIEVITKKSPQWY---EGRLNGKVGVFPTNYVKLYSS 125
           +Y ++ +   ++ + PGD+I ++TK +   +   +    G++G+ P++YV +  S
Sbjct: 500 LYPYAKQDADEVTINPGDLISLVTKDTGSGWTKIKNSTTGEMGLVPSSYVDIKES 554

>Smik_8.192 Chr8 (314456..316357) [1902 bp, 633 aa] {ON} YHR114W
           (REAL)
          Length = 633

 Score = 36.2 bits (82), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 71  VEAIYAWSGEQKGDLELCPGDIIEVIT-KKSPQWYEGRLNGKVGVFPTNYVK 121
           +EA+YA+  +   ++ +  GD+I VI       W  G  +G  G+FPT+Y K
Sbjct: 582 LEAMYAYEAQGDDEISIDVGDVITVIRGDDGSGWTYGECDGLKGLFPTSYCK 633

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/74 (21%), Positives = 38/74 (51%), Gaps = 3/74 (4%)

Query: 72  EAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLN---GKVGVFPTNYVKLYSSDDR 128
           + +YA+  +   ++ + PGD I ++ + +   +    N   G+ G+ PT Y+++ ++D  
Sbjct: 499 KVLYAYVKQDDDEISISPGDRISLVARDTGSGWTKINNDSTGESGLVPTTYIRISTTDTA 558

Query: 129 DSNYQRTGIKTPVP 142
            +N +    + P P
Sbjct: 559 TANNRGPAPEVPPP 572

>Suva_15.310 Chr15 (540462..542366) [1905 bp, 634 aa] {ON} YHR114W
           (REAL)
          Length = 634

 Score = 36.2 bits (82), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 38/72 (52%), Gaps = 3/72 (4%)

Query: 66  NGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLN---GKVGVFPTNYVKL 122
           NG    + +YA+S +   ++ + PGD I ++ + S   +    N   G+ G+ PT YV++
Sbjct: 493 NGDGGNKVLYAYSKQDTDEISISPGDKISLVARDSGSGWTKINNDSTGETGLVPTTYVRI 552

Query: 123 YSSDDRDSNYQR 134
            ++D  D+   R
Sbjct: 553 SNADGGDAANGR 564

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 35/68 (51%), Gaps = 9/68 (13%)

Query: 57  PTKGALSPRNGPQYVEAIYAWSGEQKGDLELC--PGDIIEVI-TKKSPQWYEGRLNGKVG 113
           P + AL  R     +EA YA+  E KGD E+    GD+I VI       W  G  +G  G
Sbjct: 573 PRRTALPVRT----LEAAYAY--EAKGDDEMSIDVGDVITVIRGDDGSGWTYGECDGLKG 626

Query: 114 VFPTNYVK 121
           +FPT+Y K
Sbjct: 627 LFPTSYCK 634

>KLLA0E06953g Chr5 (629777..630850) [1074 bp, 357 aa] {ON}
           uniprot|Q9P863 Kluyveromyces lactis sho1 Putative
           membrane protein
          Length = 357

 Score = 35.8 bits (81), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 68  PQYVEAIYAWSGEQKGDLELC--PGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVKL 122
           P   EA+Y +  +Q    E+    G+I+ V   +   W   + NG+ G+ P+NYVKL
Sbjct: 295 PYTAEALYTYQADQTDAYEISFEQGEILRVGDIEGRWWKAKKSNGETGIIPSNYVKL 351

>TBLA0C05560 Chr3 complement(1346488..1348509) [2022 bp, 673 aa]
           {ON} Anc_2.159 YHR114W
          Length = 673

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 73  AIYAWSGEQKGDLELCPGDIIEVIT-KKSPQWYEGRLNGKVGVFPTNYVK 121
           A+Y +  +   ++ L  GD I+VI       W  G LN K  +FPT+Y K
Sbjct: 619 ALYPYEAQGDDEMSLAVGDTIKVIKPDDGSGWTFGELNNKQSLFPTSYCK 668

>KLTH0B04818g Chr2 complement(395490..396632) [1143 bp, 380 aa] {ON}
           weakly similar to uniprot|P80667 Saccharomyces
           cerevisiae YLR191W PEX13 Integral peroxisomal membrane
           receptor
          Length = 380

 Score = 35.8 bits (81), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 40/68 (58%), Gaps = 8/68 (11%)

Query: 62  LSPRNGPQYVEAIYAWSGEQ-KGDLELCPGDIIEVITKKSP-----QWYEGRLN-GKVGV 114
           L PRN  ++  A+Y ++ E  + +  L  GD++ VI+K+ P     +W++ R   G VG 
Sbjct: 305 LDPRN-LEFARAVYDFTPENPQVEAALRKGDLMAVISKQDPLGNASEWWQVRTKKGDVGY 363

Query: 115 FPTNYVKL 122
            P+NYV+L
Sbjct: 364 VPSNYVEL 371

>KNAG0H03500 Chr8 (652236..654140) [1905 bp, 634 aa] {ON} Anc_2.159
           YHR114W
          Length = 634

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 71  VEAIYAWSGEQKGDLELCPGDIIEVITKK-SPQWYEGRLNGKVGVFPTNYVK 121
           V A YA+  +   +L L  GD+++VI       W  G L+G  G+ PT+Y K
Sbjct: 583 VTAQYAYVAQGDDELSLEAGDVVKVIKGDDGSGWTYGELDGAKGLIPTSYCK 634

 Score = 33.1 bits (74), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 72  EAIYAWSGEQKGDLELCPGDIIEVITKKSPQ-WYEGR--LNGKVGVFPTNYVKLYSS 125
           + +YA++ +   ++ + PGD+IE++T  S   W + R    G  G+ PT Y+ +  S
Sbjct: 507 KVLYAYTQQDDDEISVTPGDVIELVTPDSGSGWTQIRNVTTGAEGLVPTTYISVRES 563

>TPHA0B02890 Chr2 complement(659614..661518) [1905 bp, 634 aa] {ON}
           Anc_2.159 YHR114W
          Length = 634

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 71  VEAIYAWSGEQKGDLELCPGDIIEVITKK-SPQWYEGRLNGKVGVFPTNYVK 121
           V+A+Y +  +   ++ +  GD I VI       W  G LNG  G+FP++Y K
Sbjct: 583 VQALYDYEAQGDDEISISVGDTITVIKGDDGSGWTFGELNGIKGLFPSSYCK 634

>KLLA0D09306g Chr4 (783852..788465) [4614 bp, 1537 aa] {ON} similar
           to uniprot|P04821 Saccharomyces cerevisiae YLR310C CDC25
           Membrane bound guanine nucleotide exchange factor (GEF
           or GDP-release factor) indirectly regulates adenylate
           cyclase through activation of Ras1p and Ras2p by
           stimulating the exchange of GDP for GTP required for
           progression through G1
          Length = 1537

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 35/72 (48%), Gaps = 6/72 (8%)

Query: 56  NPTKGALSPRNGP-QYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRL--NGKV 112
           NP K  LS    P   V A Y ++  +K  L    GDII VI+K    W++G L  N  +
Sbjct: 10  NPPKAGLSTIIKPLDIVIAQYDFNPLRKSQLRFFAGDIIYVISKSDSGWWDGILYYNKSL 69

Query: 113 ---GVFPTNYVK 121
              G FP +Y K
Sbjct: 70  VLRGWFPRSYTK 81

>Kpol_1072.56 s1072 complement(127771..129684) [1914 bp, 637 aa]
           {ON} complement(127771..129684) [1914 nt, 638 aa]
          Length = 637

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 1/52 (1%)

Query: 71  VEAIYAWSGEQKGDLELCPGDIIEVI-TKKSPQWYEGRLNGKVGVFPTNYVK 121
           VEAIY +      +L +  G+ I+VI       W  G  NG  G+FP++Y K
Sbjct: 586 VEAIYDYEAAGDDELSISQGETIKVIRGDDGSGWTYGESNGAKGLFPSSYCK 637

>KAFR0L01880 Chr12 complement(348028..350820) [2793 bp, 930 aa] {ON}
           Anc_7.413 YER114C
          Length = 930

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 37/71 (52%), Gaps = 5/71 (7%)

