Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0D016705.525ON1018101850280.0
KAFR0E033105.525ON938100717330.0
Kpol_1028.825.525ON92584416140.0
Skud_4.6955.525ON95482216070.0
ZYRO0D12518g5.525ON88183115870.0
YDR421W (ARO80)5.525ON95081115920.0
Suva_2.5985.525ON96582115930.0
SAKL0G04884g5.525ON93081515850.0
Smik_4.6965.525ON94983715730.0
TDEL0A038905.525ON83180915610.0
NDAI0H015805.525ON90981015420.0
NCAS0F010705.525ON90481115040.0
TPHA0L003505.525ON85982914810.0
KLLA0A01804g5.525ON945101414650.0
KLTH0G03718g5.525ON85781713871e-176
KNAG0C032505.525ON93682213431e-169
ADR199C5.525ON94485812231e-151
CAGL0F03025g5.525ON92881911791e-145
TDEL0C044802.231ON852821211e-05
NDAI0D00900singletonON865501165e-05
KLTH0E16500g8.879ON833551156e-05
Kwal_27.96888.879ON841891157e-05
Kwal_56.230583.264ON7751051122e-04
AAL175W8.879ON883551112e-04
YIL130W (ASG1)2.231ON964621112e-04
Suva_9.592.231ON926621112e-04
Smik_9.392.231ON1012621112e-04
Skud_9.372.231ON954621102e-04
NCAS0B065502.231ON906661103e-04
TPHA0F013802.231ON890561084e-04
NCAS0D029606.75ON11721541085e-04
CAGL0G08844g2.231ON847511085e-04
KAFR0B063408.423ON864651085e-04
Kwal_47.168624.344ON743911076e-04
SAKL0E08998g2.231ON823641067e-04
NDAI0C002602.654ON1041621067e-04
KAFR0J017102.231ON848511068e-04
Ecym_53972.231ON826641068e-04
NDAI0B038502.231ON930621030.002
CAGL0I07755g3.109ON10531181030.002
TBLA0I025408.423ON1259651030.002
Smik_17.27singletonON688781030.002
KLTH0C07480g3.264ON775591030.002
Kpol_1039.112.231ON992731030.002
SAKL0D00264g8.879ON848531030.002
TBLA0E047504.344ON1283661030.002
ZYRO0E00572g2.654ON8381071020.002
KNAG0A044808.423ON1013651020.003
Ecym_33922.654ON847701010.003
NCAS0A03070singletonON656861010.003
KLTH0G09108g2.231ON782621010.003
Kwal_23.47542.231ON812611010.003
Smik_2.1512.547ON919861010.003
TPHA0B004104.344ON945431000.004
KNAG0A025508.423ON730601000.004
AER370W2.231ON801541000.004
CAGL0H06875g8.879ON70245990.004
TBLA0G026102.231ON1000571000.004
KNAG0E017602.231ON90251990.005
TPHA0L010608.423ON97352990.005
NDAI0I007406.279ON103380980.006
KLLA0F18084gna 1ON86061980.006
TBLA0A04280singletonON892116980.007
TBLA0H006808.423ON88099980.007
NCAS0C002208.879ON83949980.007
KAFR0E012503.264ON736104980.007
YBR297W (MAL33)na 2ON46846970.008
NDAI0K018002.547ON121048980.008
Skud_15.3346.61ON79092970.008
TBLA0E034803.109ON1046109970.009
KLLA0E19603g7.360ON68161970.009
Smik_12.2898.423ON81257970.009
KLLA0E18129g2.654ON86562970.009
KLLA0F04609g2.231ON91653970.009
SAKL0G19470g2.654ON83164970.010
TBLA0A007302.654ON103773970.010
KLLA0A04169g8.423ON77561960.010
KNAG0E041004.344ON90349960.011
KLLA0E02663gna 3ON110964960.012
CAGL0K11902g3.264ON83152960.012
KAFR0C039002.654ON81873960.013
TDEL0F054708.423ON81066950.014
KAFR0C03660singletonON84791950.015
KAFR0B014502.547ON108851950.017
KLTH0D16852g4.344ON81165940.018
Suva_8.2256.61ON801117940.018
KNAG0A071002.547ON128664940.019
Skud_12.2968.423ON81452940.020
TBLA0I018903.264ON82552940.021
Kpol_1061.113.264ON73352930.023
KLLA0F04213g3.264ON76850930.023
Smik_15.673.109ON1030141940.023
NDAI0F00110singletonON50853930.024
TBLA0C062306.60ON79548930.025
Ecym_81598.879ON90839930.025
Suva_16.25singletonON14346870.026
KNAG0E041507.17ON113659930.026
Smik_11.2402.654ON97657930.027
Kpol_538.427.17ON1088131930.027
NCAS0I002707.17ON94459930.028
NCAS0A150207.512ON80949930.028
YLR228C (ECM22)8.423ON81452930.029
AFR096W1.277ON85250920.030
Suva_10.3238.423ON81358920.031
CAGL0C01199g8.423ON92267920.032
NDAI0A034204.113ON110844920.034
NCAS0H034202.654ON90269920.035
ZYRO0C18150g1.128ON57193910.035
Kwal_26.81092.547ON97054920.040
KLLA0C10923g5.235ON77558910.042
SAKL0G17622gna 4ON67644910.043
KLTH0E05786gna 5ON81763910.043
TPHA0N011006.154ON39791900.044
TDEL0G04920singletonON69657910.046
ZYRO0G19338gna 6ON65360910.046
Ecym_63401.277ON95250910.046
Smik_10.251.128ON77281910.046
TPHA0B015854.344ON81251910.046
TDEL0D051503.109ON996152910.047
SAKL0G17908g4.344ON80951910.047
NCAS0H00780singletonON90948910.047
Smik_2.438na 2ON46945900.047
SAKL0D05654g1.277ON919103910.051
Kpol_1049.19na 7ON94349910.051
KAFR0L021308.879ON882130910.051
KLTH0D16456gna 4ON66170900.052
YJL206C1.128ON75872900.052
SAKL0H00682gna 8ON92251900.054
NDAI0J004407.512ON823126900.054
Skud_11.2142.654ON98157900.055
Kpol_1001.34.344ON85643900.056
Kpol_538.528.879ON90740900.057
TDEL0B004808.879ON83547900.057
TBLA0F012003.109ON1086109900.058
YKL015W (PUT3)2.654ON97951900.058
SAKL0H13024g8.423ON75457900.060
ZYRO0A10956g5.235ON85568900.060
CAGL0H04367g4.344ON94543900.061
TDEL0B074902.654ON865109900.061
KNAG0H012603.264ON74148900.062
TPHA0C049808.879ON85257900.064
Kwal_55.218847.512ON88253900.065
KNAG0M00120singletonON88146900.066
KLLA0C16489gna 9ON72841890.068
KAFR0C013203.109ON100646900.068
KNAG0J002108.879ON86142890.068
KAFR0C049807.17ON95166900.068
Smik_12.775.235ON90361890.074
CAGL0M02651g8.642ON46296880.078
Skud_10.101.128ON83395890.085
NCAS0D041906.279ON89057890.086
TDEL0E039105.235ON86244890.086
Skud_2.427na 2ON46845880.089
Smik_16.15singletonON46346880.090
KLTH0E14454gna 10ON90248880.095
ZYRO0A03058g3.264ON73650880.099
NCAS0B029308.416ON70145880.11
YMR280C (CAT8)8.845ON1433111880.11
NCAS0A094101.277ON93246880.11
ZYRO0B14718g4.344ON103545880.11
KLLA0F19602g8.283ON60343870.11
CAGL0L01903g2.547ON128745880.11
Ecym_1146na 4ON66542870.12
NDAI0G055301.277ON118665880.12
SAKL0D14542gna 11ON946125870.12
Kwal_26.7095na 12ON83855870.12
SAKL0A01386gna 13ON77062870.12
Smik_11.2102.547ON116963870.12
KAFR0A03060singletonON86048870.13
SAKL0D03586g3.264ON80148870.13
NCAS0A047502.547ON114148870.13
KLTH0D07260g2.547ON97951870.13
Suva_2.1873.264ON78452870.13
KLLA0B04620g4.344ON91945870.13
CAGL0H00396g7.512ON94043870.13
KAFR0G025406.60ON85598870.13
TBLA0D054201.277ON75750870.13
Kwal_14.9152.654ON82262870.14
Skud_15.5027.56ON75965870.14
ACL096W2.654ON83549870.14
Smik_4.4608.423ON91850870.14
NDAI0E034608.423ON94955870.14
TBLA0B062404.344ON143556870.14
KLLA0F14322g1.277ON71754870.15
Suva_11.2132.654ON98556870.15
KNAG0D052407.512ON86950870.15
NDAI0K001508.879ON95342870.15
KNAG0F037207.512ON76648860.15
KAFR0F014901.128ON65852860.15
KAFR0A014801.277ON72549860.15
SAKL0G11902g5.235ON90644860.15
YDR034C (LYS14)3.264ON79049860.16
TPHA0A016508.298ON532139860.16
CAGL0F07909g3.109ON104942860.16
Kpol_1009.56.75ON1178133860.16
Skud_20.3singletonON47046850.17
Kpol_1031.478.423ON89499860.17
KLLA0E20307g7.389ON111953860.17
Smik_4.2693.264ON77849860.18
YPR196WsingletonON47046850.18
ZYRO0D14432g6.75ON1170152860.19
NCAS0A035804.113ON111344860.19
YLR014C (PPR1)5.235ON90455860.19
AGL083W2.547ON85665860.19
KAFR0I002804.344ON936123860.20
TBLA0B04800singletonON77761850.20
Kpol_1042.66.60ON78087850.20
Skud_7.638singletonON47346850.20
Kpol_529.158.423ON94860860.20
NDAI0A087907.17ON105960860.20
Suva_15.415na 7ON86751850.20
ZYRO0A09350g8.423ON79350850.20
YKL038W (RGT1)2.547ON117063860.21
KLTH0D02222gna 12ON84750850.21
SAKL0D02596gna 14ON75042850.21
KAFR0H018008.423ON79455850.22
KNAG0J002508.845ON123747850.22
ZYRO0D08316gna 13ON68053850.23
Kwal_55.20722singletonON827103850.23
Kpol_1008.137.512ON90249850.24
NDAI0E038507.56ON76849850.25
CAGL0L09691g2.654ON82446850.26
Suva_2.3818.423ON91850850.26
AGL091W8.423ON86660840.27
Skud_4.4758.423ON913149840.27
KLLA0A03421gna 11ON88053840.28
Skud_12.5447.512ON88861840.28
Skud_4.2873.264ON78449840.28
KLLA0F25630g2.547ON100756840.29
CAGL0L03377g1.277ON120960840.30
Suva_6.2851.128ON78647840.30
NCAS0A016304.113ON104379840.30
SAKL0A09856g2.547ON102045840.32
Kwal_23.31228.423ON78852840.33
Kpol_1002.52.547ON95864840.33
TPHA0G003807.512ON87348840.34
TDEL0B063602.547ON98148840.34
NCAS0C027308.423ON77555830.35
KNAG0G021308.283ON63237830.35
Kpol_1057.32.651ON102767830.36
ZYRO0G17512gsingletonON52336830.36
KLTH0H16170gna 15ON61948830.38
CAGL0M12298g7.17ON99458830.38
KLTH0F07854g8.423ON78852830.38
Suva_15.773.109ON102961830.38
KLLA0A06039g1.199ON65743830.40
NCAS0A125802.547ON70460830.40
Skud_7.646singletonON46946820.41
KLLA0B04840gna 4ON77149830.42
Skud_7.627na 16ON47446820.43
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0D01670
         (1018 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0D01670 Chr4 complement(413360..416416) [3057 bp, 1018 aa] {...  1941   0.0  
KAFR0E03310 Chr5 complement(656129..658945) [2817 bp, 938 aa] {O...   672   0.0  
Kpol_1028.82 s1028 complement(183595..186372) [2778 bp, 925 aa] ...   626   0.0  
Skud_4.695 Chr4 (1233000..1235864) [2865 bp, 954 aa] {ON} YDR421...   623   0.0  
ZYRO0D12518g Chr4 (1055521..1058166) [2646 bp, 881 aa] {ON} simi...   615   0.0  
YDR421W Chr4 (1312040..1314892) [2853 bp, 950 aa] {ON}  ARO80Zin...   617   0.0  
Suva_2.598 Chr2 (1064757..1067654) [2898 bp, 965 aa] {ON} YDR421...   618   0.0  
SAKL0G04884g Chr7 (400351..403143) [2793 bp, 930 aa] {ON} simila...   615   0.0  
Smik_4.696 Chr4 (1232828..1235677) [2850 bp, 949 aa] {ON} YDR421...   610   0.0  
TDEL0A03890 Chr1 (695880..698375) [2496 bp, 831 aa] {ON} Anc_5.5...   605   0.0  
NDAI0H01580 Chr8 (382179..384908) [2730 bp, 909 aa] {ON} Anc_5.5...   598   0.0  
NCAS0F01070 Chr6 (211085..213799) [2715 bp, 904 aa] {ON} Anc_5.5...   583   0.0  
TPHA0L00350 Chr12 complement(47367..49946) [2580 bp, 859 aa] {ON}     575   0.0  
KLLA0A01804g Chr1 complement(159689..162526) [2838 bp, 945 aa] {...   568   0.0  
KLTH0G03718g Chr7 (292858..295431) [2574 bp, 857 aa] {ON} simila...   538   e-176
KNAG0C03250 Chr3 complement(635995..638805) [2811 bp, 936 aa] {O...   521   e-169
ADR199C Chr4 complement(1048528..1051362) [2835 bp, 944 aa] {ON}...   475   e-151
CAGL0F03025g Chr6 (295783..298569) [2787 bp, 928 aa] {ON} simila...   458   e-145
TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON} Anc_2.2...    51   1e-05
NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON}               49   5e-05
KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON} simi...    49   6e-05
Kwal_27.9688 s27 complement(21328..23853) [2526 bp, 841 aa] {ON}...    49   7e-05
Kwal_56.23058 s56 complement(381390..383717) [2328 bp, 775 aa] {...    48   2e-04
AAL175W Chr1 (32874..35525) [2652 bp, 883 aa] {ON} Non-syntenic ...    47   2e-04
YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc c...    47   2e-04
Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W (R...    47   2e-04
Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W (R...    47   2e-04
Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W (REAL)    47   2e-04
NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa] ...    47   3e-04
TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {O...    46   4e-04
NCAS0D02960 Chr4 complement(563406..566924) [3519 bp, 1172 aa] {...    46   5e-04
CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa] {...    46   5e-04
KAFR0B06340 Chr2 (1311310..1313904) [2595 bp, 864 aa] {ON} Anc_8...    46   5e-04
Kwal_47.16862 s47 complement(147009..149240) [2232 bp, 743 aa] {...    46   6e-04
SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa] {...    45   7e-04
NDAI0C00260 Chr3 (40019..43144) [3126 bp, 1041 aa] {ON} Anc_2.65...    45   7e-04
KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {...    45   8e-04
Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar t...    45   8e-04
NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {O...    44   0.002
CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa] ...    44   0.002
TBLA0I02540 Chr9 (590352..594131) [3780 bp, 1259 aa] {ON} Anc_8....    44   0.002
Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}...    44   0.002