Query: 65  RNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKK---SPQWYEGR--LNGKVGVFPTNY 119
           +N    + A+ A++   + ++ + PGD I+VIT     +  WY GR    GK G+FP  +
Sbjct: 25  KNSNTMLIAVSAYTKRMEDEISIKPGDKIQVITDDEDYNDGWYVGRNLRTGKEGLFPKIF 84

Query: 120 VKLYSSDDRDS 130
            +    D +DS
Sbjct: 85  TQKLDIDAQDS 95

>SAKL0H10098g Chr8 (865874..865882,865987..867645) [1668 bp, 555 aa]
           {ON} similar to uniprot|P29366 Saccharomyces cerevisiae
           YBR200W BEM1 Protein containing SH3-domains involved in
           establishing cell polarity and morphogenesis functions
           as a scaffold protein for complexes that include Cdc24p
           Ste5p Ste20p and Rsr1p
          Length = 555

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 41/83 (49%), Gaps = 14/83 (16%)

Query: 44  HKR-RSPSASSYSNPTKGALSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQ 102
           H+R  +P +   S+P K           ++A+Y +  +  G+L    GD   V+T+   +
Sbjct: 53  HQRLNAPKSKDISSPEK----------VIKAMYNYQAQSPGELSFVKGDFFHVLTEDR-E 101

Query: 103 WYEGR--LNGKVGVFPTNYVKLY 123
           WY+     +GK G+ P +Y +++
Sbjct: 102 WYDASNPSDGKRGMVPKSYFEIF 124

>KLLA0E23365g Chr5 complement(2077042..2078760,2078979..2078987)
           [1728 bp, 575 aa] {ON} similar to uniprot|P29366
           Saccharomyces cerevisiae YBR200W BEM1 Protein containing
           SH3-domains involved in establishing cell polarity and
           morphogenesis functions as a scaffold protein for
           complexes that include Cdc24p Ste5p Ste20p and Rsr1p
          Length = 575

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 29/55 (52%), Gaps = 3/55 (5%)

Query: 71  VEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGR--LNGKVGVFPTNYVKLY 123
           ++A+Y +  +  G+L    GD   V  ++   WYE     +GK G+ P NY +++
Sbjct: 68  IKALYNYQAQSAGELSFNKGDFFHV-QQEENDWYEASNPADGKRGMVPKNYFEIF 121

>KLLA0F23848g Chr6 (2224951..2226900) [1950 bp, 649 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 649

 Score = 34.7 bits (78), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 65  RNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITK-KSPQWYEGRLNGKVGVFPTNY 119
           ++  + + A Y +  +   +L L  GD I+V+ + +   W  G LNG  G+FPT Y
Sbjct: 592 KSAQKTMTAAYPYQSQGPDELSLQVGDKIKVLKEDEGNGWTFGELNGTQGLFPTTY 647

>NDAI0A01500 Chr1 (331951..335094) [3144 bp, 1047 aa] {ON} Anc_7.413
           YBL085W
          Length = 1047

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 51/94 (54%), Gaps = 11/94 (11%)

Query: 40  DILRHKRRSPSASSYSNPTKGALSPRNGPQYVE--AIYAWSGEQKGDLELCPGDIIEVIT 97
           D+   + R  S SS+++P    +SP+   QY     I  +S   + +L++ PGD IEV+T
Sbjct: 15  DVSPTRIRHVSDSSFNSP----ISPKVQKQYPMYICINEYSKRMEDELDMRPGDKIEVLT 70

Query: 98  ---KKSPQWYEGR--LNGKVGVFPTNYVKLYSSD 126
              + +  WY GR    G+ G++P  + ++ S++
Sbjct: 71  DDEEYNDGWYFGRNLRTGEEGLYPVVFTQIISTE 104

>KAFR0K02000 Chr11 complement(410316..411314) [999 bp, 332 aa] {ON}
           Anc_7.419 YER118C
          Length = 332

 Score = 34.3 bits (77), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 71  VEAIYAWSGEQKGDLELC--PGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVKLYSSD 126
            +A+Y++  ++    E+    G+I+ V   +   W   R NG+ G+ P+NYV+L +S+
Sbjct: 272 AKALYSYQADESDQYEISFEQGEILRVSDIEGRWWKAKRENGETGIIPSNYVQLINSE 329

>Ecym_5426 Chr5 (877285..879303) [2019 bp, 672 aa] {ON} similar to
           Ashbya gossypii ACR266W
          Length = 672

 Score = 34.7 bits (78), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 71  VEAIYAWSGEQKGDLELCPGDIIEVITKKSPQ-WYEGRLNGKVGVFPTNY 119
           V A+Y ++ +   ++ +  GD+I+VI   +   W  G + G  G+FP+NY
Sbjct: 621 VIAVYDYAAKDFDEISIRAGDVIKVIRDDTGNGWTYGEVRGSRGLFPSNY 670

>KLTH0D16434g Chr4 complement(1358785..1360170) [1386 bp, 461 aa]
           {ON} conserved hypothetical protein
          Length = 461

 Score = 34.3 bits (77), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 5/58 (8%)

Query: 70  YVEAIYAWSGEQ---KGDLELCPGDIIEVITKKSPQWYEGRL--NGKVGVFPTNYVKL 122
           Y  AI+ +S  +     DL  C  DII+VI +    W+ G +    + G FP + V+L
Sbjct: 400 YATAIFGFSSTEPTHSDDLSFCRNDIIKVIKRNENGWWYGEVIRTKQRGYFPASCVQL 457

>Kwal_23.6437 s23 (1581839..1583734) [1896 bp, 631 aa] {ON} YCR088W
           (ABP1) - 1:1 [contig 17] FULL
          Length = 631

 Score = 34.7 bits (78), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 32/66 (48%), Gaps = 4/66 (6%)

Query: 61  ALSPRNGPQYVEAI--YAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRL--NGKVGVFP 116
           + SP  G Q   AI  Y    E+  +L    GD I  I      W+ G L   G+ G+FP
Sbjct: 564 SASPEQGEQLHSAIAEYDNEAEEHNELAFKEGDKIVNIVFVDDDWWLGELEKTGEKGLFP 623

Query: 117 TNYVKL 122
           +NYV+L
Sbjct: 624 SNYVQL 629

>SAKL0G17600g Chr7 complement(1523623..1524948) [1326 bp, 441 aa]
           {ON} conserved hypothetical protein
          Length = 441

 Score = 34.3 bits (77), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 45/95 (47%), Gaps = 10/95 (10%)

Query: 37  EIQDILRHKRRSPSASSYSNPTKGALSPRNGPQ---YVEAIYAWSGE--QKG---DLELC 88
           EI +  R  + S   ++ SN  +   +  NG     Y  A+Y +S +  Q+G   DL   
Sbjct: 342 EIINFNRFYQHSIQNANASNKLQFRDNAANGTVPTVYATALYDYSPDPNQQGTGEDLTFK 401

Query: 89  PGDIIEVITKKSPQWYEGRL--NGKVGVFPTNYVK 121
            GD+I VI K    W+ G +    + G FP N+V+
Sbjct: 402 NGDMIRVIKKTENNWWYGEVLRTKRRGYFPVNFVE 436

>NDAI0B04320 Chr2 (1084783..1086681) [1899 bp, 632 aa] {ON}
           Anc_2.159 YHR114W
          Length = 632

 Score = 34.7 bits (78), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 1/52 (1%)

Query: 71  VEAIYAWSGEQKGDLELCPGDIIEVI-TKKSPQWYEGRLNGKVGVFPTNYVK 121
           + A Y++S     ++ +  GD+I VI       W  G LNG  G+ PT+Y K
Sbjct: 581 LTAAYSYSAAGDDEISINVGDVITVIRGDDGSGWTYGELNGSKGLVPTSYCK 632

 Score = 30.4 bits (67), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 52/99 (52%), Gaps = 15/99 (15%)

Query: 27  TKEISENDYDEIQDILRHKRRSPSASSYSNPTKGALSPRNGPQYVEAIYAWSGEQKGDLE 86
           +++++ ND D++            +S+Y+  T GA S R G +  + +YA++ +   ++ 
Sbjct: 464 SEDVASNDVDDL------------SSNYTTTTSGATSSRTGIKKNKVLYAYAKQDTDEIS 511