KLTH0C07480g Chr3 (645219..647546) [2328 bp, 775 aa] {ON} simila...    44   0.002
Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON} (29727....    44   0.002
SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON...    44   0.002
TBLA0E04750 Chr5 (1222163..1226014) [3852 bp, 1283 aa] {ON} Anc_...    44   0.002
ZYRO0E00572g Chr5 (35940..38456) [2517 bp, 838 aa] {ON} similar ...    44   0.002
KNAG0A04480 Chr1 complement(626229..629270) [3042 bp, 1013 aa] {...    44   0.003
Ecym_3392 Chr3 (741359..743902) [2544 bp, 847 aa] {ON} similar t...    44   0.003
NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON}               44   0.003
KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly...    44   0.003
Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W...    44   0.003
Smik_2.151 Chr2 (282822..285581) [2760 bp, 919 aa] {ON} YBR033W ...    44   0.003
TPHA0B00410 Chr2 complement(84722..87559) [2838 bp, 945 aa] {ON}...    43   0.004
KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa] {O...    43   0.004
AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic ...    43   0.004
CAGL0H06875g Chr8 complement(682518..684626) [2109 bp, 702 aa] {...    43   0.004
TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {...    43   0.004
KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON} Anc_2.2...    43   0.005
TPHA0L01060 Chr12 (220857..223778) [2922 bp, 973 aa] {ON} Anc_8....    43   0.005
NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {...    42   0.006
KLLA0F18084g Chr6 complement(1652031..1654613) [2583 bp, 860 aa]...    42   0.006
TBLA0A04280 Chr1 complement(1059254..1061932) [2679 bp, 892 aa] ...    42   0.007
TBLA0H00680 Chr8 complement(144914..147556) [2643 bp, 880 aa] {O...    42   0.007
NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879       42   0.007
KAFR0E01250 Chr5 complement(249538..251748) [2211 bp, 736 aa] {O...    42   0.007
YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}  MAL33MAL-a...    42   0.008
NDAI0K01800 Chr11 (401055..404687) [3633 bp, 1210 aa] {ON} Anc_2...    42   0.008
Skud_15.334 Chr15 (602966..605338) [2373 bp, 790 aa] {ON} YOR172...    42   0.008
TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3....    42   0.009
KLLA0E19603g Chr5 complement(1739869..1741914) [2046 bp, 681 aa]...    42   0.009
Smik_12.289 Chr12 complement(540824..543262) [2439 bp, 812 aa] {...    42   0.009
KLLA0E18129g Chr5 (1613115..1615712) [2598 bp, 865 aa] {ON} simi...    42   0.009
KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa] {...    42   0.009
SAKL0G19470g Chr7 complement(1677759..1680254) [2496 bp, 831 aa]...    42   0.010
TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON} Anc_2....    42   0.010
KLLA0A04169g Chr1 complement(376273..378600) [2328 bp, 775 aa] {...    42   0.010
KNAG0E04100 Chr5 (814663..817374) [2712 bp, 903 aa] {ON} Anc_4.3...    42   0.011
KLLA0E02663g Chr5 (244696..248025) [3330 bp, 1109 aa] {ON} conse...    42   0.012
CAGL0K11902g Chr11 complement(1149210..1151705) [2496 bp, 831 aa...    42   0.012
KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON} Anc_2.6...    42   0.013
TDEL0F05470 Chr6 (1017743..1020175) [2433 bp, 810 aa] {ON} Anc_8...    41   0.014
KAFR0C03660 Chr3 complement(745068..747611) [2544 bp, 847 aa] {O...    41   0.015
KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON} Anc_2....    41   0.017
KLTH0D16852g Chr4 (1392572..1395007) [2436 bp, 811 aa] {ON} simi...    41   0.018
Suva_8.225 Chr8 (404288..406693) [2406 bp, 801 aa] {ON} YOR172W ...    41   0.018
KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]...    41   0.019
Skud_12.296 Chr12 complement(540407..542851) [2445 bp, 814 aa] {...    41   0.020
TBLA0I01890 Chr9 complement(423851..426328) [2478 bp, 825 aa] {O...    41   0.021
Kpol_1061.11 s1061 complement(31679..33880) [2202 bp, 733 aa] {O...    40   0.023
KLLA0F04213g Chr6 (400673..402979) [2307 bp, 768 aa] {ON} simila...    40   0.023
Smik_15.67 Chr15 complement(113506..116598) [3093 bp, 1030 aa] {...    41   0.023
NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON}                 40   0.024
TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON} Anc_6...    40   0.025
Ecym_8159 Chr8 (330207..332933) [2727 bp, 908 aa] {ON} similar t...    40   0.025
Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON} ...    38   0.026
KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {...    40   0.026
Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976 ...    40   0.027
Kpol_538.42 s538 complement(89752..93018) [3267 bp, 1088 aa] {ON...    40   0.027
NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}...    40   0.028
NCAS0A15020 Chr1 (2957420..2959849) [2430 bp, 809 aa] {ON} Anc_7...    40   0.028
YLR228C Chr12 complement(600019..602463) [2445 bp, 814 aa] {ON} ...    40   0.029
AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic ho...    40   0.030
Suva_10.323 Chr10 complement(566314..568755) [2442 bp, 813 aa] {...    40   0.031
CAGL0C01199g Chr3 complement(121944..124712) [2769 bp, 922 aa] {...    40   0.032
NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa] {...    40   0.034
NCAS0H03420 Chr8 complement(648059..650767) [2709 bp, 902 aa] {O...    40   0.035
ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some...    40   0.035
Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa] {O...    40   0.040
KLLA0C10923g Chr3 complement(939148..941475) [2328 bp, 775 aa] {...    40   0.042
SAKL0G17622g Chr7 complement(1525163..1527193) [2031 bp, 676 aa]...    40   0.043
KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly...    40   0.043
TPHA0N01100 Chr14 (231308..232501) [1194 bp, 397 aa] {ON} Anc_6....    39   0.044
TDEL0G04920 Chr7 complement(912754..914844) [2091 bp, 696 aa] {O...    40   0.046
ZYRO0G19338g Chr7 complement(1601895..1603856) [1962 bp, 653 aa]...    40   0.046
Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}...    40   0.046
Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}...    40   0.046
TPHA0B01585 Chr2 complement(352396..354834) [2439 bp, 812 aa] {ON}     40   0.046
TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.1...    40   0.047
SAKL0G17908g Chr7 (1552344..1554773) [2430 bp, 809 aa] {ON} simi...    40   0.047
NCAS0H00780 Chr8 complement(140472..143201) [2730 bp, 909 aa] {O...    40   0.047
Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W ...    39   0.047
SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly...    40   0.051
Kpol_1049.19 s1049 (38439..41270) [2832 bp, 943 aa] {ON} (38439....    40   0.051
KAFR0L02130 Chr12 (403953..406601) [2649 bp, 882 aa] {ON} Anc_8....    40   0.051
KLTH0D16456g Chr4 complement(1360294..1362279) [1986 bp, 661 aa]...    39   0.052
YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON} Pu...    39   0.052
SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON...    39   0.054
NDAI0J00440 Chr10 complement(78052..80523) [2472 bp, 823 aa] {ON...    39   0.054
Skud_11.214 Chr11 (389377..389855,389895..392361) [2946 bp, 981 ...    39   0.055
Kpol_1001.3 s1001 complement(9551..12121) [2571 bp, 856 aa] {ON}...    39   0.056
Kpol_538.52 s538 (126243..128966) [2724 bp, 907 aa] {ON} (126243...    39   0.057
TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879...    39   0.057
TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3....    39   0.058
YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}  PUT3Trans...    39   0.058
SAKL0H13024g Chr8 complement(1119585..1121849) [2265 bp, 754 aa]...    39   0.060
ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} simila...    39   0.060
CAGL0H04367g Chr8 complement(410256..413093) [2838 bp, 945 aa] {...    39   0.061
TDEL0B07490 Chr2 complement(1314447..1317044) [2598 bp, 865 aa] ...    39   0.061
KNAG0H01260 Chr8 (220201..222426) [2226 bp, 741 aa] {ON} Anc_3.2...    39   0.062
TPHA0C04980 Chr3 (1072547..1075105) [2559 bp, 852 aa] {ON} Anc_8...    39   0.064
Kwal_55.21884 s55 (1020057..1022705) [2649 bp, 882 aa] {ON} YLR4...    39   0.065
KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}      39   0.066
KLLA0C16489g Chr3 (1444456..1446642) [2187 bp, 728 aa] {ON} cons...    39   0.068
KAFR0C01320 Chr3 (273213..276233) [3021 bp, 1006 aa] {ON} Anc_3....    39   0.068
KNAG0J00210 Chr10 (26132..28717) [2586 bp, 861 aa] {ON} Anc_8.87...    39   0.068
KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.1...    39   0.068
Smik_12.77 Chr12 complement(159125..161836) [2712 bp, 903 aa] {O...    39   0.074
CAGL0M02651g Chr13 complement(304583..305971) [1389 bp, 462 aa] ...    39   0.078
Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}...    39   0.085
NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON} Anc_6.279     39   0.086
TDEL0E03910 Chr5 (732533..735121) [2589 bp, 862 aa] {ON} Anc_5.2...    39   0.086
Skud_2.427 Chr2 (769889..771295) [1407 bp, 468 aa] {ON} YGR288W ...    39   0.089
Smik_16.15 Chr16 complement(14421..15812) [1392 bp, 463 aa] {ON}...    39   0.090
KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]...    39   0.095
ZYRO0A03058g Chr1 (247954..250164) [2211 bp, 736 aa] {ON} simila...    39   0.099
NCAS0B02930 Chr2 (504501..506606) [2106 bp, 701 aa] {ON} Anc_8.416     39   0.11 
YMR280C Chr13 complement(827028..831329) [4302 bp, 1433 aa] {ON}...    39   0.11 
NCAS0A09410 Chr1 complement(1865924..1868722) [2799 bp, 932 aa] ...    39   0.11 
ZYRO0B14718g Chr2 (1196539..1199646) [3108 bp, 1035 aa] {ON} sim...    39   0.11 
KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]...    38   0.11 
CAGL0L01903g Chr12 (220700..224563) [3864 bp, 1287 aa] {ON} simi...    39   0.11 
Ecym_1146 Chr1 (302989..304986) [1998 bp, 665 aa] {ON} similar t...    38   0.12 
NDAI0G05530 Chr7 (1360413..1363973) [3561 bp, 1186 aa] {ON}            39   0.12 
SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]...    38   0.12 
Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C...    38   0.12 
SAKL0A01386g Chr1 (132287..134599) [2313 bp, 770 aa] {ON} conser...    38   0.12 
Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON} YKL03...    38   0.12 
KAFR0A03060 Chr1 complement(626316..628898) [2583 bp, 860 aa] {O...    38   0.13 
SAKL0D03586g Chr4 (290224..292629) [2406 bp, 801 aa] {ON} simila...    38   0.13 
NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2....    38   0.13 
KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa] {...    38   0.13 
Suva_2.187 Chr2 complement(320833..323187) [2355 bp, 784 aa] {ON...    38   0.13 
KLLA0B04620g Chr2 complement(413129..415888) [2760 bp, 919 aa] {...    38   0.13 
CAGL0H00396g Chr8 complement(37005..39827) [2823 bp, 940 aa] {ON...    38   0.13 
KAFR0G02540 Chr7 complement(524919..527486) [2568 bp, 855 aa] {O...    38   0.13 
TBLA0D05420 Chr4 complement(1334955..1337228) [2274 bp, 757 aa] ...    38   0.13 
Kwal_14.915 s14 (110216..112684) [2469 bp, 822 aa] {ON} YKL015W ...    38   0.14 
Skud_15.502 Chr15 (894741..897020) [2280 bp, 759 aa] {ON} YOR337...    38   0.14 
ACL096W Chr3 (169508..172015) [2508 bp, 835 aa] {ON} Syntenic ho...    38   0.14 
Smik_4.460 Chr4 (833609..836365) [2757 bp, 918 aa] {ON} YDR213W ...    38   0.14 
NDAI0E03460 Chr5 (742144..744993) [2850 bp, 949 aa] {ON} Anc_8.423     38   0.14 
TBLA0B06240 Chr2 complement(1469510..1473817) [4308 bp, 1435 aa]...    38   0.14 
KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON} unip...    38   0.15 
Suva_11.213 Chr11 (392506..392993,393045..395514) [2958 bp, 985 ...    38   0.15 
KNAG0D05240 Chr4 (953893..956502) [2610 bp, 869 aa] {ON} Anc_7.5...    38   0.15 
NDAI0K00150 Chr11 complement(20792..23653) [2862 bp, 953 aa] {ON...    38   0.15 
KNAG0F03720 Chr6 (695079..697379) [2301 bp, 766 aa] {ON} Anc_7.5...    38   0.15 
KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {O...    38   0.15 
KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON} Anc_1.2...    38   0.15 
SAKL0G11902g Chr7 (1016915..1019635) [2721 bp, 906 aa] {ON} simi...    38   0.15 
YDR034C Chr4 complement(509737..512109) [2373 bp, 790 aa] {ON}  ...    38   0.16 
TPHA0A01650 Chr1 (335768..337366) [1599 bp, 532 aa] {ON} Anc_8.2...    38   0.16 
CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some ...    38   0.16 
Kpol_1009.5 s1009 complement(10170..13706) [3537 bp, 1178 aa] {O...    38   0.16 
Skud_20.3 Chr20 (4504..5916) [1413 bp, 470 aa] {ON} YBR297W (REAL)     37   0.17 
Kpol_1031.47 s1031 (125242..127926) [2685 bp, 894 aa] {ON} (1252...    38   0.17 
KLLA0E20307g Chr5 (1806005..1809364) [3360 bp, 1119 aa] {ON} uni...    38   0.17 
Smik_4.269 Chr4 complement(491110..493446) [2337 bp, 778 aa] {ON...    38   0.18 
YPR196W Chr16 (931376..932788) [1413 bp, 470 aa] {ON} Putative m...    37   0.18 
ZYRO0D14432g Chr4 complement(1222977..1226489) [3513 bp, 1170 aa...    38   0.19 
NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa] {...    38   0.19 
YLR014C Chr12 complement(172268..174982) [2715 bp, 904 aa] {ON} ...    38   0.19 
AGL083W Chr7 (550291..552861) [2571 bp, 856 aa] {ON} Syntenic ho...    38   0.19 
KAFR0I00280 Chr9 complement(57061..59871) [2811 bp, 936 aa] {ON}...    38   0.20 
TBLA0B04800 Chr2 complement(1127000..1129333) [2334 bp, 777 aa] ...    37   0.20 
Kpol_1042.6 s1042 (9848..11548,11550..11612,11615..12193) [2343 ...    37   0.20 
Skud_7.638 Chr7 (1060062..1061483) [1422 bp, 473 aa] {ON} YFL052...    37   0.20 
Kpol_529.15 s529 complement(38664..41510) [2847 bp, 948 aa] {ON}...    38   0.20 
NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]...    38   0.20 
Suva_15.415 Chr15 (726296..728899) [2604 bp, 867 aa] {ON} YCR106...    37   0.20 
ZYRO0A09350g Chr1 (749695..752076) [2382 bp, 793 aa] {ON} simila...    37   0.20 
YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}  RGT1Gluc...    38   0.21 
KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly...    37   0.21 
SAKL0D02596g Chr4 (204347..206599) [2253 bp, 750 aa] {ON} conser...    37   0.21 
KAFR0H01800 Chr8 complement(333664..336048) [2385 bp, 794 aa] {O...    37   0.22 
KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.8...    37   0.22 
ZYRO0D08316g Chr4 (719929..721971) [2043 bp, 680 aa] {ON} conser...    37   0.23 
Kwal_55.20722 s55 (530982..533465) [2484 bp, 827 aa] {ON} YCR106...    37   0.23 
Kpol_1008.13 s1008 (21147..23855) [2709 bp, 902 aa] {ON} (21147....    37   0.24 
NDAI0E03850 Chr5 (846504..848810) [2307 bp, 768 aa] {ON} Anc_7.56      37   0.25 
CAGL0L09691g Chr12 complement(1041796..1044270) [2475 bp, 824 aa...    37   0.26 
Suva_2.381 Chr2 (669136..671892) [2757 bp, 918 aa] {ON} YDR213W ...    37   0.26 
AGL091W Chr7 (535317..537917) [2601 bp, 866 aa] {ON} Syntenic ho...    37   0.27 
Skud_4.475 Chr4 (844018..846759) [2742 bp, 913 aa] {ON} YDR213W ...    37   0.27 
KLLA0A03421g Chr1 (308414..311056) [2643 bp, 880 aa] {ON} weakly...    37   0.28 
Skud_12.544 Chr12 (969942..972608) [2667 bp, 888 aa] {ON} YLR451...    37   0.28 
Skud_4.287 Chr4 complement(501344..503698) [2355 bp, 784 aa] {ON...    37   0.28 
KLLA0F25630g Chr6 (2378464..2381487) [3024 bp, 1007 aa] {ON} som...    37   0.29 
CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]...    37   0.30 
Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C ...    37   0.30 
NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa] {...    37   0.30 
SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa] ...    37   0.32 
Kwal_23.3122 s23 complement(166388..168754) [2367 bp, 788 aa] {O...    37   0.33 
Kpol_1002.5 s1002 (11943..14819) [2877 bp, 958 aa] {ON} (11943.....    37   0.33 
TPHA0G00380 Chr7 complement(65673..68294) [2622 bp, 873 aa] {ON}       37   0.34 
TDEL0B06360 Chr2 complement(1127150..1130095) [2946 bp, 981 aa] ...    37   0.34 
NCAS0C02730 Chr3 (513280..515607) [2328 bp, 775 aa] {ON} Anc_8.423     37   0.35 
KNAG0G02130 Chr7 complement(482333..484231) [1899 bp, 632 aa] {O...    37   0.35 
Kpol_1057.3 s1057 (3619..6702) [3084 bp, 1027 aa] {ON} (3619..67...    37   0.36 
ZYRO0G17512g Chr7 complement(1447970..1449541) [1572 bp, 523 aa]...    37   0.36 
KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]...    37   0.38 
CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa...    37   0.38 
KLTH0F07854g Chr6 complement(677647..680013) [2367 bp, 788 aa] {...    37   0.38 
Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {...    37   0.38 
KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly...    37   0.40 
NCAS0A12580 Chr1 complement(2481447..2483561) [2115 bp, 704 aa] ...    37   0.40 
Skud_7.646 Chr7 (1073386..1074795) [1410 bp, 469 aa] {ON} YPR196...    36   0.41 
KLLA0B04840g Chr2 (439864..442179) [2316 bp, 771 aa] {ON} conser...    37   0.42 
Skud_7.627 Chr7 (1048240..1049664) [1425 bp, 474 aa] {ON} YBR297...    36   0.43 
Kpol_1018.92 s1018 (244116..247298) [3183 bp, 1060 aa] {ON} (244...    37   0.43 
Smik_15.350 Chr15 (610312..612666) [2355 bp, 784 aa] {ON} YOR172...    36   0.45 
TDEL0D01450 Chr4 (284869..287706) [2838 bp, 945 aa] {ON} Anc_1.2...    37   0.45 
YOR337W Chr15 (954344..956623) [2280 bp, 759 aa] {ON}  TEA1Ty1 e...    36   0.46 
NCAS0E02620 Chr5 complement(523279..526626) [3348 bp, 1115 aa] {...    37   0.46 
Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019...    36   0.46 
Suva_10.94 Chr10 complement(178366..181086) [2721 bp, 906 aa] {O...    36   0.49 
ZYRO0B03278g Chr2 (269277..272996) [3720 bp, 1239 aa] {ON} simil...    36   0.49 
Ecym_4144 Chr4 complement(306206..308728) [2523 bp, 840 aa] {ON}...    36   0.49 
Kwal_47.16939 s47 (180147..182156) [2010 bp, 669 aa] {ON} [conti...    36   0.49 
CAGL0D02904g Chr4 complement(302952..305615) [2664 bp, 887 aa] {...    36   0.51 
Kwal_23.6529 s23 (1627853..1629649) [1797 bp, 598 aa] {ON} YDR03...    36   0.51 
YGR288W Chr7 (1070293..1071714) [1422 bp, 473 aa] {ON}  MAL13MAL...    36   0.51 
YBL005W Chr2 (217470..220400) [2931 bp, 976 aa] {ON}  PDR3Transc...    36   0.53 
CAGL0F07865g Chr6 complement(768270..770804) [2535 bp, 844 aa] {...    36   0.54 
YML076C Chr13 complement(112513..115347) [2835 bp, 944 aa] {ON} ...    36   0.54 
TDEL0D03610 Chr4 (664819..666993) [2175 bp, 724 aa] {ON} Anc_3.2...    36   0.56 
KAFR0A02130 Chr1 (447063..449186) [2124 bp, 707 aa] {ON} Anc_2.5...    36   0.57 
Skud_12.82 Chr12 complement(164119..166818) [2700 bp, 899 aa] {O...    36   0.57 
TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {...    36   0.58 
Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON} (71447.....    36   0.59 
KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa] {...    35   0.61 
KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17 ...    36   0.62 
TPHA0M01040 Chr13 complement(202491..204803) [2313 bp, 770 aa] {...    36   0.63 
SAKL0C02024g Chr3 complement(174858..177554) [2697 bp, 898 aa] {...    36   0.64 
TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {...    36   0.64 
Ecym_4686 Chr4 complement(1336279..1339581) [3303 bp, 1100 aa] {...    36   0.65 
ZYRO0D01650g Chr4 complement(131688..134270) [2583 bp, 860 aa] {...    36   0.66 
Smik_12.549 Chr12 (964956..967616) [2661 bp, 886 aa] {ON} YLR451...    36   0.67 
ZYRO0D14080g Chr4 (1191418..1194183) [2766 bp, 921 aa] {ON} weak...    36   0.67 
KLTH0C00814g Chr3 (76637..79141) [2505 bp, 834 aa] {ON} similar ...    36   0.68 
KLTH0C00880g Chr3 complement(85841..89098) [3258 bp, 1085 aa] {O...    36   0.69 
KLTH0G07898g Chr7 (636890..639490) [2601 bp, 866 aa] {ON} simila...    36   0.69 
ZYRO0A00440g Chr1 complement(27895..30447) [2553 bp, 850 aa] {ON...    36   0.69 
Kwal_23.2905 s23 (69235..71880) [2646 bp, 881 aa] {ON} YLR014C (...    36   0.70 
Suva_8.387 Chr8 (696078..698357) [2280 bp, 759 aa] {ON} YOR337W ...    36   0.70 
KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {...    36   0.70 
Skud_13.43 Chr13 complement(73880..76522) [2643 bp, 880 aa] {ON}...    36   0.71 
Smik_13.493 Chr13 complement(810035..814336) [4302 bp, 1433 aa] ...    36   0.71 
KLLA0D00484g Chr4 (44879..47893) [3015 bp, 1004 aa] {ON} conserv...    36   0.71 
Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {...    36   0.71 
KAFR0A06690 Chr1 complement(1354262..1357255) [2994 bp, 997 aa] ...    36   0.72 
Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 ...    36   0.72 
KLLA0C08657g Chr3 (757100..759268) [2169 bp, 722 aa] {ON} some s...    36   0.74 
Ecym_7239 Chr7 (501580..504774) [3195 bp, 1064 aa] {ON} similar ...    36   0.74 
NDAI0I02190 Chr9 (501867..504074) [2208 bp, 735 aa] {ON} Anc_6.6...    36   0.75 
YDR213W Chr4 (889751..892492) [2742 bp, 913 aa] {ON}  UPC2Sterol...    36   0.76 
KLLA0D10593g Chr4 complement(900326..903103) [2778 bp, 925 aa] {...    36   0.76 
NDAI0D00220 Chr4 complement(43353..46187) [2835 bp, 944 aa] {ON}...    36   0.77 
Ecym_5131 Chr5 (278980..281292) [2313 bp, 770 aa] {ON} similar t...    35   0.78 
ADR405C Chr4 complement(1435702..1438125) [2424 bp, 807 aa] {ON}...    35   0.78 
ZYRO0C13882g Chr3 complement(1093041..1095542) [2502 bp, 833 aa]...    35   0.81 
Kwal_YGOB_gneas1 s33 complement(285483..287042) [1560 bp, 519 aa...    35   0.81 
Suva_13.49 Chr13 complement(75704..78352) [2649 bp, 882 aa] {ON}...    35   0.81 
NCAS0H00270 Chr8 complement(45600..48320) [2721 bp, 906 aa] {ON}...    35   0.82 
Smik_15.515 Chr15 (903950..906229) [2280 bp, 759 aa] {ON} YOR337...    35   0.82 
KNAG0A02300 Chr1 (214177..216363) [2187 bp, 729 aa] {ON}  gene e...    35   0.83 
CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa]...    35   0.84 
Smik_13.36 Chr13 complement(71547..74189) [2643 bp, 880 aa] {ON}...    35   0.84 
YML099C Chr13 complement(74398..77040) [2643 bp, 880 aa] {ON}  A...    35   0.84 
YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putat...    35   0.86 
TPHA0C02180 Chr3 complement(493972..496632) [2661 bp, 886 aa] {O...    35   0.86 
Suva_10.569 Chr10 (990917..992962,992995..993603) [2655 bp, 884 ...    35   0.91 
NCAS0A06190 Chr1 (1226184..1228868) [2685 bp, 894 aa] {ON} Anc_4...    35   0.92 
Ecym_4635 Chr4 complement(1238691..1241261) [2571 bp, 856 aa] {O...    35   0.96 
KLTH0F18392g Chr6 (1484590..1487211) [2622 bp, 873 aa] {ON} simi...    35   0.97 
Skud_4.469 Chr4 complement(831562..834189) [2628 bp, 875 aa] {ON...    35   0.98 
YNR063W Chr14 (746943..748766) [1824 bp, 607 aa] {ON} Putative z...    35   0.98 
YOL089C Chr15 complement(150398..153490) [3093 bp, 1030 aa] {ON}...    35   0.98 
Kpol_534.28 s534 (64772..66079) [1308 bp, 435 aa] {ON} (64772..6...    35   1.00 
SAKL0F15444g Chr6 (1243590..1246484) [2895 bp, 964 aa] {ON} simi...    35   1.0  
YLR451W Chr12 (1036093..1038753) [2661 bp, 886 aa] {ON}  LEU3Zin...    35   1.1  
Smik_18.3 Chr18 complement(3105..5219) [2115 bp, 704 aa] {ON} YK...    35   1.1  
NDAI0A05750 Chr1 complement(1302180..1304459) [2280 bp, 759 aa] ...    35   1.1  
TBLA0G00730 Chr7 complement(165589..167994) [2406 bp, 801 aa] {O...    35   1.1  
Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON} YKL03...    35   1.1  
TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON} Anc_8....    35   1.1  