Query: 87  LCPGDIIEVITKKSPQ-WYEGR--LNGKVGVFPTNYVKL 122
           + PGD I ++   +   W + R    G+ G+ PT YVK+
Sbjct: 512 ISPGDSISLLAADTGSGWTKIRNDTTGESGLVPTTYVKI 550

>SAKL0H24222g Chr8 complement(2089734..2094314) [4581 bp, 1526 aa]
           {ON} similar to uniprot|P04821 Saccharomyces cerevisiae
           YLR310C CDC25 Membrane bound guanine nucleotide exchange
           factor (GEF or GDP-release factor) indirectly regulates
           adenylate cyclase through activation of Ras1p and Ras2p
           by stimulating the exchange of GDP for GTP required for
           progression through G1
          Length = 1526

 Score = 34.7 bits (78), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 5/56 (8%)

Query: 71  VEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRL---NGKV--GVFPTNYVK 121
           V A Y +   +K  L L  GD + V++K+   W++G +   N K   G FP NY K
Sbjct: 26  VVATYDYVPSRKSQLRLIQGDTVYVLSKQDSGWWDGIILDSNNKASRGWFPCNYSK 81

>NDAI0A01470 Chr1 (326531..327634) [1104 bp, 367 aa] {ON} Anc_7.419
           YER118C
          Length = 367

 Score = 34.3 bits (77), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 71  VEAIYAWSGEQKGDLELC--PGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVKL 122
           V+A+Y++  +     E+    G+I++V   +   W   R NG+ G+ P+NYV+L
Sbjct: 311 VKALYSYQADDADAYEISFDQGEILKVSDIEGRWWKAKRENGQTGIIPSNYVEL 364

>KAFR0L01580 Chr12 complement(286684..287718) [1035 bp, 344 aa] {ON}
           Anc_7.365 YLR191W
          Length = 344

 Score = 33.9 bits (76), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 34/61 (55%), Gaps = 7/61 (11%)

Query: 69  QYVEAIYAWSGEQKG-DLELCPGDIIEVITKKSP-----QWYEGRL-NGKVGVFPTNYVK 121
           ++  AIY +  E    ++ L  GD++ +++KK       QW++ R  NG VG  P NY++
Sbjct: 260 EFARAIYNFVPENPNIEVNLQKGDLMAILSKKDSFGNDSQWWKVRTKNGSVGFVPFNYIE 319

Query: 122 L 122
           +
Sbjct: 320 V 320

>Ecym_4710 Chr4 (1391055..1392254) [1200 bp, 399 aa] {ON} similar to
           Ashbya gossypii ACR230C
          Length = 399

 Score = 33.9 bits (76), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 37/64 (57%), Gaps = 7/64 (10%)

Query: 66  NGPQYVEAIYAWSGEQ-KGDLELCPGDIIEVITKKSP-----QWYEGRLN-GKVGVFPTN 118
           N  ++  A+Y ++ E  + +  L  GD++ +I+K  P     QW++ R   G+VG  P+N
Sbjct: 312 NNLEFARAVYDFTPENPRIECSLKKGDLMAIISKLDPTGNESQWWKVRTKKGEVGYIPSN 371

Query: 119 YVKL 122
           Y++L
Sbjct: 372 YIEL 375

>Ecym_1167 Chr1 (341453..341461,341739..343382) [1653 bp, 550 aa]
           {ON} similar to Ashbya gossypii AEL241W  1-intron
          Length = 550

 Score = 34.3 bits (77), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 36/65 (55%), Gaps = 4/65 (6%)

Query: 60  GALSPRNG-PQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRL--NGKVGVFP 116
           G +SP N  P  ++A+Y +  +  G+L    G+++ VI +   +W+E     +G+ G+ P
Sbjct: 57  GGVSPSNEVPIILKALYTYHAQSPGELSFTKGELVHVIGEDG-EWFEVSSPDSGRKGMVP 115

Query: 117 TNYVK 121
            +Y +
Sbjct: 116 KSYFE 120

>Skud_12.256 Chr12 (483859..485070) [1212 bp, 403 aa] {ON} YLR191W
           (REAL)
          Length = 403

 Score = 33.9 bits (76), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 36/61 (59%), Gaps = 7/61 (11%)

Query: 69  QYVEAIYAWSGEQ-KGDLELCPGDIIEVITKKSP-----QWYEGRL-NGKVGVFPTNYVK 121
           ++  A+Y +  E  + ++ L  GD++ +++KK P      W++ R  NGK+G  P NY++
Sbjct: 326 EFARALYDFVPENPQIEVALTKGDLMAILSKKDPIGKNSDWWKVRTKNGKIGYIPYNYIE 385

Query: 122 L 122
           +
Sbjct: 386 I 386

>Suva_5.235 Chr5 complement(366285..369416) [3132 bp, 1043 aa] {ON}
           YER114C (REAL)
          Length = 1043

 Score = 34.3 bits (77), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 42/79 (53%), Gaps = 9/79 (11%)

Query: 56  NPTKGALSPRNG---PQYVEAIYAWSGEQKGDLELCPGDIIEVIT---KKSPQWYEGR-- 107
           N +KG++S R G   P Y+ AI  +    + +L++ PGD I+VIT   K    WY GR  
Sbjct: 31  NDSKGSISGREGGNFPTYI-AINEYFKRMEDELDMKPGDKIKVITDDEKYKDGWYFGRNL 89

Query: 108 LNGKVGVFPTNYVKLYSSD 126
              + G++P  + +  + D
Sbjct: 90  RTNEEGLYPVVFTQKITVD 108

>KLLA0F14575g Chr6 complement(1351796..1354351) [2556 bp, 851 aa]
           {ON} some similarities with uniprot|P47068 Saccharomyces
           cerevisiae YJL020C/YJL021C BBC1 Protein possibly
           involved in assembly of actin patches
          Length = 851

 Score = 33.9 bits (76), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 31/58 (53%), Gaps = 5/58 (8%)

Query: 68  PQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRL---NGKV--GVFPTNYV 120
           P  VEA++ ++ + + DL    G II V+  +  +W+ G     +GK   G+FP  +V
Sbjct: 4   PFKVEALFPYTSDFEDDLPFSKGQIITVLEIEDDEWFFGEFKDADGKTKQGIFPKGFV 61

>Skud_8.175 Chr8 (311857..313758) [1902 bp, 633 aa] {ON} YHR114W
           (REAL)
          Length = 633

 Score = 33.5 bits (75), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 71  VEAIYAWSGEQKGDLELCPGDIIEVIT-KKSPQWYEGRLNGKVGVFPTNYVK 121
           +EA+YA+  +   ++ +  GD I VI       W  G  +G  G+FPT+Y +
Sbjct: 582 MEAVYAYEAQGDDEMSIDVGDEITVIRGDDGSGWTYGECDGLKGLFPTSYCR 633

 Score = 29.6 bits (65), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 14/63 (22%), Positives = 34/63 (53%), Gaps = 3/63 (4%)

Query: 72  EAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLN---GKVGVFPTNYVKLYSSDDR 128
           + +YA+  +   ++++ PGD I ++ + +   +    N   G+ G+ PT Y+++ S+   
Sbjct: 499 KVLYAYVKQDDDEIDITPGDKISLVARDTGSGWTKINNGNTGETGLVPTTYIRVSSAASA 558

Query: 129 DSN 131
            +N
Sbjct: 559 TAN 561

>YLL017W Chr12 (112234..112545) [312 bp, 103 aa] {OFF} Non-essential
           Ras guanine nucleotide exchange factor (GEF) localized
           to the membrane; expressed in poor nutrients and on
           non-fermentable carbon sources; homologous to CDC25;
           contains a stop codon in S288C; full-length gene
           includes YLL016W
          Length = 103

 Score = 31.6 bits (70), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%)

Query: 71  VEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRL 108
           VE  Y +  + +  L L  GD+I V+TK S  W++G L
Sbjct: 31  VECTYQYFTKSRNKLSLRVGDLIYVLTKGSNGWWDGVL 68

>Ecym_7134 Chr7 (266402..267400) [999 bp, 332 aa] {ON} similar to
           Ashbya gossypii AGL286C
          Length = 332

 Score = 33.1 bits (74), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 68  PQYVEAIYAWSGEQKGDLELC--PGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVKL 122
           P    A+YA+  ++    E+    G+I+ V   +   W   R NG+ G+ P+NYV+L
Sbjct: 269 PYTSRALYAYEADESDAYEISFQQGEILRVGDIEGRWWKAKRSNGETGIIPSNYVEL 325

>CAGL0I02750g Chr9 complement(242879..244738) [1860 bp, 619 aa] {ON}
           similar to uniprot|P38822 Saccharomyces cerevisiae
           YHR114w BZZ1
          Length = 619

 Score = 33.1 bits (74), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 71  VEAIYAWSGEQKGDLELCPGDIIEVITKK-SPQWYEGRLNGKVGVFPTNY 119
           + A Y ++ +   +L L  GD++ V+       W  G LNG  G+ PT+Y
Sbjct: 568 ITAQYEYTSQGDDELSLAVGDVVTVLKGDDGSGWTYGELNGHKGLVPTSY 617

>Ecym_8219 Chr8 (447011..450085) [3075 bp, 1024 aa] {ON} similar to
           Ashbya gossypii AGR306C
          Length = 1024

 Score = 33.1 bits (74), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 5/60 (8%)

Query: 68  PQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRL---NGKV--GVFPTNYVKL 122
           P  V A +++  E K DL    G  I VI+ +  QWY G      GK   G+FP ++V +
Sbjct: 10  PFQVVAQFSYKSEYKHDLHFDKGQKILVISIEDNQWYYGHFVDSEGKQREGIFPKSFVSI 69

>NCAS0B06980 Chr2 (1328203..1330122) [1920 bp, 639 aa] {ON}
           Anc_2.159 YHR114W
          Length = 639

 Score = 33.1 bits (74), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 8/77 (10%)

Query: 44  HKRRSPSASSYSNPTKGALSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVIT-KKSPQ 102
           H+  +P+A     P +  L  R     + A Y +  +   ++ +  GD I VI       
Sbjct: 568 HRGNAPAAPP---PRRSTLPTRT----MTAKYPYVAQGDDEMSINAGDTISVIRGDDGSG 620

Query: 103 WYEGRLNGKVGVFPTNY 119
           W  G LNG  G+FPT+Y
Sbjct: 621 WTYGELNGVKGLFPTSY 637

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 37/80 (46%), Gaps = 5/80 (6%)

Query: 52  SSYSNPTKGALSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWY---EGRL 108
           ++ S    GA S       V  +YA++ +   ++ + P DII ++   S   +   +   
Sbjct: 492 ATRSRANTGATSATTNKNKV--LYAYTKQDSDEITISPQDIITLLAADSGSGWTKIKNET 549

Query: 109 NGKVGVFPTNYVKLYSSDDR 128
            G+ G+ PT Y+K+  S  R
Sbjct: 550 TGESGLVPTTYIKIEESSHR 569

>AGL286C Chr7 complement(174535..175527) [993 bp, 330 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER118C
           (SHO1)
          Length = 330

 Score = 32.7 bits (73), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 2/59 (3%)

Query: 66  NGPQYVEAIYAWSGEQKGDLELC--PGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVKL 122
           N P   +A+YA+  +     E+    G+I+ V   +   W   + NG+ G+ P+NYV+L
Sbjct: 265 NFPYTAKALYAYEADASDAYEISFQQGEILRVGDIEGRWWKAKKANGETGIIPSNYVEL 323

>TPHA0F00380 Chr6 (85560..90416) [4857 bp, 1618 aa] {ON} Anc_4.45
           Scer_YGOB_SDC25
          Length = 1618

 Score = 33.1 bits (74), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 25/43 (58%), Gaps = 4/43 (9%)

Query: 85  LELCPGDIIEVITKKSPQWYEG-RLNGKV---GVFPTNYVKLY 123
           L   PGD I V+ K    W++G  L+GKV   G FP ++VK Y
Sbjct: 53  LRFNPGDKIYVLNKNDNGWWDGIVLHGKVVTRGWFPLHFVKPY 95

>NDAI0E04390 Chr5 (993398..994735) [1338 bp, 445 aa] {ON} Anc_7.365
           YLR191W
          Length = 445

 Score = 32.7 bits (73), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 37/64 (57%), Gaps = 7/64 (10%)

Query: 66  NGPQYVEAIYAWSGEQ-KGDLELCPGDIIEVITKKSP-----QWYEGRL-NGKVGVFPTN 118
           N  ++  A Y +  E  + +L+L  GD++ +I+K+ P     +W++ R  NG +G  P N
Sbjct: 368 NNLEFARAKYKFVPENPEMELQLSKGDLMAIISKQDPLGRDSEWWKVRTKNGDMGYVPYN 427

Query: 119 YVKL 122
           Y+++
Sbjct: 428 YLEI 431

>TDEL0C02810 Chr3 complement(498625..499638) [1014 bp, 337 aa] {ON}
           Anc_7.419 YER118C
          Length = 337

 Score = 32.7 bits (73), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 32/61 (52%), Gaps = 2/61 (3%)

Query: 68  PQYVEAIYAWSGEQKGDLELC--PGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVKLYSS 125
           P   + +Y++  +     E+    G+I++V   +   W   R NG+ G+ P+NYV+L  +
Sbjct: 275 PYTAKTLYSYQADAGDAYEISFDQGEILKVSDIEGRWWKAKRANGETGIIPSNYVQLIDN 334

Query: 126 D 126
           D
Sbjct: 335 D 335

>KNAG0C03390 Chr3 (667055..668083) [1029 bp, 342 aa] {ON} Anc_7.419
           YER118C
          Length = 342

 Score = 32.3 bits (72), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 71  VEAIYAWSGEQKGDLELC--PGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVKLYSS 125
            +A+Y++  +     E+    G+I++V   +   W   R NG+ G+ P+NYV+L  S
Sbjct: 286 AKALYSYDADSNDQYEVSFEQGEILKVSDIEGRWWKARRANGETGIIPSNYVELIES 342

>KLTH0C06028g Chr3 (520445..521473) [1029 bp, 342 aa] {ON} similar
           to uniprot|P40073 Saccharomyces cerevisiae YER118C SHO1
           Transmembrane osmosensor participates in activation of
           both the Cdc42p- and MAP kinase-dependent filamentous
           growth pathway and the high- osmolarity glycerol
           response pathway
          Length = 342

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 30/57 (52%), Gaps = 2/57 (3%)

Query: 68  PQYVEAIYAWSGEQKGDLELC--PGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVKL 122
           P   +A+Y ++ +     E+    G+++ V   +   W   R NG+ G+ P+NYV+L
Sbjct: 280 PYVAKALYTYTADSNDAYEVSFEQGEMLRVGDIEGRWWKAKRANGETGIIPSNYVEL 336

>ACR230C Chr3 complement(763430..764626) [1197 bp, 398 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR191W
           (PEX13)
          Length = 398

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 36/64 (56%), Gaps = 7/64 (10%)

Query: 66  NGPQYVEAIYAWSGEQ-KGDLELCPGDIIEVITKKSP-----QWYEGRLN-GKVGVFPTN 118
           N  ++  AIY ++ E  + +  L  GD++ +I+++ P     QW++ R   G VG  P N
Sbjct: 312 NSLEFARAIYDFTPENPRIECALKKGDLMAIISRQDPTGKESQWWKVRTKKGDVGYVPCN 371

Query: 119 YVKL 122
           Y++L
Sbjct: 372 YIEL 375

>KAFR0J00580 Chr10 (99508..102216) [2709 bp, 902 aa] {ON} Anc_5.170
           YJL020C
          Length = 902

 Score = 32.3 bits (72), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 36/69 (52%), Gaps = 5/69 (7%)

Query: 68  PQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRL---NGKV--GVFPTNYVKL 122
           P  V A YA+  E + DL      II+V + +  +WY G     +G++  G+FP ++V +
Sbjct: 7   PFEVIAQYAYQSEYEDDLNFDKNQIIKVTSVEDDEWYLGEFTDDDGQLLSGIFPKSFVVI 66