TBLA0F02920 Chr6 (700340..703111) [2772 bp, 923 aa] {ON} Anc_7.5...    35   1.1  
Kwal_56.22605 s56 (200072..202669) [2598 bp, 865 aa] {ON} YOL089...    35   1.2  
SAKL0H25146g Chr8 complement(2185695..2187632) [1938 bp, 645 aa]...    35   1.2  
Ecym_7203 Chr7 (415869..418523) [2655 bp, 884 aa] {ON} similar t...    35   1.2  
AGL099C Chr7 complement(516587..518830) [2244 bp, 747 aa] {ON} S...    35   1.2  
KLTH0A06644g Chr1 complement(553084..555270) [2187 bp, 728 aa] {...    35   1.2  
KLLA0A03443g Chr1 (311628..314555) [2928 bp, 975 aa] {ON} simila...    35   1.2  
Smik_4.453 Chr4 complement(820614..823172) [2559 bp, 852 aa] {ON...    35   1.2  
KAFR0J00690 Chr10 (124449..127043) [2595 bp, 864 aa] {ON} Anc_5....    35   1.2  
YDR207C Chr4 complement(865012..867522) [2511 bp, 836 aa] {ON}  ...    35   1.3  
Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON} YKL03...    35   1.3  
Suva_13.468 Chr13 complement(809712..812654,812694..814007) [425...    35   1.3  
Skud_13.452 Chr13 complement(800289..804587) [4299 bp, 1432 aa] ...    35   1.3  
SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa] ...    35   1.3  
KLLA0F10835g Chr6 (997512..999782) [2271 bp, 756 aa] {ON} conser...    35   1.3  
Smik_23.3 Chr23 complement(4675..6111) [1437 bp, 478 aa] {ON} YB...    35   1.4  
TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON} Anc_...    35   1.4  
Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}...    35   1.4  
ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly...    35   1.4  
KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa] {O...    35   1.4  
NCAS0A10550 Chr1 (2100725..2102950) [2226 bp, 741 aa] {ON} Anc_3...    35   1.5  
KLTH0D01804g Chr4 complement(173650..175608) [1959 bp, 652 aa] {...    35   1.5  
TPHA0E00880 Chr5 complement(177030..180164) [3135 bp, 1044 aa] {...    35   1.5  
KNAG0B02380 Chr2 complement(466392..469595) [3204 bp, 1067 aa] {...    35   1.5  
NCAS0C04780 Chr3 (974254..976998) [2745 bp, 914 aa] {ON}               35   1.6  
NDAI0D01770 Chr4 (411567..413924) [2358 bp, 785 aa] {ON} Anc_5.322     35   1.6  
NDAI0B01540 Chr2 complement(359639..362050) [2412 bp, 803 aa] {O...    35   1.6  
NDAI0I01940 Chr9 (450330..454112) [3783 bp, 1260 aa] {ON} Anc_6.75     35   1.6  
ZYRO0A13596g Chr1 complement(1080653..1082599) [1947 bp, 648 aa]...    35   1.6  
KLTH0F03300g Chr6 complement(283918..285474) [1557 bp, 518 aa] {...    34   1.6  
TDEL0G04890 Chr7 (903504..903581,903640..905316) [1755 bp, 584 a...    34   1.7  
NDAI0I02350 Chr9 (536448..539117) [2670 bp, 889 aa] {ON} Anc_5.235     35   1.7  
NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {O...    35   1.7  
NDAI0C04840 Chr3 (1117201..1120047) [2847 bp, 948 aa] {ON} Anc_8...    35   1.7  
AER183C Chr5 complement(975879..978518) [2640 bp, 879 aa] {ON} N...    35   1.7  
TDEL0D00820 Chr4 (151394..153451) [2058 bp, 685 aa] {ON}               34   1.7  
KLTH0C10516g Chr3 (871091..872776) [1686 bp, 561 aa] {ON} simila...    34   1.8  
Ecym_2263 Chr2 (518089..519615) [1527 bp, 508 aa] {ON} similar t...    34   1.8  
KLTH0E06116g Chr5 complement(553784..556297) [2514 bp, 837 aa] {...    34   1.8  
TDEL0D00730 Chr4 complement(129036..131456) [2421 bp, 806 aa] {O...    34   1.8  
ZYRO0G21626g Chr7 complement(1781790..1783031) [1242 bp, 413 aa]...    34   1.8  
NDAI0D03180 Chr4 (759984..762953) [2970 bp, 989 aa] {ON} Anc_4.3...    34   1.8  
NCAS0A12720 Chr1 (2510574..2512853) [2280 bp, 759 aa] {ON} Anc_2...    34   1.8  
NCAS0A03570 Chr1 complement(708718..711654) [2937 bp, 978 aa] {O...    34   1.8  
TDEL0H00590 Chr8 complement(101024..103477) [2454 bp, 817 aa] {O...    34   1.9  
NDAI0A03410 Chr1 complement(778569..781511) [2943 bp, 980 aa] {O...    34   1.9  
ZYRO0G15136g Chr7 complement(1218989..1222072) [3084 bp, 1027 aa...    34   1.9  
KLTH0C06776g Chr3 complement(586976..590140) [3165 bp, 1054 aa] ...    34   1.9  
TBLA0G01800 Chr7 complement(469668..473132) [3465 bp, 1154 aa] {...    34   2.1  
Kpol_455.10 s455 (12074..14566) [2493 bp, 830 aa] {ON} (12074..1...    34   2.1  
Kpol_1018.30 s1018 complement(81534..83840,83842..84180) [2646 b...    34   2.2  
KLTH0E03256g Chr5 complement(294997..297021) [2025 bp, 674 aa] {...    34   2.3  
Smik_12.157 Chr12 complement(317470..319404) [1935 bp, 644 aa] {...    34   2.3  
Kwal_27.10852 s27 complement(526456..529596) [3141 bp, 1046 aa] ...    34   2.3  
KLLA0E18195g Chr5 complement(1622300..1625701) [3402 bp, 1133 aa...    34   2.4  
Skud_13.66 Chr13 complement(111847..114666) [2820 bp, 939 aa] {O...    34   2.4  
Kpol_1023.41 s1023 (88566..91013) [2448 bp, 815 aa] {ON} (88566....    34   2.5  
TPHA0I02820 Chr9 complement(620925..624059) [3135 bp, 1044 aa] {...    34   2.5  
Sklu_YGOB_gneas1 Chr3 complement(352893..354335) [1443 bp, 480 a...    34   2.6  
TDEL0C01580 Chr3 complement(272178..275687) [3510 bp, 1169 aa] {...    34   2.7  
KAFR0L01720 Chr12 (313720..316545) [2826 bp, 941 aa] {ON} Anc_7....    34   2.7  
Ecym_1135 Chr1 complement(276229..278697) [2469 bp, 822 aa] {ON}...    34   2.7  
TDEL0H03950 Chr8 (674423..676411) [1989 bp, 662 aa] {ON} Anc_7.5...    34   2.8  
TBLA0H03910 Chr8 complement(943931..946234) [2304 bp, 767 aa] {O...    34   2.8  
ZYRO0G12584g Chr7 complement(996642..998702) [2061 bp, 686 aa] {...    34   2.9  
NDAI0A01040 Chr1 complement(220931..223918) [2988 bp, 995 aa] {O...    34   2.9  
Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920 ...    34   2.9  
YOR172W Chr15 (654210..656570) [2361 bp, 786 aa] {ON}  YRM1Zn2-C...    34   2.9  
Ecym_5015 Chr5 (29616..32099) [2484 bp, 827 aa] {ON} similar to ...    33   3.0  
NCAS0H01260 Chr8 (238877..240499) [1623 bp, 540 aa] {ON} Anc_6.152     33   3.1  
SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa] {...    33   3.1  
Kpol_1016.20 s1016 (51828..55088) [3261 bp, 1086 aa] {ON} (51828...    34   3.1  
TPHA0F02540 Chr6 (556797..559178) [2382 bp, 793 aa] {ON} Anc_6.6...    33   3.1  
KLLA0F00572g Chr6 complement(42710..44503) [1794 bp, 597 aa] {ON...    33   3.3  
Kpol_463.14 s463 (38999..40429) [1431 bp, 476 aa] {ON} (38999..4...    33   3.3  
KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa] ...    33   3.3  
Smik_13.64 Chr13 complement(110338..113172) [2835 bp, 944 aa] {O...    33   3.4  
Kwal_26.6664 s26 complement(11094..12833) [1740 bp, 579 aa] {ON}...    33   3.5  
TPHA0F00830 Chr6 complement(188299..191877) [3579 bp, 1192 aa] {...    33   3.6  
KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} simil...    33   3.6  
Smik_16.20 Chr16 complement(26236..27657) [1422 bp, 473 aa] {ON}...    33   3.7  
KAFR0A04940 Chr1 (975356..978913) [3558 bp, 1185 aa] {ON} Anc_6....    33   3.8  
YDR520C Chr4 complement(1481085..1483403) [2319 bp, 772 aa] {ON}...    33   3.8  
ADR403C Chr4 complement(1429115..1432027) [2913 bp, 970 aa] {ON}...    33   3.8  
KAFR0G03520 Chr7 complement(728360..729694) [1335 bp, 444 aa] {O...    33   3.8  
NCAS0E02310 Chr5 (452368..454524) [2157 bp, 718 aa] {ON} Anc_7.56      33   3.8  
Ecym_4286 Chr4 (613587..615470) [1884 bp, 627 aa] {ON} similar t...    33   3.9  
Kwal_23.6425 s23 (1574518..1576725) [2208 bp, 735 aa] {ON} YKL22...    33   3.9  
TPHA0N00440 Chr14 complement(82249..84522) [2274 bp, 757 aa] {ON...    33   4.1  
AFR171W Chr6 (752589..754427) [1839 bp, 612 aa] {ON} NOHBY629; N...    33   4.1  
KAFR0B07080 Chr2 complement(1480370..1482397) [2028 bp, 675 aa] ...    33   4.1  
Suva_4.265 Chr4 (467625..470438) [2814 bp, 937 aa] {ON} YBR033W ...    33   4.3  
CAGL0J07150g Chr10 complement(688858..691926) [3069 bp, 1022 aa]...    33   4.3  
KLTH0B09262g Chr2 (758773..761235) [2463 bp, 820 aa] {ON} weakly...    33   4.3  
KLTH0H05720g Chr8 (505672..507006) [1335 bp, 444 aa] {ON} simila...    33   4.4  
YFL052W Chr6 (28232..29629) [1398 bp, 465 aa] {ON} Putative zinc...    33   4.4  
Suva_2.701 Chr2 complement(1233963..1236344) [2382 bp, 793 aa] {...    33   4.4  
Ecym_4153 Chr4 complement(330831..333281) [2451 bp, 816 aa] {ON}...    33   4.5  
KAFR0B00100 Chr2 (2110..4137) [2028 bp, 675 aa] {ON}                   33   4.6  
Smik_6.15 Chr6 (22860..24260) [1401 bp, 466 aa] {ON} YFL052W (REAL)    33   4.6  
SAKL0G02992g Chr7 (243859..247044) [3186 bp, 1061 aa] {ON} conse...    33   4.7  
KLTH0A07766g Chr1 (654163..655980) [1818 bp, 605 aa] {ON} conser...    33   4.7  
SAKL0D14520g Chr4 complement(1192788..1195739) [2952 bp, 983 aa]...    33   4.8  
ZYRO0D14058g Chr4 (1188615..1190891) [2277 bp, 758 aa] {ON} simi...    33   4.8  
Kwal_14.931 s14 complement(119423..122608) [3186 bp, 1061 aa] {O...    33   5.0  
NCAS0D02540 Chr4 complement(484060..486732) [2673 bp, 890 aa] {O...    33   5.1  
KLTH0D03564g Chr4 (343546..346134) [2589 bp, 862 aa] {ON} weakly...    33   5.2  
Skud_4.795 Chr4 complement(1401165..1403492) [2328 bp, 775 aa] {...    33   5.2  
KNAG0B01840 Chr2 (345204..348422) [3219 bp, 1072 aa] {ON} Anc_1....    33   5.4  
CAGL0E05434g Chr5 (532814..535264) [2451 bp, 816 aa] {ON} simila...    33   5.6  
NDAI0F02030 Chr6 complement(499614..501464) [1851 bp, 616 aa] {O...    33   5.6  
NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {...    33   5.6  
KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa] ...    33   5.7  
KAFR0B02820 Chr2 complement(576317..578311) [1995 bp, 664 aa] {O...    33   5.7  
YLL054C Chr12 complement(32673..35204) [2532 bp, 843 aa] {ON} Pu...    33   6.0  
NCAS0B02860 Chr2 complement(488982..491591) [2610 bp, 869 aa] {O...    33   6.0  
ZYRO0E05676g Chr5 complement(439616..442816) [3201 bp, 1066 aa] ...    33   6.1  
Suva_8.421 Chr8 complement(757924..760932) [3009 bp, 1002 aa] {O...    33   6.2  
KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa] {...    33   6.3  
KLLA0D11286g Chr4 complement(964642..966678) [2037 bp, 678 aa] {...    33   6.3  
CAGL0F05357g Chr6 (541830..543635) [1806 bp, 601 aa] {ON} some s...    33   6.3  
Suva_13.76 Chr13 complement(113974..116811) [2838 bp, 946 aa] {O...    33   6.3  
ADR365W Chr4 (1355407..1357512) [2106 bp, 701 aa] {ON} Syntenic ...    33   6.5  
YBR033W Chr2 (301944..304703) [2760 bp, 919 aa] {ON}  EDS1Putati...    33   6.6  
ZYRO0C18282g Chr3 (1431515..1433665) [2151 bp, 716 aa] {ON} cons...    32   6.8  
TDEL0E00160 Chr5 (16083..17978) [1896 bp, 631 aa] {ON}                 32   7.0  
TDEL0E03050 Chr5 (575425..577893) [2469 bp, 822 aa] {ON} Anc_5.3...    32   7.3  
TBLA0C01910 Chr3 complement(448085..448684,448765..451611) [3447...    32   7.4  
CAGL0M05907g Chr13 (622029..624704) [2676 bp, 891 aa] {ON} simil...    32   7.5  
ZYRO0B00242g Chr2 (12202..14118) [1917 bp, 638 aa] {ON} conserve...    32   7.7  
KNAG0B05120 Chr2 (982236..984902) [2667 bp, 888 aa] {ON}               32   7.8  
YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}  OAF1Oleate-...    32   7.9  
Skud_2.145 Chr2 (271582..274335) [2754 bp, 917 aa] {ON} YBR033W ...    32   8.1  
TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON}                32   8.3  
NCAS0F00370 Chr6 complement(61819..65148) [3330 bp, 1109 aa] {ON...    32   8.8  
Ecym_3395 Chr3 complement(750356..753481) [3126 bp, 1041 aa] {ON...    32   8.9  
KLLA0D00396g Chr4 complement(36277..37362) [1086 bp, 361 aa] {ON...    32   9.7  
KLLA0C17050g Chr3 (1490472..1493339) [2868 bp, 955 aa] {ON} cons...    32   9.9  
Smik_4.801 Chr4 complement(1403910..1406225) [2316 bp, 771 aa] {...    32   9.9  
KNAG0F02830 Chr6 (536483..538723) [2241 bp, 746 aa] {ON}               32   9.9  
YIL128W Chr9 (113806..116904) [3099 bp, 1032 aa] {ON}  MET18DNA ...    32   10.0 