Query: 123 YSSDDRDSN 131
           +  + +  +
Sbjct: 67  HKGETKQEH 75

>Scer_YGOB_SDC25 Chr12 (112234..112506,112508..115993) [3759 bp,
           1252 aa] {ON} ANNOTATED BY YGOB - skipping over
           frameshift in strain S288c
          Length = 1252

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%)

Query: 71  VEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRL 108
           VE  Y +  + +  L L  GD+I V+TK S  W++G L
Sbjct: 31  VECTYQYFTKSRNKLSLRVGDLIYVLTKGSNGWWDGVL 68

>Kpol_1045.21 s1045 (44318..45394) [1077 bp, 358 aa] {ON}
           (44320..45396) [1077 nt, 359 aa]
          Length = 358

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 32/62 (51%), Gaps = 2/62 (3%)

Query: 68  PQYVEAIYAWSGEQKGDLELC--PGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVKLYSS 125
           P    A+Y++  +     E+    G+I++V   +   W   +  G+VG+ P+NYV+L   
Sbjct: 295 PYTARALYSYQADDADGYEVSFEQGEILKVSDIEGRWWKSKKETGEVGIIPSNYVQLIED 354

Query: 126 DD 127
           D+
Sbjct: 355 DE 356

>TBLA0H01160 Chr8 (259004..259678) [675 bp, 224 aa] {ON} Anc_8.344
           YDR162C
          Length = 224

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 73  AIYAWSGEQKGDLELCPGDIIEVITKKSPQWY--EGRLNGKVGVFPTNYV 120
           A+Y +  E   +L+L  GDII +  K    W   +   N K+G+ P  +V
Sbjct: 105 ALYDFVPENDNELQLVEGDIIFINYKHGQGWLVAQNLNNNKIGLVPEEFV 154

>AER140C Chr5 complement(901101..902345) [1245 bp, 414 aa] {ON}
           NOHBY516; No homolog in Saccharomyces cerevisiae'
          Length = 414

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 2/40 (5%)

Query: 85  LELCPGDIIEVITKKSPQWYEGRL--NGKVGVFPTNYVKL 122
           L +  GDII+VIT+    W+ G L      G+FP +YV++
Sbjct: 370 LSIKKGDIIQVITQSKNGWWYGDLLRTKTKGLFPQSYVQV 409

>Ecym_7231 Chr7 complement(480473..483913) [3441 bp, 1146 aa] {ON}
           similar to Ashbya gossypii AGR170C
          Length = 1146

 Score = 32.0 bits (71), Expect = 2.0,   Method: Composition-based stats.
 Identities = 21/65 (32%), Positives = 29/65 (44%), Gaps = 4/65 (6%)

Query: 71  VEAIYAWSGEQKGDLELC--PGDIIEVITKKSPQWYEGRL--NGKVGVFPTNYVKLYSSD 126
           V AIY +   Q  D EL    GD+ ++   +   W+  R   + KVG  P NYV+     
Sbjct: 74  VHAIYDYKQVQNPDEELSFQEGDVFDIFDDRDADWFLVRAVKDKKVGFIPGNYVETIEEG 133

Query: 127 DRDSN 131
            R  N
Sbjct: 134 GRGGN 138

>Kwal_27.10707 s27 (457482..458513) [1032 bp, 343 aa] {ON} YER118C
           (SHO1) - Transmembrane osmosensor [contig 33] FULL
          Length = 343

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 68  PQYVEAIYAWSGEQKGDLELC--PGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVKL 122
           P   +A+Y ++ +     E+    G+ + V   +   W   R NG+ G+ P+NYV+L
Sbjct: 281 PYLAKALYTYTADSNDAYEVSFEQGETLRVGDIEGRWWKAKRANGETGIIPSNYVEL 337

>Kpol_325.12 s325 (19571..21283) [1713 bp, 570 aa] {ON}
           (19571..21283) [1713 nt, 571 aa]
          Length = 570

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 28/58 (48%), Gaps = 3/58 (5%)

Query: 67  GPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRL--NGKVGVFPTNYVKL 122
           GP  V A Y +   +  +L    GD I  I      W+ G L   G+ G+FP+NYV L
Sbjct: 512 GPSAV-AEYDYDAAEDNELTFVEGDKIVNIEFVDDDWWLGELEKTGEKGLFPSNYVSL 568

>KLTH0B02354g Chr2 (186128..189772) [3645 bp, 1214 aa] {ON} weakly
           similar to uniprot|P47068 Saccharomyces cerevisiae
           YJL020C BBC1 Protein possibly involved in assembly of
           actin patches interacts with an actin assembly factor
           Las17p and with the SH3 domains of Type I myosins Myo3p
           and Myo5p localized predominantly to cortical actin
           patches
          Length = 1214

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 36/81 (44%), Gaps = 5/81 (6%)

Query: 68  PQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNG-----KVGVFPTNYVKL 122
           P  V A + ++ E   DL    G +I V + +  +WY G         K G+FP ++VKL
Sbjct: 7   PFTVIAQFPYTSEHDDDLNFEKGSLITVQSIEDDEWYFGEYQDESGTYKEGIFPRSFVKL 66

Query: 123 YSSDDRDSNYQRTGIKTPVPT 143
              ++     +    + P PT
Sbjct: 67  AGDEEPSKPVEDPLDRVPSPT 87

>KLTH0H09416g Chr8 (806836..811422) [4587 bp, 1528 aa] {ON} similar
           to uniprot|P04821 Saccharomyces cerevisiae YLR310C CDC25
           Membrane bound guanine nucleotide exchange factor (GEF
           or GDP-release factor) indirectly regulates adenylate
           cyclase through activation of Ras1p and Ras2p by
           stimulating the exchange of GDP for GTP required for
           progression through G1
          Length = 1528

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 34/78 (43%), Gaps = 7/78 (8%)

Query: 71  VEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYE-----GRLNGKV--GVFPTNYVKLY 123
           V A   ++  +K  L L  GD++ V+ K    W++     GR   +V  G FP N+ + Y
Sbjct: 27  VVATCDFTPTKKAQLRLSAGDVVYVLGKNESGWWDGVTVCGRSPQRVARGWFPHNFTRSY 86

Query: 124 SSDDRDSNYQRTGIKTPV 141
               R     + G  + V
Sbjct: 87  REHKRGGLAAKCGAASSV 104

>YLR191W Chr12 (537272..538432) [1161 bp, 386 aa] {ON}
           PEX13Integral peroxisomal membrane protein required for
           translocation of peroxisomal matrix proteins, interacts
           with the PTS1 signal recognition factor Pex5p and the
           PTS2 signal recognition factor Pex7p, forms a complex
           with Pex14p and Pex17p
          Length = 386

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 35/61 (57%), Gaps = 7/61 (11%)

Query: 69  QYVEAIYAWSGEQ-KGDLELCPGDIIEVITKKSP-----QWYEGRL-NGKVGVFPTNYVK 121
           ++  A+Y +  E  + ++ L  GD++ +++KK P      W++ R  NG +G  P NY++
Sbjct: 309 EFARALYDFVPENPEMEVALKKGDLMAILSKKDPLGRDSDWWKVRTKNGNIGYIPYNYIE 368

Query: 122 L 122
           +
Sbjct: 369 I 369

>Suva_5.239 Chr5 complement(373672..374778) [1107 bp, 368 aa] {ON}
           YER118C (REAL)
          Length = 368

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 25/47 (53%)

Query: 79  GEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVKLYSS 125
           G+   ++     +I++V   +   W   R NG+ G+ P+NYV+L  S
Sbjct: 316 GDDAYEISFEQNEILQVSDIEGRWWKARRANGETGIIPSNYVQLIDS 362

>SAKL0F12958g Chr6 complement(1019015..1022098) [3084 bp, 1027 aa]
           {ON} similar to uniprot|P39969 Saccharomyces cerevisiae
           YER114C BOI2 Protein implicated in polar growth
           functionally redundant with Boi1p interacts with bud-
           emergence protein Bem1p contains an SH3 (src homology 3)
           domain and a PH (pleckstrin homology) domain
          Length = 1027

 Score = 31.6 bits (70), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 42/74 (56%), Gaps = 7/74 (9%)