>TBLA0D01670 Chr4 complement(413360..416416) [3057 bp, 1018 aa] {ON}
            Anc_5.525 YDR421W
          Length = 1018

 Score = 1941 bits (5028), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 944/1018 (92%), Positives = 944/1018 (92%)

Query: 1    MFLKELRLSKRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKRE 60
            MFLKELRLSKRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKRE
Sbjct: 1    MFLKELRLSKRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKRE 60

Query: 61   ARDCIFDEPLKKLGTVENENDSIDDNQRVPNSPEDEIQQNTDIIQERISSIVATNESRFN 120
            ARDCIFDEPLKKLGTVENENDSIDDNQRVPNSPEDEIQQNTDIIQERISSIVATNESRFN
Sbjct: 61   ARDCIFDEPLKKLGTVENENDSIDDNQRVPNSPEDEIQQNTDIIQERISSIVATNESRFN 120

Query: 121  NDISNSQKHERKDKPSERKSNLKVNFTNMRNALEFLANAAGQAAXXXXXXXXXXXXXXXX 180
            NDISNSQKHERKDKPSERKSNLKVNFTNMRNALEFLANAAGQAA                
Sbjct: 121  NDISNSQKHERKDKPSERKSNLKVNFTNMRNALEFLANAAGQAAEERLSEEEEELNNKFE 180

Query: 181  XXXXDDHISIDSPATQSTTSTDSVKHLDLSDESIASLFLSENETNRKKVTSLIEAVIAAR 240
                DDHISIDSPATQSTTSTDSVKHLDLSDESIASLFLSENETNRKKVTSLIEAVIAAR
Sbjct: 181  KELNDDHISIDSPATQSTTSTDSVKHLDLSDESIASLFLSENETNRKKVTSLIEAVIAAR 240

Query: 241  PISNRKLTDYDYIGKSKMISEFEAIQLINAFFLTMHPFYPYLPDQLQDPHELARYPILLC 300
            PISNRKLTDYDYIGKSKMISEFEAIQLINAFFLTMHPFYPYLPDQLQDPHELARYPILLC
Sbjct: 241  PISNRKLTDYDYIGKSKMISEFEAIQLINAFFLTMHPFYPYLPDQLQDPHELARYPILLC 300

Query: 301  TILTISSRHHKFNELGTYNGVNDKRHIDVHEKLWVYCQKMISQTVWAEASTRSLGTVLAF 360
            TILTISSRHHKFNELGTYNGVNDKRHIDVHEKLWVYCQKMISQTVWAEASTRSLGTVLAF
Sbjct: 301  TILTISSRHHKFNELGTYNGVNDKRHIDVHEKLWVYCQKMISQTVWAEASTRSLGTVLAF 360

Query: 361  LLFTEWNPRAIHWKWADYANNPKLNDFSTSDTGINDYLKVGKRTTGLGAIRRSDRMAWML 420
            LLFTEWNPRAIHWKWADYANNPKLNDFSTSDTGINDYLKVGKRTTGLGAIRRSDRMAWML
Sbjct: 361  LLFTEWNPRAIHWKWADYANNPKLNDFSTSDTGINDYLKVGKRTTGLGAIRRSDRMAWML 420

Query: 421  CGTSVRIAQDMGFIENSSNVFVATHTSETFHAMNVGQRSSLNESLNDTYYSQGRMSSYRN 480
            CGTSVRIAQDMGFIENSSNVFVATHTSETFHAMNVGQRSSLNESLNDTYYSQGRMSSYRN
Sbjct: 421  CGTSVRIAQDMGFIENSSNVFVATHTSETFHAMNVGQRSSLNESLNDTYYSQGRMSSYRN 480

Query: 481  KQQQTLKNEIFYIENIFSENFKITERNYWKSQLQXXXXXXXXXXXXXALSDKVRGFLNDE 540
            KQQQTLKNEIFYIENIFSENFKITERNYWKSQLQ             ALSDKVRGFLNDE
Sbjct: 481  KQQQTLKNEIFYIENIFSENFKITERNYWKSQLQENIENKIDIDDKIALSDKVRGFLNDE 540

Query: 541  FALFYSNGNDPTYSNERNNQPYSSFSTLPLPVNLSKSQQANIELLRIFSTAYKTIYSRXX 600
            FALFYSNGNDPTYSNERNNQPYSSFSTLPLPVNLSKSQQANIELLRIFSTAYKTIYSR  
Sbjct: 541  FALFYSNGNDPTYSNERNNQPYSSFSTLPLPVNLSKSQQANIELLRIFSTAYKTIYSRNQ 600

Query: 601  XXXXXXXXXXXXISLLDIFAPLLHNWTIAFGDLLQPSDVCEPINLXXXXXXXXXXEFNKI 660
                        ISLLDIFAPLLHNWTIAFGDLLQPSDVCEPINL          EFNKI
Sbjct: 601  NQKLSSNNQSHNISLLDIFAPLLHNWTIAFGDLLQPSDVCEPINLNNRNNKRVVKEFNKI 660

Query: 661  IEGESLICDYNYCQLYIFSLALQIGLDGEILTVNEITKSSTYINLAYQSAKEYILSTERV 720
            IEGESLICDYNYCQLYIFSLALQIGLDGEILTVNEITKSSTYINLAYQSAKEYILSTERV
Sbjct: 661  IEGESLICDYNYCQLYIFSLALQIGLDGEILTVNEITKSSTYINLAYQSAKEYILSTERV 720

Query: 721  FTLKMLKYMPVRWLTRLIRATAFLVKCYLSVAGTDQELNSISEINMIFKLGGTSANEVLE 780
            FTLKMLKYMPVRWLTRLIRATAFLVKCYLSVAGTDQELNSISEINMIFKLGGTSANEVLE
Sbjct: 721  FTLKMLKYMPVRWLTRLIRATAFLVKCYLSVAGTDQELNSISEINMIFKLGGTSANEVLE 780

Query: 781  LIKKSAILLGSSSPDELHLCSRYSSIIMCFYKEMSEKNLTRKRGSTDKHNAIEELNKIRQ 840
            LIKKSAILLGSSSPDELHLCSRYSSIIMCFYKEMSEKNLTRKRGSTDKHNAIEELNKIRQ
Sbjct: 781  LIKKSAILLGSSSPDELHLCSRYSSIIMCFYKEMSEKNLTRKRGSTDKHNAIEELNKIRQ 840

Query: 841  HXXXXXXXXXXXXXXXXXRVSSDTIRTKTNNFNQINLTRTTKGRPEVALDTEAQASHRKN 900
            H                 RVSSDTIRTKTNNFNQINLTRTTKGRPEVALDTEAQASHRKN
Sbjct: 841  HKKQKLLQKEYKKKTYKKRVSSDTIRTKTNNFNQINLTRTTKGRPEVALDTEAQASHRKN 900

Query: 901  LQTQTAADESALSTSPSISEVGSKNSNQSLMQLTSQIEVGTSSDLGPTNRDLLSYNTRET 960
            LQTQTAADESALSTSPSISEVGSKNSNQSLMQLTSQIEVGTSSDLGPTNRDLLSYNTRET
Sbjct: 901  LQTQTAADESALSTSPSISEVGSKNSNQSLMQLTSQIEVGTSSDLGPTNRDLLSYNTRET 960

Query: 961  SPNTGHTGVTGEPTGSHANEFLDWFSASGDIGLEFVESWTEMLEQRYMKDDDNLLFNN 1018
            SPNTGHTGVTGEPTGSHANEFLDWFSASGDIGLEFVESWTEMLEQRYMKDDDNLLFNN
Sbjct: 961  SPNTGHTGVTGEPTGSHANEFLDWFSASGDIGLEFVESWTEMLEQRYMKDDDNLLFNN 1018

>KAFR0E03310 Chr5 complement(656129..658945) [2817 bp, 938 aa] {ON}
            Anc_5.525 YDR421W
          Length = 938

 Score =  672 bits (1733), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/1007 (40%), Positives = 554/1007 (55%), Gaps = 110/1007 (10%)

Query: 18   KGKSVR----WRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKL 73
            +GKS++    WRRSYKAC+NCR +KVKCDLGP +NPH PPCVRCKRE R+C+F    KK 
Sbjct: 6    QGKSLKTESKWRRSYKACLNCRARKVKCDLGPYDNPHPPPCVRCKREQRECLFTSRRKK- 64

Query: 74   GTVENENDSIDDNQRVPNSPEDEIQQNTDIIQERISSIVATNESRFNNDISNSQKHERKD 133
                 ++D I     + N P    Q++ +   +RI     +++       SNS K+    
Sbjct: 65   -----KDDVISGTVSLTNVPSAITQEDDN---DRIQLNSGSSKGAL---FSNSPKNPN-- 111

Query: 134  KPSERKSNLKVNFTNMRNALEFLANAAGQAAXXXXXXXXXXXXXXXXXXXXDDHISID-- 191
              ++ +S  K    +M+N LEFLA AAG  +                     +   +D  
Sbjct: 112  --TQDQSKWKYGLGSMQNTLEFLATAAGSVSKESNRRLTTARHSHQYAKETSEDFRVDDS 169

Query: 192  SPATQSTTSTDSVKHLDLSDESIASLFLSENETNRKKVTSLIEAVIAARPISNRKLTDYD 251
            SP+++    TD+      S++S+ +  L E  T R  V SLIE +   RP  N+KL D D
Sbjct: 170  SPSSERKDITDT------SEQSVIAPLLKECGTQRATV-SLIEELSRVRPKPNKKLADID 222

Query: 252  YIGKSKMISEFEAIQLINAFFLTMHPFYPYLPDQLQDPHELARYPILLCTILTISSRHHK 311
            YIG S ++SE EA +LI+A+FLTMHPF+P +P QLQDP EL  YPILLC ILT+SSR+H 
Sbjct: 223  YIGPSNLLSEQEARELIDAYFLTMHPFFPNIPLQLQDPDELVNYPILLCAILTMSSRYHP 282

Query: 312  FNELGTYNGVNDKRHIDVHEKLWVYCQKMISQTVWAEASTRSLGTVLAFLLFTEWNPRAI 371
            F+E G YNG N+KR+I+VHE LW YCQ++ISQTVWAEASTRS+GTVLAF++FTEWNPR I
Sbjct: 283  FSEFGFYNGENNKRNIEVHETLWDYCQRLISQTVWAEASTRSIGTVLAFIIFTEWNPRQI 342

Query: 372  HWKWADYANNPKLNDFSTSDTGINDYLKVGKRTTGLGAIRRSDRMAWMLCGTSVRIAQDM 431
            HW+  DYAN+      +  DT +    K     TG+GAIRRSDRM+WML G++VR+AQDM
Sbjct: 343  HWRRTDYANS------AEKDTDVPHSQKDDDGLTGIGAIRRSDRMSWMLTGSAVRLAQDM 396

Query: 432  GFIENSSNVFVATHTSETFHAMNVGQRSSLNESLNDTYYSQGRMSSYRNKQQQT----LK 487
            GFIE S+ +FVA+H S+TF +MN+ QR +L+E+ +   +  GR  +     +QT    + 
Sbjct: 397  GFIETSTKIFVASHISDTFASMNMNQRCALSETFSVVGFGAGRERASAIDSEQTDVDEVG 456

Query: 488  NEIFYIENIFSENFKITERNYWKSQLQXXXXXXXXXXXXXALSDKVRGFLNDEFALFYSN 547
            NE FY+E +  +N +  ER  W   L+              L+D  R FLNDE+ L+Y+N
Sbjct: 457  NEKFYLEQML-QNEESRER--WTRVLE--RLQHNNDKKNGPLTDLEREFLNDEYVLYYAN 511

Query: 548  GNDPTYSNERNNQPYSSFSTLPLPVNLSKSQQANIELLRIFSTAYKTIYSRXXXXXXXXX 607
                     RN++       LP P+  S  Q+A IEL+RI   AY TIY           
Sbjct: 512  ---------RNDEMVQQHLQLPFPLKFSFHQRAKIELIRIILIAYDTIYYDKGKRKLTSN 562

Query: 608  XXXXXISLLDIFAPLLHNWTIAFGDLLQPSDVCEPINLXXXXXXXXXXEFNKIIEGESLI 667
                 +++L I +PL+  W   + +LL+ S   +P ++          E  + I  ES++
Sbjct: 563  DQVHNLAVLGILSPLIEGWYATYRNLLKISS-GQPYSIEIRKNKRAVHELGEEINRESIL 621

Query: 668  CDYNYCQLYIFSLALQIGLDGEILTVNEITKSSTYINLAYQSAKEYILSTERVFTLKMLK 727
             DY YCQLYI+SLALQ+ + G  L +NE TKS+ Y+ LAY +AKE ++S+ RV  LKMLK
Sbjct: 622  SDYYYCQLYIYSLALQVDVKGPKLRINEATKSAKYVELAYVAAKEILISSTRVHRLKMLK 681

Query: 728  YMPVRWLTRLIRATAFLVKCYLSVAGTDQELNSISEINMIFKLGGTSANEVLELIKKSAI 787
            YMPVRW+ R++RA +FLVKCYL++ G     N  SE   I KL   S +E +  I+ +A+
Sbjct: 682  YMPVRWVMRIVRAVSFLVKCYLTLTGGGGVPN--SEAQTILKLCCISLDETIHTIRLAAL 739

Query: 788  LLGSSSPDELHLCSRYSSIIMCFYKEMSEKNLTRKRGST--DKHNAIEELNKIRQHXXXX 845
            +L  +SPDELHLC RYS+I++   KEM   NL  KR       H  +  +N+ R      
Sbjct: 740  ILKEASPDELHLCVRYSAILLYLCKEM---NLKSKRNQKLLVSHGIL--INESRNRQMGS 794

Query: 846  XXXXXXXXXXXXXRVSSDTIRTKTNNFNQINLTRTTKGRPEVALDTEAQASHRKNLQTQT 905
                           + D+   ++NN    N   TT G      +TE             
Sbjct: 795  RRTKATQDSDIDLGSTDDSKNIQSNNELLPNNISTTNGLTTSLFNTE------------- 841

Query: 906  AADESALSTSPSISEVGSKNSNQSLMQLTSQIEVGTSSDLGPTNRDLLSYNTRETSPNTG 965
                          E+ S+  NQ       +I     +D  P N D           N G
Sbjct: 842  --------------EMRSETPNQ-------RIPTSAVADNTPNNLD-----------NDG 869

Query: 966  HTGVTGEPTGSHANEFLDWFSASGDIGLEFVESWTEMLEQRYMKDDD 1012
                T  P  S  +E +DWFS S DIGL+FVE WTE+LEQR+++  D
Sbjct: 870  TNNPTNFP--SLPDEAIDWFSGSADIGLDFVEPWTELLEQRFLQSGD 914

>Kpol_1028.82 s1028 complement(183595..186372) [2778 bp, 925 aa]
           {ON} complement(183595..186372) [2778 nt, 926 aa]
          Length = 925

 Score =  626 bits (1614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/844 (41%), Positives = 502/844 (59%), Gaps = 60/844 (7%)

Query: 6   LRLSKRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCI 65
           + LSKR   ++S  +  +WRRSY+AC+NCR +K+KCDLGPL+NPH PPCVRCKRE R+CI
Sbjct: 1   MSLSKRPLSEESGNQGTKWRRSYRACVNCRSRKIKCDLGPLDNPHKPPCVRCKREQRECI 60

Query: 66  FDEPLKKLGTVENENDSIDDNQRVPNSPEDEIQQNTDIIQERISSIVATNESRFNNDI-- 123
           F  P+ K   V           ++ N    E++++       ISSI+   + +  N    
Sbjct: 61  F--PVTKRRDV---------TAKINNMKGSELERSI------ISSILPDVDKKSLNGGGS 103

Query: 124 --SNSQKHERKDKPSERKSNLKVNFTNMRNALEFLANAAGQAAXXXXXXXXXXXXXXXXX 181
             S+ +++  + KP++  SN + + + M+ ALEFLANA G  +                 
Sbjct: 104 AGSDLKQNNIRKKPTD--SNWQSDISTMQTALEFLANAVGVISKSDTRSLLNLNQNNTLI 161

Query: 182 XXXDDHISIDSPATQSTTSTDSVKHLDLSD----ESIASLF-LSENETNRKKVTSLIEAV 236
              D        A  S  + D+ + +  SD    +S  S+F L  ++T  K ++ L+  +
Sbjct: 162 ENED--------ADDSNPNNDNSEDVSRSDSNTPKSRNSIFSLIHDDTASKVISPLMGTI 213

Query: 237 IAARPISNRKLTDYDYIGKSKMISEFEAIQLINAFFLTMHPFYPYLPDQLQDPHELARYP 296
            + RP   R L+D +YIG +K+++E EA  LIN FFLTMHP++PY+P QL +P EL RYP
Sbjct: 214 ESIRPKPTRNLSDIEYIGPNKLLTEDEARTLINVFFLTMHPYFPYIPLQLHNPDELVRYP 273

Query: 297 ILLCTILTISSRHHKFNELGTYNGVNDKRHIDVHEKLWVYCQKMISQTVWAEASTRSLGT 356
           ILLC ILT+SSR++ FNE+   N     R+I VHEKLW YCQ++IS T+WAEASTRS+GT
Sbjct: 274 ILLCAILTVSSRYNSFNEIFINNEYEKDRNIVVHEKLWFYCQRLISNTIWAEASTRSIGT 333

Query: 357 VLAFLLFTEWNPRAIHWKWADYANNPKLNDFSTSDTGINDYLKVGKRTTGLGAIRRSDRM 416
           +LAFLLFTEWNPRAIHW W+DY NNP+L  F+ ++       K G++TTG  A+R SDRM
Sbjct: 334 ILAFLLFTEWNPRAIHWTWSDYGNNPELTCFTKNNENNMSEFK-GEKTTGFEAMRHSDRM 392

Query: 417 AWMLCGTSVRIAQDMGFIENSSNVFVATHTSETFHAMNVGQRSSLNESLNDTYYSQGRMS 476
           AWM  G++VR+AQDM FI+N+  +F+ATH SETF+AMNV QRS+L++SL++   S  R  
Sbjct: 393 AWMFTGSAVRLAQDMHFIDNNYKIFMATHISETFNAMNVNQRSTLSDSLSNINLSITRSH 452

Query: 477 SYRNKQQ------QTLKNEIFYIENIFSENFKITERNYWKSQLQXXXXXXXXXXXXXALS 530
              N  +      +   NE +Y+E I   +     +  W   L+              ++
Sbjct: 453 GKNNDDEEGHIFAENFGNEQYYLEQILKHD---KSKEKWIKFLK-EINSNKSSENSTVIT 508

Query: 531 DKVRGFLNDEFALFYSNGN---DPTYSNERNNQPYSSFSTLPLPVNLSKSQQANIELLRI 587
           D  R +LNDE+ L+Y N N    PT+ N        + ++LP P+  +   +A IE+LRI
Sbjct: 509 DAEREYLNDEYILYYQNNNPETQPTWGNHS-----VTSTSLPYPLKFASFHKAKIEILRI 563

Query: 588 FSTAYKTIYSRXXXXXXXXXXXXXXISLLDIFAPLLHNWTIAFGDLLQPSDVCEPINLXX 647
            S AY+TIYS               +++L IF+PL+ +W      LL+  + C P ++  
Sbjct: 564 MSIAYETIYSAKNKRVLAFNNQRQNLAVLSIFSPLIESWYSNHHGLLKLFE-CAPCDMSK 622

Query: 648 XXXXXXXXEFNKIIEGESLICDYNYCQLYIFSLALQIGLDGEILTVNEITKSSTYINLAY 707
                   + ++ IE ESLI DY YCQLYI+SLAL++ +    L ++EITKS+ Y+ +AY
Sbjct: 623 YKDKNTVQKLSQAIEKESLIGDYYYCQLYIYSLALKVDIKDNNLNLSEITKSAKYVYMAY 682

Query: 708 QSAKEYILSTERVFTLKMLKYMPVRWLTRLIRATAFLVKCYLSVAGTDQELNSISEINMI 767
            +AKE + S  RV  LK+L+Y+PVRW+TR++R+ AF+VKC+L +  T+ E +  SEIN I
Sbjct: 683 NAAKEILTSAVRVNKLKLLRYLPVRWVTRILRSVAFIVKCFLLL--TESETSENSEINAI 740

Query: 768 FKLGGTSANEVLELIKKSAILLGSSSPDELHLCSRYSSIIMCFYKEMSEK--NLTRKRGS 825
            +L G   +E LELI+ +++ L  +SPDELHLC RYSSI++   KE+  K  NL    G 
Sbjct: 741 IRLSGIPVDEALELIETTSVTLNDASPDELHLCKRYSSILLYMCKELRNKTQNLYMNEGV 800

Query: 826 TDKH 829
             K 
Sbjct: 801 AAKQ 804

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 39/67 (58%), Gaps = 7/67 (10%)

Query: 953  LSYNTRETSPNTG--HTGVTGEP-----TGSHANEFLDWFSASGDIGLEFVESWTEMLEQ 1005
            L  NT E     G  H G+   P     + S   E +DWFS+S DIGLEFVESWTEM+EQ
Sbjct: 842  LPINTTEQIAIVGNEHHGIEQTPILNPNSMSFQGEVIDWFSSSADIGLEFVESWTEMIEQ 901

Query: 1006 RYMKDDD 1012
             Y++  D
Sbjct: 902  MYLRSSD 908

>Skud_4.695 Chr4 (1233000..1235864) [2865 bp, 954 aa] {ON} YDR421W
           (REAL)
          Length = 954

 Score =  623 bits (1607), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/822 (42%), Positives = 491/822 (59%), Gaps = 60/822 (7%)

Query: 10  KRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEP 69
           KR S +    +  + RR+Y+ACINCR +KVKCDLGP++NPH+PPC RCKRE +DC F   
Sbjct: 4   KRRSSENEAHELPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKDCSF--- 60

Query: 70  LKKLGTVENENDSIDDNQRVPNSPEDEIQQNTDIIQERISSIVATNESRFNNDISNSQKH 129
                +   E +    N  +  + +  + ++   I+ R +S +         D++ S K 
Sbjct: 61  ----SSTRGETNGTSPNM-ITAASKTFLSKSEQQIRNRSTSPITA-------DMTLSGK- 107

Query: 130 ERKDKPSERKSNLKVNF--TNMRNALEFLANAAGQAAXXXXXXXXXXXXXXXXXXXXDDH 187
           E  ++ S +   +K  F  ++M+NALEFLA AAG  A                       
Sbjct: 108 ETGNETSFKSEGVKWKFELSSMQNALEFLAQAAGTVAKEGAKEIIEDKSATPRPL----- 162

Query: 188 ISIDSPATQSTTSTDS-VKHLDLSD----------ESIASLFLSENETNRKKVTSLIEAV 236
             +D   T   ++TD  +K L   D          E++ ++  +    NR   + LI  +
Sbjct: 163 --VDPLDTSHQSATDGGLKRLSRGDSAASATCTPHENVTAMLAASLNANRT-TSQLIREI 219

Query: 237 IAARPISNRKLTDYDYIGKSKMISEFEAIQLINAFFLTMHPFYPYLPDQLQDPHELARYP 296
              RP   RK+ D+DYIG   ++++ EAI+LI AFFLTMHPF+P +P QL DP ELA YP
Sbjct: 220 SGVRPSPTRKIEDFDYIGPDNLLTKEEAIELIEAFFLTMHPFFPNIPLQLHDPKELAEYP 279

Query: 297 ILLCTILTISSRHHKFNELGTYNGVNDKRHIDVHEKLWVYCQKMISQTVWAEASTRSLGT 356
           IL C ILT+S+R+H+F+ LG YNG N  RHI+VH+KLWVYCQK+ISQT+WAEASTRS+GT
Sbjct: 280 ILFCAILTVSARYHRFDTLGLYNGENGLRHIEVHDKLWVYCQKLISQTIWAEASTRSIGT 339

Query: 357 VLAFLLFTEWNPRAIHWKWADYANNPKLNDFSTSDTGINDYLKVGKRTTGLGAIRRSDRM 416
           VLAF++FTEWNPR+IH+KW+DYAN+P+LN+ +   +      K  +  TG+GAIRRSDRM
Sbjct: 340 VLAFIIFTEWNPRSIHYKWSDYANDPELNNVNVRGSKNICTRKDEEGLTGVGAIRRSDRM 399

Query: 417 AWMLCGTSVRIAQDMGFIENSSNVFVATHTSETFHAMNVGQRSSLNESLNDTYYSQGRM- 475
           +WML G++VR+AQDMGFIENSS +F+ TH SET  AMN+ QRS L ES +    +  +  
Sbjct: 400 SWMLTGSAVRLAQDMGFIENSSKIFIVTHISETTSAMNMNQRSLLAESFSVLNLNLEKFD 459

Query: 476 SSYRNKQQQTLKNEIFYIENIFSENFKITERNYWKSQLQXXXXXXXXXXXXXALSDKVRG 535
           S  +   +    NE FY++ I   N +I +R  WK   +              L+D  R 
Sbjct: 460 SDGKENNENYFGNEKFYLDEILP-NDEIKKR--WKGVFEDSADASDNEKYL--LTDWERE 514

Query: 536 FLNDEFALFYSNGNDPTYSNERNNQPYSSFSTLPLPVNLSKSQQANIELLRIFSTAYKTI 595
           FLNDE+ L+YSN ND T +  +N+ P       P P+  S +Q+A IE++RI S AY+TI
Sbjct: 515 FLNDEYVLYYSNKNDDT-NLAQNHTP-------PFPLRFSFAQRAKIEIIRILSIAYETI 566

Query: 596 YSRXXXXXXXXXXXXXXISLLDIFAPLLHNWTIAFGDLLQP-SDVCEPINLXXXXXXXXX 654
           Y                +S+L IF+PL+  W   + ++L P SDV  P +L         
Sbjct: 567 YCEKNKRKLATTDQRHNLSVLSIFSPLMEGWLSNYREVLVPLSDV--PFSLADRKNKKQV 624

Query: 655 XEFNKIIEGESLICDYNYCQLYIFSLALQIGLDGEI--LTVNEITKSSTYINLAYQSAKE 712
            +    I GES+I D+NYCQLYIFSLALQ+  DG+I  L +NEI  S+ Y+ LAY+SAKE
Sbjct: 625 FDNIDRINGESIITDFNYCQLYIFSLALQV--DGKISRLNMNEIVTSARYVELAYRSAKE 682

Query: 713 YILSTERVFTLKMLKYMPVRWLTRLIRATAFLVKCYLSVAGTDQELNSISEINMIFKLGG 772
            + S +RV    MLK+MPVRW+ R+IR+ AF+VKCYL++ G+  EL +  +   I KL  
Sbjct: 683 ILGSAKRVSRQAMLKFMPVRWVIRIIRSIAFIVKCYLTLTGS--ELATNPDARNILKLSA 740

Query: 773 TSANEVLELIKKSAILLGSSSPDELHLCSRYSSIIMCFYKEM 814
            S +E  +L++ +A+ L  ++PDELHLC RY++I+M    EM
Sbjct: 741 ISVDETFDLMRDTAVTLKEATPDELHLCQRYAAILMYLCTEM 782