Query: 63  SPRNG-PQYVEAIYAWSGEQKGDLELCPGDIIEVIT---KKSPQWYEGR--LNGKVGVFP 116
           +P+ G P Y+ AI  ++   + +L++ PGD I+VIT   + +  WY GR     + G++P
Sbjct: 33  TPQGGFPTYI-AINEYTKRMEDELDMKPGDKIQVITDDQEYNDGWYYGRNLRTNEEGLYP 91

Query: 117 TNYVKLYSSDDRDS 130
             + ++ S+  + S
Sbjct: 92  KVFTQVISTQKQPS 105

>Smik_12.251 Chr12 (484225..485391) [1167 bp, 388 aa] {ON} YLR191W
           (REAL)
          Length = 388

 Score = 31.2 bits (69), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 35/61 (57%), Gaps = 7/61 (11%)

Query: 69  QYVEAIYAWSGEQ-KGDLELCPGDIIEVITKKSP-----QWYEGRL-NGKVGVFPTNYVK 121
           ++  A+Y +  E  + ++ L  GD++ +++KK P      W++ R  NG +G  P NY++
Sbjct: 311 EFARALYDFVPENPEMEVALKKGDLMAILSKKDPVGRDSDWWKVRTKNGNIGYIPYNYIE 370

Query: 122 L 122
           +
Sbjct: 371 I 371

>KAFR0F00750 Chr6 complement(145999..147807) [1809 bp, 602 aa] {ON}
           Anc_2.159 YHR114W
          Length = 602

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 65  RNGPQYVEAIYAWSGEQKGDLELCPGDIIEVIT-KKSPQWYEGRLNGKVGVFPTNYVK 121
           R   + +E ++ +  +   ++ +  GD++ VI       W  G LNG  G+ PT+Y K
Sbjct: 545 RKHVRTLEVVFDYVAQGDDEISINVGDVVTVIKGDDGSGWTYGELNGLKGLVPTSYCK 602

>TBLA0I01050 Chr9 (210595..211710) [1116 bp, 371 aa] {ON} Anc_7.419
           YER118C
          Length = 371

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 28/57 (49%), Gaps = 2/57 (3%)

Query: 68  PQYVEAIYAWSGEQKGDLELC--PGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVKL 122
           P    A+Y++   +    E+     +++EV   +   W   R NG  G+ P+NYV+L
Sbjct: 313 PYKARALYSYKANENDAYEISFEQNELLEVSDIEGRWWKARRENGTTGIIPSNYVEL 369

>AGL237C Chr7 complement(254636..256372) [1737 bp, 578 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR088W
           (ABP1)
          Length = 578

 Score = 31.2 bits (69), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 73  AIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLN--GKVGVFPTNYVKL 122
           A Y +   +  +L    GD+I  I      W+ G L   G+ G+FP+NYV+L
Sbjct: 525 AEYDYEAGEDNELTFEEGDVIVNIDFVDDDWWLGELQKTGQKGLFPSNYVEL 576

>AGL293C Chr7 complement(156902..159856) [2955 bp, 984 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER114C
           (BOI2) and YBL085W (BOI1)
          Length = 984

 Score = 31.6 bits (70), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 37/66 (56%), Gaps = 7/66 (10%)

Query: 64  PRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVIT---KKSPQWYEGR--LNGKVGVFPTN 118
           PR G  Y+ AI  +S   + +L++ PGD IEVIT   + +  WY GR    G+ G++P  
Sbjct: 27  PRYG-TYI-AINEYSKRMEDELDMKPGDKIEVITDDQEYNDGWYFGRNLRTGEEGLYPKL 84

Query: 119 YVKLYS 124
           + +  S
Sbjct: 85  FTQELS 90

>Kwal_47.16943 s47 (182308..183690) [1383 bp, 460 aa] {ON} YDR388W
           (RVS167) - (putative) cytoskeletal protein [contig 219]
           FULL
          Length = 460

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 2/45 (4%)

Query: 80  EQKGDLELCPGDIIEVITKKSPQWY--EGRLNGKVGVFPTNYVKL 122
           +Q  DL     ++I+VI K    W+  E     K G FP NYV+L
Sbjct: 412 DQSTDLNFRRNEVIKVIKKNEDGWWYGEAMRTRKRGYFPANYVEL 456

>KLTH0E12518g Chr5 complement(1109548..1111197,1111361..1111369)
           [1659 bp, 552 aa] {ON} similar to uniprot|P29366
           Saccharomyces cerevisiae YBR200W BEM1 Protein containing
           SH3-domains involved in establishing cell polarity and
           morphogenesis functions as a scaffold protein for
           complexes that include Cdc24p Ste5p Ste20p and Rsr1p
          Length = 552

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 42/90 (46%), Gaps = 12/90 (13%)

Query: 41  ILRHKRRSPSASSYSNPTKGALSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKS 100
           + +H+++ P  SS+       +S R+G  Y   +Y +  E+  +L    G+ + +    +
Sbjct: 134 LTQHQQQLPVNSSF-------ISQRSGSLYAIVLYDFRAEKSDELTTYAGENLFICAHHN 186

Query: 101 PQWY----EGRLNGKVGVFPTNYVKLYSSD 126
            +W+     GRL G  G+ P  +V +   D
Sbjct: 187 YEWFIAKPIGRLGGP-GLVPVGFVSIIDID 215

>SAKL0H21912g Chr8 complement(1913307..1917068) [3762 bp, 1253 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1253

 Score = 31.2 bits (69), Expect = 3.0,   Method: Composition-based stats.
 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 4/66 (6%)

Query: 70  YVEAIYAWSGEQKGDLELC--PGDIIEVITKKSPQWY--EGRLNGKVGVFPTNYVKLYSS 125
           + +A+Y +   Q  D EL    GD  +V   + P W     + +G++G  P NYV++  +
Sbjct: 73  HAKALYDYDQVQNPDEELLFHEGDEFDVYDNRDPDWILCSSKTSGEIGFVPGNYVEISEA 132

Query: 126 DDRDSN 131
               SN
Sbjct: 133 TPVGSN 138

>Suva_10.287 Chr10 (509884..511062) [1179 bp, 392 aa] {ON} YLR191W
           (REAL)
          Length = 392

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 35/61 (57%), Gaps = 7/61 (11%)

Query: 69  QYVEAIYAWSGEQ-KGDLELCPGDIIEVITKKSP-----QWYEGRL-NGKVGVFPTNYVK 121
           ++  A+Y +  E  + ++ L  GD++ +++KK P      W++ R  NG +G  P NY++
Sbjct: 315 EFARALYDFIPENPQMEVALKKGDLMAILSKKDPLGKDSDWWKVRTKNGSIGYIPYNYIE 374

Query: 122 L 122
           +
Sbjct: 375 I 375

>CAGL0E02783g Chr5 (261665..265276) [3612 bp, 1203 aa] {ON} similar
           to uniprot|P32790 Saccharomyces cerevisiae YBL007c SLA1
          Length = 1203

 Score = 31.2 bits (69), Expect = 3.3,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 3/58 (5%)

Query: 73  AIYAWSGEQKGDLELCPGDIIEVIT-KKSPQWYEGRL--NGKVGVFPTNYVKLYSSDD 127
           A+Y +  E   +L +  GD + VI  KKS  W+   L  NGK G+ P  +++   S +
Sbjct: 377 ALYDFEAESPDELTIRQGDAVYVINDKKSKDWWMVELISNGKKGLVPAQFIEFSKSKE 434

>ZYRO0F13882g Chr6 complement(1143280..1144146) [867 bp, 288 aa]
           {ON} similar to uniprot|Q12163 Saccharomyces cerevisiae
           YDR162C NBP2 Protein involved in the HOG (high
           osmolarity glycerol) pathway negatively regulates Hog1p
           by recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex found in the nucleus and cytoplasm contains an
           SH3 domain that binds Pbs2p
          Length = 288

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 28/59 (47%), Gaps = 2/59 (3%)

Query: 73  AIYAWSGEQKGDLELCPGDIIEVITKKSPQWY--EGRLNGKVGVFPTNYVKLYSSDDRD 129
           A+Y +  E   +LEL  GD++ +  +    W   E +   K G+ P  +V   + DD +
Sbjct: 133 ALYDFEPENDNELELQEGDVVFISYRHGQGWLVAENQNRTKTGLVPEEFVTYANEDDEN 191