 Score = 58.2 bits (139), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 32/45 (71%), Gaps = 2/45 (4%)

Query: 976  SHANEFLDWFSASGDIGLEFVESWTEMLEQRYMK--DDDNLLFNN 1018
            S + E  DWF AS DIGLEFVE WTE++EQRYM+  D DN  F N
Sbjct: 886  SLSEEVTDWFGASEDIGLEFVEPWTELIEQRYMQCGDGDNNNFEN 930

>ZYRO0D12518g Chr4 (1055521..1058166) [2646 bp, 881 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421W ARO80
           Zinc finger transcriptional activator of the Zn2Cys6
           family activates transcription of aromatic amino acid
           catabolic genes in the presence of aromatic amino acids
          Length = 881

 Score =  615 bits (1587), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/831 (40%), Positives = 472/831 (56%), Gaps = 110/831 (13%)

Query: 17  SKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLK----- 71
           S     +WRR YKACI+CR KK+KCD+GPL+NPH PPC+RC+RE ++CI  E  +     
Sbjct: 11  SGSNPTKWRRIYKACISCRNKKMKCDMGPLDNPHGPPCMRCRRENKECILPENKRRGNTD 70

Query: 72  ---KLGTVEN----------ENDSIDDNQRVPNSPEDEIQQNTDIIQERISSIVATNESR 118
              KLG +EN             S+    R P  P      N D++  +           
Sbjct: 71  TEFKLGKIENGLVGVMNKSESEQSLLSQTRAP-PPNGSTSNNLDLVDPK----------- 118

Query: 119 FNNDISNSQKHERKDKPSERKSNLKVNFTNMRNALEFLANAAGQAAXXXXXXXXXXXXXX 178
                                   K     M NALEFLA AAG  +              
Sbjct: 119 -----------------------WKFEIGTMYNALEFLAKAAGSVSK------------- 142

Query: 179 XXXXXXDDHISIDSPATQSTTS-------------TDSVKHLDLSDESIASLFLSENETN 225
                 ++ I + SP  +S                +D++ +LD+SDES  +   + N + 
Sbjct: 143 ------EEPIEMKSPQNRSDLGVGNMPDTALNGVMSDNIGNLDISDESFLAPLTTANGSQ 196

Query: 226 RKKVTSLIEAVIAARPISNRKLTDYDYIGKSKMISEFEAIQLINAFFLTMHPFYPYLPDQ 285
           R     LIE + + RP S++KL D DYIG SK++SE EA +LI+ FFLTMHPF+P++P Q
Sbjct: 197 RA-AAPLIEKLSSMRPKSSKKLIDVDYIGPSKLLSEDEATRLIDIFFLTMHPFFPHIPLQ 255

Query: 286 LQDPHELARYPILLCTILTISSRHHKFNELGTYNGVNDKRHIDVHEKLWVYCQKMISQTV 345
           LQDP EL RYPILLC ILTIS+R++ F ELG Y+G    R+I+VHE+LW+YCQ++ISQT+
Sbjct: 256 LQDPDELVRYPILLCAILTISARYNPFGELGFYDGEAHNRNIEVHERLWIYCQRLISQTI 315

Query: 346 WAEASTRSLGTVLAFLLFTEWNPRAIHWKWADYANNPKLNDFSTSDTGINDYLKVGKRTT 405
           WAEASTRS+GTVLAFLLFTEWNPRAIHWKW+DYANNP+LND +  +T   +  +  +  T
Sbjct: 316 WAEASTRSIGTVLAFLLFTEWNPRAIHWKWSDYANNPELNDVTKRETHGANTPRDTETFT 375

Query: 406 GLGAIRRSDRMAWMLCGTSVRIAQDMGFIENSSNVFVATHTSETFHAMNVGQRSSLNESL 465
           G+ A+RRSDRMAWML G +VR+AQDM FI+ SS +FVATH +E   AMN+ Q+S L+ESL
Sbjct: 376 GMAAVRRSDRMAWMLIGAAVRLAQDMSFIDTSSKIFVATHIAEAHTAMNLNQKSILSESL 435

Query: 466 NDTYYSQGRMSSYRNKQQQTLKNEIFYIENIFSENFKITERNYWKSQLQXXXXXXXXXXX 525
           ++       ++    ++   + NE FY+E+I  ++     +  W + LQ           
Sbjct: 436 SE-------VNREVLERLDDIGNENFYLEHILQKD---ESKERWTNFLQ-NVSEGRRAKG 484

Query: 526 XXALSDKVRGFLNDEFALFYSNGNDPTYSNERNNQPYSSFSTLPLPVNLSKSQQANIELL 585
              L+D  R FLNDE+ L+Y N         RN+    S  TLP P+  S  Q+A IELL
Sbjct: 485 TGPLTDMEREFLNDEYVLYYVNA--------RNDASSKSSLTLPFPLKFSHPQRAKIELL 536

Query: 586 RIFSTAYKTIY--SRXXXXXXXXXXXXXXISLLDIFAPLLHNWTIAFGDLLQPSDVCEPI 643
           RI +  Y++IY  S               ++LL+I + L+  W   + DLL P++   P 
Sbjct: 537 RILTIGYESIYYESEKDKTQLINGNPKRNLALLEIISTLIEKWHATYKDLLIPANAT-PC 595

Query: 644 NLXXXXXXXXXXEFNKIIEGESLICDYNYCQLYIFSLALQIGLDGEILTVNEITKSSTYI 703
           +L          E  + I+ ESL CDYNYCQLYI+SLALQ  +    L + EI KS+ Y+
Sbjct: 596 SLDMARNKRAVHELTQQIDRESLSCDYNYCQLYIYSLALQNDVKNMDLKMPEIRKSARYV 655

Query: 704 NLAYQSAKEYILSTERVFTLKMLKYMPVRWLTRLIRATAFLVKCYLSVAGTDQELNSISE 763
            LAY++A+  + S ER+ +LKML+YMPVRW+TR++RA AFLVKCYL +       N ++ 
Sbjct: 656 ELAYRAAEGILDSAERIHSLKMLRYMPVRWVTRIVRAVAFLVKCYLVLTKDGLAANPVA- 714

Query: 764 INMIFKLGGTSANEVLELIKKSAILLGSSSPDELHLCSRYSSIIMCFYKEM 814
              I +L    + E + +I+++A+ L  ++PDE+HL  RYS I+     E+
Sbjct: 715 -GTILRLTVIPSEETVPIIERAAVTLQEAAPDEVHLGMRYSKILKFLCAEV 764

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 26/30 (86%)

Query: 982  LDWFSASGDIGLEFVESWTEMLEQRYMKDD 1011
             D F+AS DIGL+FV++WTEM+E RYM+D+
Sbjct: 841  FDLFAASDDIGLDFVDTWTEMIENRYMQDE 870

>YDR421W Chr4 (1312040..1314892) [2853 bp, 950 aa] {ON}  ARO80Zinc
           finger transcriptional activator of the Zn2Cys6 family;
           activates transcription of aromatic amino acid catabolic
           genes in the presence of aromatic amino acids
          Length = 950

 Score =  617 bits (1592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/811 (43%), Positives = 474/811 (58%), Gaps = 72/811 (8%)

Query: 25  RRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLGTVENENDSID 84
           RR+Y+ACI+CR +KVKCDLGP++NPH PPC RCKRE + CIF           N+  S  
Sbjct: 19  RRTYQACISCRSRKVKCDLGPVDNPHDPPCARCKRELKKCIFSS---------NKGTS-- 67

Query: 85  DNQRVPNSPEDEIQQNTDIIQERISSIVATNESRFNNDISN-SQKHERKDKPSERKS--- 140
            N   PNS               I++I   +  +   +I N S      D P  RK    
Sbjct: 68  -NDLPPNS---------------INAISLPSLGKSKQEIQNDSTSPILSDVPLSRKGISS 111

Query: 141 ---------NLKVNFTNMRNALEFLANAAGQAAXXXXXXXXXXXXXXXXXXXXDDHISID 191
                      K+  ++M+NALEFLA AAG  A                        S+D
Sbjct: 112 EKSFKSEGMKWKLELSSMQNALEFLAQAAGTVAKEGAKEIIKEKSTTPKPLKS----SLD 167

Query: 192 SPATQSTTSTDSVKHLDLSD------ESIASLFLSENETNRKKVTSLIEAVIAARPISNR 245
             AT  + + + +K L  SD      E+ A +      TNRK  + L+E +   RP   R
Sbjct: 168 --ATNKSATDEGLKRLSKSDSTNTLYENTADMLNHTLNTNRK-TSQLMEEIGKVRPPPTR 224

Query: 246 KLTDYDYIGKSKMISEFEAIQLINAFFLTMHPFYPYLPDQLQDPHELARYPILLCTILTI 305
           K+ D+DYIG   ++++ EAI+LI AFFLTMHPF+P +P QL DP ELA YPIL C ILT+
Sbjct: 225 KIDDFDYIGPDSLLTKEEAIELIEAFFLTMHPFFPNIPLQLHDPKELAEYPILFCAILTV 284

Query: 306 SSRHHKFNELGTYNGVNDKRHIDVHEKLWVYCQKMISQTVWAEASTRSLGTVLAFLLFTE 365
           S+R+H F+ LG  NG +  RHI+VH+KLWVYCQK+ISQT+WAEASTRS+GTVLAF++FTE
Sbjct: 285 SARYHPFDTLGLDNGEDGMRHIEVHDKLWVYCQKLISQTIWAEASTRSIGTVLAFIIFTE 344

Query: 366 WNPRAIHWKWADYANNPKLNDFSTSDTGINDYLKVGKRTTGLGAIRRSDRMAWMLCGTSV 425
           WNPR+IH+KW+DYAN+P+LN+ +   +      K  +  TG+GAIRRSDRM+WML G++V
Sbjct: 345 WNPRSIHYKWSDYANDPELNNVNARGSKNISTRKDEEGLTGVGAIRRSDRMSWMLTGSAV 404

Query: 426 RIAQDMGFIENSSNVFVATHTSETFHAMNVGQRSSLNESLNDTYYSQGRMSSYRNKQQQT 485
           R+AQDMGFIENSS VF+ TH SET  AMN+ QRS L ES +    + G++ +  N+  + 
Sbjct: 405 RLAQDMGFIENSSKVFIVTHISETTSAMNMNQRSLLAESFSVLNLNLGKIENDGNESNED 464

Query: 486 -LKNEIFYIENIFSENFKITERNYWKSQLQXXXXXXXXXXXXXALSDKVRGFLNDEFALF 544
            L NE FY+  I  +      +  WK   +              L+D  R FLNDE+ L+
Sbjct: 465 YLGNEKFYLNEILPDE---ESKLRWKRVFENSENDHDNEKNF--LTDWEREFLNDEYVLY 519

Query: 545 YSNGNDPTYSNERNNQPYSSFSTLPLPVNLSKSQQANIELLRIFSTAYKTIYSRXXXXXX 604
           YSN  D T +  +N+ P       P P+  S +Q+A IE++RI S AY+TIY        
Sbjct: 520 YSNKKDDT-NLAQNHIP-------PFPLRFSFAQRAKIEIIRILSIAYETIYCEKNKRKL 571

Query: 605 XXXXXXXXISLLDIFAPLLHNWTIAFGDLLQP-SDVCEPINLXXXXXXXXXXEFNKIIEG 663
                   +S+L +F+PL+  W   + +LL P SDV  P +L          +    I G
Sbjct: 572 ATTDQRHNLSVLSVFSPLIEGWLSNYRELLVPLSDV--PFSLADRKNKKQIFDNIDRING 629

Query: 664 ESLICDYNYCQLYIFSLALQIGLDGEILTVNEITKSSTYINLAYQSAKEYILSTERVFTL 723
           ES+I D+NYCQLYIFSLALQ+      L +NEI  S+ Y+ LAY+SAKE + S +RV   
Sbjct: 630 ESIITDFNYCQLYIFSLALQVDGKTSRLNMNEIVTSARYVELAYRSAKEILSSAKRVSRQ 689

Query: 724 KMLKYMPVRWLTRLIRATAFLVKCYLSVAGTDQELNSISEINMIFKLGGTSANEVLELIK 783
            MLKYMPVRW+ R+IR+ AF+VKCYL++ G+  EL +  +   I KL   S +E  ++I+
Sbjct: 690 GMLKYMPVRWVIRIIRSIAFIVKCYLTLTGS--ELATNPDARNILKLSAISVDETFDIIR 747

Query: 784 KSAILLGSSSPDELHLCSRYSSIIMCFYKEM 814
            +A+ L  ++PDELHLC RY++I+M    EM
Sbjct: 748 DTAVTLKEATPDELHLCQRYAAILMYLCTEM 778

 Score = 58.9 bits (141), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 33/45 (73%), Gaps = 2/45 (4%)

Query: 976  SHANEFLDWFSASGDIGLEFVESWTEMLEQRYMK--DDDNLLFNN 1018
            S ++E  DWF AS DIGLEFVE WTE++EQRYM+  D DN  F N
Sbjct: 882  SLSDEVTDWFGASEDIGLEFVEPWTELIEQRYMQCGDGDNNNFEN 926

>Suva_2.598 Chr2 (1064757..1067654) [2898 bp, 965 aa] {ON} YDR421W
           (REAL)
          Length = 965

 Score =  618 bits (1593), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/821 (42%), Positives = 492/821 (59%), Gaps = 56/821 (6%)

Query: 9   SKRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDE 68
           +KR S + +     + RR+Y+ACINCR +KVKCDLGP++NPH+PPC RCKRE + C+F  
Sbjct: 14  TKRGSSENTVPTFPKRRRTYQACINCRSRKVKCDLGPVDNPHAPPCARCKRELKRCLFSS 73

Query: 69  PLKKLGT-------VENENDSIDDNQRVPNSPEDEIQQNTDIIQERISSIVATNESRFNN 121
             + + T       + +++ S    Q VPN          D++    S +  + ++  N 
Sbjct: 74  NREAMHTLSPSMINITSKSASSKSEQGVPN----------DLMSSTPSDMPLSGKNTDNE 123