>Ecym_4228 Chr4 (475985..476770) [786 bp, 261 aa] {ON} similar to
           Ashbya gossypii AGL169C
          Length = 261

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 2/59 (3%)

Query: 71  VEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWY--EGRLNGKVGVFPTNYVKLYSSDD 127
           V A+Y +  E   +LEL  GD+I +  K    W   E     + G+ P  YV ++  D+
Sbjct: 119 VVALYDFVPENDNELELKEGDVIYISYKHGQGWLVAENIDGTRTGLVPEEYVSIWKGDE 177

>Smik_2.35 Chr2 (57476..60433) [2958 bp, 985 aa] {ON} YBL085W (REAL)
          Length = 985

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 36/68 (52%), Gaps = 6/68 (8%)

Query: 68  PQYVEAIYAWSGEQKGDLELCPGDIIEVIT---KKSPQWYEGR--LNGKVGVFPTNYVKL 122
           P Y+ A+  +S   + +L + PGD IEVIT   + +  WY GR     + G++P  + K 
Sbjct: 16  PLYI-AVNEYSKRMEDELNMRPGDKIEVITDDGEYNDGWYYGRNLRTKEEGLYPAVFTKK 74

Query: 123 YSSDDRDS 130
            + D  +S
Sbjct: 75  ITLDKSES 82

>Kwal_53.19449 s53 (58..657) [600 bp, 199 aa] {ON} YDR162C (NBP2) -
           interacts with Nap1, which is involved in histone
           assembly [contig 398] FULL
          Length = 199

 Score = 30.4 bits (67), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 2/60 (3%)

Query: 73  AIYAWSGEQKGDLELCPGDIIEVITKKSPQWY--EGRLNGKVGVFPTNYVKLYSSDDRDS 130
           A+Y +  E   +LEL  GD++ +  + +  W   E     + G+ P  YV L    D D+
Sbjct: 76  ALYDFVAENDNELELKEGDVLFIGYRHAQGWLVAENMDRTRTGLVPEEYVSLTDVADSDA 135

>Skud_5.265 Chr5 (427799..430930) [3132 bp, 1043 aa] {ON} YER114C
           (REAL)
          Length = 1043

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 37/72 (51%), Gaps = 9/72 (12%)

Query: 58  TKGALSPRNG---PQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSP---QWYEGR--LN 109
           +KG+ S R G   P Y+ AI  +    + +L++ PGD I+VIT        WY GR    
Sbjct: 33  SKGSTSGREGGNFPMYI-AINEYFKRMEDELDMKPGDKIKVITDDEEYKDGWYFGRNLRT 91

Query: 110 GKVGVFPTNYVK 121
            + G++P  + +
Sbjct: 92  NEEGLYPVVFTQ 103

>TBLA0F00280 Chr6 complement(58186..59916) [1731 bp, 576 aa] {ON}
           Anc_6.366 YCR088W
          Length = 576

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 35/76 (46%), Gaps = 3/76 (3%)

Query: 49  PSASSYSNPTKGALSPRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRL 108
           PS  S  N T+    P  G   + A Y +   +  +L     D I  I      W+ G L
Sbjct: 500 PSLPSRENATEEPSKPAGGATAI-AQYDYEAAEDNELTFNENDKIINIEFVDDDWWLGEL 558

Query: 109 --NGKVGVFPTNYVKL 122
             +G+ G+FP+NYV+L
Sbjct: 559 ESSGEKGLFPSNYVEL 574

>Suva_2.33 Chr2 (60529..63477) [2949 bp, 982 aa] {ON} YBL085W (REAL)
          Length = 982

 Score = 30.8 bits (68), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 32/59 (54%), Gaps = 6/59 (10%)

Query: 68  PQYVEAIYAWSGEQKGDLELCPGDIIEVIT---KKSPQWYEGR--LNGKVGVFPTNYVK 121
           P Y+ A+  +S   + +L + PGD IEVIT   + +  WY GR     + G++P  + K
Sbjct: 16  PLYI-AVNEYSKRMEDELSMKPGDKIEVITDDGEYNDGWYYGRNLRTKEEGLYPAVFTK 73

>ZYRO0B16214g Chr2 (1312950..1314929) [1980 bp, 659 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 659

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 38/69 (55%), Gaps = 6/69 (8%)

Query: 58  TKGALSPR-NGPQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQ-WYEGRLN--GKVG 113
           T+G+ S   NG   V  +YA+ G    ++ + PGD I+V+   +   W + R N  G  G
Sbjct: 512 TRGSTSSNTNGGNRV--VYAFRGRDNDEVSVNPGDSIKVLAPDTGSGWTKLRNNTTGDQG 569

Query: 114 VFPTNYVKL 122
           + PT+Y+++
Sbjct: 570 LAPTSYLEI 578

 Score = 30.4 bits (67), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 13/48 (27%), Positives = 26/48 (54%), Gaps = 1/48 (2%)

Query: 75  YAWSGEQKGDLELCPGDIIEVITKK-SPQWYEGRLNGKVGVFPTNYVK 121
           Y +  +++ ++ +  GD++ V+ +     W    L+G  G+ PTNY K
Sbjct: 612 YDYDAQEENEMTVEVGDVVNVLKEDDGSGWTLAELDGDSGLIPTNYCK 659

>SAKL0A00594g Chr1 complement(68426..70336) [1911 bp, 636 aa] {ON}
           some similarities with uniprot|P15891 Saccharomyces
           cerevisiae YCR088W ABP1 Actin-binding protein of the
           cortical actin cytoskeleton important for activation of
           the Arp2/3 complex that plays a key role actin in
           cytoskeleton organization
          Length = 636

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 73  AIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRL--NGKVGVFPTNYVKL 122
           A Y +   ++ +L    GD I  I      W+ G L   G+ G+FP+NYV+L
Sbjct: 583 AEYDYEAGEENELTFTEGDKIINIEFVDDDWWLGELEKTGEKGLFPSNYVEL 634

>KLTH0A07348g Chr1 (610049..611929) [1881 bp, 626 aa] {ON} similar
           to uniprot|P15891 Saccharomyces cerevisiae YCR088W ABP1
           Actin-binding protein of the cortical actin cytoskeleton
           important for activation of the Arp2/3 complex that
           plays a key role actin in cytoskeleton organization
          Length = 626

 Score = 30.8 bits (68), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 73  AIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRL--NGKVGVFPTNYVKL 122
           A Y    E+  +L    GD I  I+     W+ G L   G+ G+FP+NYV+L
Sbjct: 573 AEYDNEAEEHNELAFEEGDKIINISFVDDDWWLGELEKTGEKGLFPSNYVQL 624

>KAFR0B05860 Chr2 complement(1210822..1211571) [750 bp, 249 aa] {ON}
           Anc_8.344 YDR162C
          Length = 249

 Score = 30.0 bits (66), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 27/59 (45%), Gaps = 2/59 (3%)

Query: 73  AIYAWSGEQKGDLELCPGDIIEVITKKSPQWY--EGRLNGKVGVFPTNYVKLYSSDDRD 129
           A+Y +  E   +L L  GDI+ +  +    W   E +   K G+ P  +V    +D+ D
Sbjct: 117 ALYDFEPENDNELGLHEGDIVFISYRHGQGWLVAENQPRTKTGLVPEEFVSFLDNDEED 175

>NDAI0I00220 Chr9 (32281..34128) [1848 bp, 615 aa] {ON} Anc_6.366
           YCR088W
          Length = 615

 Score = 30.4 bits (67), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 2/55 (3%)

Query: 70  YVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRL--NGKVGVFPTNYVKL 122
           +  A Y +   ++ +L     D I  I      W+ G L  NG+ G+FP+NYV L
Sbjct: 559 WATAEYDYDAGEENELTFVENDKIINIEFVDDDWWLGELEKNGEKGLFPSNYVSL 613

>ZYRO0C14454g Chr3 (1130631..1131161) [531 bp, 176 aa] {ON} some
          similarities with uniprot|P38794 Saccharomyces
          cerevisiae YHR071W PCL5 Cyclin interacts with Pho85p
          cyclin-dependent kinase (Cdk) induced by Gcn4p at level
          of transcription specifically required for Gcn4p
          degradation may be sensor of cellular protein
          biosynthetic capacity
          Length = 176

 Score = 29.6 bits (65), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 30/67 (44%), Gaps = 8/67 (11%)

Query: 18 RRCLELLIDTKEISENDYDEIQDILRHKRRSPSASSYSNPTKGALSPRNGPQYVEAIYAW 77
          R  L L ++TK  +++DY  I+  L+   R    +  S     A        YVE IY  
Sbjct: 40 RMALFLTLNTKTTAKDDYKSIRRFLKELLRRSQCNRRSALLAAA--------YVENIYQT 91

Query: 78 SGEQKGD 84
           G++ GD
Sbjct: 92 MGDENGD 98

>Smik_4.406 Chr4 complement(738389..739096) [708 bp, 235 aa] {ON}
           YDR162C (REAL)
          Length = 235

 Score = 30.0 bits (66), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 26/57 (45%), Gaps = 2/57 (3%)

Query: 73  AIYAWSGEQKGDLELCPGDIIEVITKKSPQWY--EGRLNGKVGVFPTNYVKLYSSDD 127
           A+Y +  E   +L+L  G+I+ +  K    W   E     K G+ P  +V    S+D
Sbjct: 117 ALYDFEPENDNELKLAEGEIVFISYKHGQGWLVAENESRSKTGLVPEEFVSYIQSED 173

>ZYRO0B04004g Chr2 complement(337594..338709) [1116 bp, 371 aa] {ON}
           similar to uniprot|P40073 Saccharomyces cerevisiae
           YER118C SHO1 Transmembrane osmosensor participates in
           activation of both the Cdc42p- and MAP kinase-dependent
           filamentous growth pathway and the high-osmolarity
           glycerol response pathway
          Length = 371

 Score = 30.4 bits (67), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 2/57 (3%)

Query: 68  PQYVEAIYAWSGEQKGDLELC--PGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVKL 122
           P   + +Y +  ++    E+    G+I++V   +   W   R  G+ G+ P+NYVKL
Sbjct: 308 PYTAQTLYRYQADEDDAYEISFEQGEILKVSDIEGRWWKAKRSTGETGIIPSNYVKL 364

>Smik_5.263 Chr5 complement(407025..408131) [1107 bp, 368 aa] {ON}
           YER118C (REAL)
          Length = 368

 Score = 30.0 bits (66), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 71  VEAIYAWSGEQKGDLELC--PGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVKL 122
            +A+Y +  + +   E+     +I++V   +   W   R NG+ G+ P+NYV+L
Sbjct: 306 AKALYPYDADDEDAYEISFEQNEILQVSDIEGRWWKARRANGETGIIPSNYVQL 359

>YER114C Chr5 complement(390590..393712) [3123 bp, 1040 aa] {ON}
           BOI2Protein implicated in polar growth, functionally
           redundant with Boi1p; interacts with bud-emergence
           protein Bem1p; contains an SH3 (src homology 3) domain
           and a PH (pleckstrin homology) domain
          Length = 1040

 Score = 30.4 bits (67), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 38/72 (52%), Gaps = 9/72 (12%)

Query: 58  TKGALSPRNG---PQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSP---QWYEGR--LN 109
           +KG+ + R+G   P Y+ AI  +    + +L++ PGD I+VIT        WY GR    
Sbjct: 33  SKGSATGRDGGNFPMYI-AINEYFKRMEDELDMKPGDKIKVITDDEEYKDGWYFGRNLRT 91

Query: 110 GKVGVFPTNYVK 121
            + G++P  + +
Sbjct: 92  NEEGLYPVVFTQ 103

>TDEL0A07810 Chr1 (1355773..1357449) [1677 bp, 558 aa] {ON}
           Anc_6.366 YCR088W
          Length = 558

 Score = 30.0 bits (66), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 16/22 (72%), Gaps = 2/22 (9%)

Query: 103 WYEGRL--NGKVGVFPTNYVKL 122
           W+ G L  NG+ G+FP+NYV L
Sbjct: 536 WWLGELERNGEKGLFPSNYVTL 557

>KAFR0J02650 Chr10 complement(510356..512017) [1662 bp, 553 aa] {ON}
           Anc_6.366 YCR088W
          Length = 553

 Score = 30.0 bits (66), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 16/22 (72%), Gaps = 2/22 (9%)

Query: 103 WYEGRL--NGKVGVFPTNYVKL 122
           W+ G L  NG+ G+FP+NYV L
Sbjct: 529 WWLGELEKNGEKGLFPSNYVNL 550

>YER118C Chr5 complement(397952..399055) [1104 bp, 367 aa] {ON}
           SHO1Transmembrane osmosensor involved in activation of
           the Cdc42p- and MAP kinase-dependent filamentous growth
           pathway and the high-osmolarity glycerol response
           pathway; phosphorylated by Hog1p; interacts with Pbs2p,
           Msb2p, Hkr1p, and Ste11p
          Length = 367

 Score = 29.6 bits (65), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 20/32 (62%)

Query: 91  DIIEVITKKSPQWYEGRLNGKVGVFPTNYVKL 122
           +I++V   +   W   R NG+ G+ P+NYV+L
Sbjct: 327 EILQVSDIEGRWWKARRANGETGIIPSNYVQL 358

>Skud_4.420 Chr4 complement(749749..750450) [702 bp, 233 aa] {ON}
           YDR162C (REAL)
          Length = 233

 Score = 29.6 bits (65), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 28/66 (42%), Gaps = 2/66 (3%)

Query: 73  AIYAWSGEQKGDLELCPGDIIEVITKKSPQWY--EGRLNGKVGVFPTNYVKLYSSDDRDS 130
           A+Y +  E   +L+L  GDI+ +  K    W   E     K G+ P  +V     +D + 
Sbjct: 117 ALYDFEPENDNELKLTEGDIVFISYKHGQGWLVAENESRSKTGLVPEEFVSYIQPEDGEE 176

Query: 131 NYQRTG 136
             + T 
Sbjct: 177 EQEDTA 182

>KNAG0B02230 Chr2 (431524..434238) [2715 bp, 904 aa] {ON} Anc_7.413
           YER114C
          Length = 904

 Score = 30.0 bits (66), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 6/50 (12%)

Query: 84  DLELCPGDIIEVITKK---SPQWYEGR---LNGKVGVFPTNYVKLYSSDD 127
           +L+L PGD IEV+         WY G+      +VG+FP  + K+  +++
Sbjct: 35  ELDLVPGDRIEVLEADELYGDGWYTGKNLSRGSQVGLFPEVFTKVVDAEE 84

>KNAG0I02700 Chr9 complement(531880..533607) [1728 bp, 575 aa] {ON}
           Anc_6.366 YCR088W
          Length = 575

 Score = 29.6 bits (65), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 16/22 (72%), Gaps = 2/22 (9%)

Query: 103 WYEGRL--NGKVGVFPTNYVKL 122
           W+ G L  NG+ G+FP+NYV L
Sbjct: 552 WWLGELERNGEKGLFPSNYVSL 573

>AEL241W Chr5 (184639..184647,184836..186476) [1650 bp, 549 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR200W
           (BEM1); 1-intron
          Length = 549

 Score = 29.6 bits (65), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 44/90 (48%), Gaps = 6/90 (6%)

Query: 40  DILRHKRRSPSASSYSN--PTKGALS-PRNGPQYVEAIYAWSGEQKGDLELCPGDIIEVI 96
           +I  H  R  S S+ SN     GA++   + P  ++A+Y +  +  G+L    G++ +V 
Sbjct: 33  NIAFHMNRLRSLSNTSNRGGKNGAVAGAVDVPIILKALYTYHAQSPGELSFNKGELFQV- 91

Query: 97  TKKSPQWYE--GRLNGKVGVFPTNYVKLYS 124
             +  +WYE      G+ G+ P +Y +  S
Sbjct: 92  NGEDGEWYEVTSTEGGRKGMVPKSYFEQVS 121

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.134    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 18,658,385
Number of extensions: 759520
Number of successful extensions: 2225
Number of sequences better than 10.0: 257
Number of HSP's gapped: 2202
Number of HSP's successfully gapped: 268
Length of query: 269
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 161
Effective length of database: 41,097,471
Effective search space: 6616692831
Effective search space used: 6616692831
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 65 (29.6 bits)