Query: 122 DISNSQKHERKDKPSERKSNLKVNFTNMRNALEFLANAAGQAAXXXXXXXXXXXXXXXXX 181
            +  S+  +            K+  ++M+N LEFLA AAG  A                 
Sbjct: 124 TLFKSEGMK-----------WKLELSSMQNTLEFLAQAAGTVAKEGAKEIIKDESTTTTP 172

Query: 182 XXXDDHISIDSPATQSTTS--TDSVKHLDLSDESIASLFLSENET-NRKKVTS-LIEAVI 237
                H S   P+T       + S+     ++  I +L ++   T N  + TS LIE + 
Sbjct: 173 FVNSLHSSCQ-PSTDEGLKPLSRSLSAASDTNTPIENLTVALATTLNANRTTSQLIEEIG 231

Query: 238 AARPISNRKLTDYDYIGKSKMISEFEAIQLINAFFLTMHPFYPYLPDQLQDPHELARYPI 297
             RPI  RK+ D++YIG + ++++ EAI+LI AFFLTMHPF+P +P QL DP ELA+YPI
Sbjct: 232 KVRPIPTRKIEDFEYIGPANLLTKEEAIELIEAFFLTMHPFFPNIPFQLHDPKELAQYPI 291

Query: 298 LLCTILTISSRHHKFNELGTYNGVNDKRHIDVHEKLWVYCQKMISQTVWAEASTRSLGTV 357
           L C ILT+S+R+H F+ LG  NG N  RH++VH+KLWVYCQK+ISQT+WAEASTRS+GTV
Sbjct: 292 LFCAILTVSARYHPFDTLGLDNGENGTRHVEVHDKLWVYCQKLISQTIWAEASTRSIGTV 351

Query: 358 LAFLLFTEWNPRAIHWKWADYANNPKLNDFSTSDTGINDYLKVGKRTTGLGAIRRSDRMA 417
           LAF++FTEWNPR+IH KW+DYAN+P+LN+ +       +  +  +  TG+GAIRRSDRM+
Sbjct: 352 LAFIIFTEWNPRSIHCKWSDYANDPELNNVNVRGGKHINTRRDEEGLTGVGAIRRSDRMS 411

Query: 418 WMLCGTSVRIAQDMGFIENSSNVFVATHTSETFHAMNVGQRSSLNESLNDTYYSQGRMSS 477
           WML G++VR+AQDMGFIENSS +F+ TH SET  AMN+ QRS L ES +    + GR  +
Sbjct: 412 WMLTGSAVRLAQDMGFIENSSRIFIVTHISETTSAMNMNQRSVLAESFSVLNLNLGRFDN 471

Query: 478 YRNKQQQT-LKNEIFYIENIFSENFKITERNYWKSQLQXXXXXXXXXXXXXALSDKVRGF 536
             N+  +  L NE FY++ I   N +  ER  WK  L+              L+D  R F
Sbjct: 472 DGNENNENYLGNERFYLDEILP-NDESKER--WKKVLE--NLEADSDNEKCVLTDWEREF 526

Query: 537 LNDEFALFYSNGNDPTYSNERNNQPYSSFSTLPLPVNLSKSQQANIELLRIFSTAYKTIY 596
           LNDE+ L+YSN  D T +  +N+ P       P P+  S +Q+A IE++RI S AY+TIY
Sbjct: 527 LNDEYVLYYSNKKDDT-NLAQNHMP-------PFPLRFSFAQRAKIEIIRILSIAYETIY 578

Query: 597 SRXXXXXXXXXXXXXXISLLDIFAPLLHNWTIAFGDLLQP-SDVCEPINLXXXXXXXXXX 655
                           +S+L +F+PL+  W   + ++L P SDV  P +L          
Sbjct: 579 CEKNKRKLATTDQRHNLSVLSVFSPLMEGWLSNYREVLVPLSDV--PFSLADRKNKRQVL 636

Query: 656 EFNKIIEGESLICDYNYCQLYIFSLALQIGLDGEI--LTVNEITKSSTYINLAYQSAKEY 713
                I GES+I D+NYCQLYIFSLALQ+  DG+I  L ++EI KS+ Y+ LAY+SAKE 
Sbjct: 637 NNIDRINGESIITDFNYCQLYIFSLALQV--DGKISRLNMSEIVKSAKYVELAYKSAKEI 694

Query: 714 ILSTERVFTLKMLKYMPVRWLTRLIRATAFLVKCYLSVAGTDQELNSISEINMIFKLGGT 773
           + S +RV    MLKYMPVRW+ R+IR+ AF+VKCYL++ G+  E+ +  +   I KL   
Sbjct: 695 LSSAKRVSRQCMLKYMPVRWVIRIIRSIAFIVKCYLTLTGS--EIATNPDARNILKLSAI 752

Query: 774 SANEVLELIKKSAILLGSSSPDELHLCSRYSSIIMCFYKEM 814
           S +E  +LI+ +A+ L  ++PDELHLC RY++I+M    EM
Sbjct: 753 SVDETFDLIRDTAVTLKEATPDELHLCQRYAAILMYLCTEM 793

 Score = 60.1 bits (144), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 33/45 (73%), Gaps = 2/45 (4%)

Query: 976  SHANEFLDWFSASGDIGLEFVESWTEMLEQRYMK--DDDNLLFNN 1018
            S + E  DWFSAS DIGLEFVE WTE++EQRYM+  D DN  F N
Sbjct: 897  SLSEEVTDWFSASEDIGLEFVEPWTELIEQRYMQCGDGDNNNFEN 941

>SAKL0G04884g Chr7 (400351..403143) [2793 bp, 930 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421W ARO80
           Zinc finger transcriptional activator of the Zn2Cys6
           family activates transcription of aromatic amino acid
           catabolic genes in the presence of aromatic amino acids
          Length = 930

 Score =  615 bits (1585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/815 (41%), Positives = 477/815 (58%), Gaps = 65/815 (7%)

Query: 23  RWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLGTVENENDS 82
           +WRR+Y+AC+NCR +KVKCDLGP++NPH PPCVRCKRE ++CIF E  K+ G       +
Sbjct: 18  KWRRTYQACLNCRTRKVKCDLGPVDNPHDPPCVRCKRERKECIFTESNKRGGLRVANVSA 77

Query: 83  IDDNQRVPNSPEDEIQQNTDIIQERISSIVATNESRFNNDISNSQKHERKDKPSERKSNL 142
           I +N              T  + + I+S+   N S        SQ+ + K + S     +
Sbjct: 78  IAEN----------TANATASMSKAITSVFQGNTSE------GSQQPDFKRENSIDPLPI 121

Query: 143 KVNFTNMRNALEFLANAAGQAAXXXXXXXXXXXXXXXXXXXXDDHISIDSPATQSTT--S 200
               T M++ALEFLA AAG  A                     +    D+P +  +   S
Sbjct: 122 NSELTTMQDALEFLAKAAGSVAKEDSRDLVDASTKYEELESQSNS-RTDTPISSGSAQDS 180

Query: 201 TDSVKHLDLSDESIASLFLSENETNRKKVTSLIEAVIAARPISNRKLTDYDYIGKSKMIS 260
           T +    ++ DE+  +  L  +   R  +  LIE + + RP  +R+LTD +YIG  KM+S
Sbjct: 181 TRNSNSANIPDEACIAPLLRPHGLGRPTI-PLIEKLSSVRPKPSRRLTDIEYIGTLKMLS 239

Query: 261 EFEAIQLINAFFLTMHPFYPYLPDQLQDPHELARYPILLCTILTISSRHHKFNELGTYNG 320
           E EA++LI+ FFLTMHPF+P++P QLQ+P ELA+YPILLC ILTISSR+H F+E+  YNG
Sbjct: 240 EEEAVKLIDLFFLTMHPFFPHVPLQLQNPDELAQYPILLCAILTISSRYHSFDEVNMYNG 299

Query: 321 VNDKRHIDVHEKLWVYCQKMISQTVWAEASTRSLGTVLAFLLFTEWNPRAIHWKWADYAN 380
            ++ R++++HE+LW+YCQ++ISQTVWAEASTRS+GTVLAFLLFTEWNPRAIHW+W+DYAN
Sbjct: 300 ESNNRNVEIHERLWIYCQRLISQTVWAEASTRSIGTVLAFLLFTEWNPRAIHWRWSDYAN 359

Query: 381 NPKLNDFSTSD-----------TGINDYLKVGKRTTGLGAIRRSDRMAWMLCGTSVRIAQ 429
           NP LND S  D           T  N   + G   TGL A+RRSDRMAWML GT+VR+AQ
Sbjct: 360 NPDLNDVSKRDLSNVACSSSSSTACNSQ-QHGDGLTGLSAMRRSDRMAWMLTGTAVRLAQ 418

Query: 430 DMGFIENSSNVFVATHTSETFHAMNVGQRSSLNESLNDTYYSQGRMSSYRNKQQQTLKNE 489
           DMGF+  SS +F ATH SET  AMN+ QRS L++SL +            N  +  ++NE
Sbjct: 419 DMGFMNTSSKIFTATHISETHTAMNMNQRSILSQSLAEINL---------NGYEDDVENE 469

Query: 490 IFYIENIFSENFKITERNYWKSQLQXXXXXXXXXXXXXALSDKVRGFLNDEFALFYSN-- 547
            +Y+  I   +     +  W   L+              ++D  R F+NDE+ L+YS+  
Sbjct: 470 SYYLGQILKSD---GSKERWSKFLKKLGSSSTRGR----MNDIEREFVNDEYVLYYSDKD 522

Query: 548 -----GNDPTYSNERNNQPYSSFSTLPLPVNLSKSQQANIELLRIFSTAYKTIYSRXXXX 602
                 ++ T ++++N +        P  +  S  Q+A IELLRI S  Y+TIY      
Sbjct: 523 GAPAHADEYTMNDDKNRK--KQIEEEPYNLKFSFGQRAKIELLRIMSIGYETIY--RGKL 578

Query: 603 XXXXXXXXXXISLLDIFAPLLHNWTIAFGDLLQPSDVCEPINLXXXXXXXXXXEFNKIIE 662
                     ++LL I +PL+ +W   +  +L+P       N           E  + ++
Sbjct: 579 KLYSNSQYHNLALLSILSPLIESWYNTYKTILKPCSGAA-CNTAMCSEKKYIFELTEKVD 637

Query: 663 GESLICDYNYCQLYIFSLALQIGL---DGEILTVNEITKSSTYINLAYQSAKEYILSTER 719
            ESLI DY YCQLYI+SLALQ+ +     + L +NEITK + Y+ LAY +AKE + S  R
Sbjct: 638 RESLISDYYYCQLYIYSLALQVDVGTPKDKKLRMNEITKCARYVELAYNAAKEILNSAIR 697

Query: 720 VFTLKMLKYMPVRWLTRLIRATAFLVKCYLSVAGTDQELNSISEINMIFKLGGTSANEVL 779
           V  LKMLKYMPVRW+TR++R+ AF+VKCYL++ G+    N   E N I  L      E++
Sbjct: 698 VHKLKMLKYMPVRWVTRIVRSVAFVVKCYLTLTGSGIATN--PEANTILTLSVIPTEEII 755

Query: 780 ELIKKSAILLGSSSPDELHLCSRYSSIIMCFYKEM 814
           + I+++AI L  +SPDELHLC+RYS+I+M    EM
Sbjct: 756 QTIQRAAITLREASPDELHLCTRYSTILMYLCTEM 790

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 33/48 (68%)

Query: 971  GEPTGSHANEFLDWFSASGDIGLEFVESWTEMLEQRYMKDDDNLLFNN 1018
            G  T     + +DWFS S +IGL+FVE WTEM+EQ+++ +D+N  F N
Sbjct: 866  GAQTHHLPTQVVDWFSTSDEIGLDFVEPWTEMIEQQFISNDNNKTFEN 913

>Smik_4.696 Chr4 (1232828..1235677) [2850 bp, 949 aa] {ON} YDR421W
           (REAL)
          Length = 949

 Score =  610 bits (1573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/837 (41%), Positives = 483/837 (57%), Gaps = 64/837 (7%)

Query: 6   LRLSKRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCI 65
           + L KR S+  +     R RR+Y+ACINCR +KVKCDLGP++NPH PPC RCKRE R+C+
Sbjct: 1   MSLKKRFSENTTSALPKR-RRTYQACINCRSRKVKCDLGPVDNPHEPPCARCKRELRECL 59

Query: 66  F--DEPLKKLGTVENENDSIDDNQRVPNSPEDEIQQNTDIIQERISSIVATNESRFNNDI 123
           F   + +K   +    N        +PN     I       +  +S     +E+ F +D 
Sbjct: 60  FSSQKVVKNSTSPHMVNTICQSKGEIPNHSRRLISS-----EMALSEKGTNDETLFKSD- 113

Query: 124 SNSQKHERKDKPSERKSNLKVNFTNMRNALEFLANAAGQAAXXXXXXXXXXXXXXXXXXX 183
                              K+  ++M+NALEFLA AAG  A                   
Sbjct: 114 ---------------GVKWKLELSSMQNALEFLAQAAGTVAKEGAKETIKDRSATPRPSE 158

Query: 184 XDDHISIDSP---ATQSTTSTDSVKHLDLS-----DESIASLFLSENETNRKKVTSLIEA 235
                S+D+P   A      T S+   D S      E+I     +   +N +K++ LI+ 
Sbjct: 159 S----SLDTPHQSAANKELKTLSISECDASATNTPHENITDTLAAALNSN-QKMSQLIKE 213

Query: 236 VIAARPISNRKLTDYDYIGKSKMISEFEAIQLINAFFLTMHPFYPYLPDQLQDPHELARY 295
           +  ARP+  R++ D++YIG   ++++ EAI+LI AFFLTMHPF+P +P QL DP ELA Y
Sbjct: 214 ISRARPMPTRRIDDFEYIGPDNLLTKEEAIELIEAFFLTMHPFFPNIPLQLHDPKELAEY 273

Query: 296 PILLCTILTISSRHHKFNELGTYNGVNDKRHIDVHEKLWVYCQKMISQTVWAEASTRSLG 355
           PIL C+ILT+S+R+H F+ LG  NG N  RHI+VH+KLW+YCQK+ISQT+WAEASTRS+G
Sbjct: 274 PILFCSILTVSARYHPFDTLGLDNGENGIRHIEVHDKLWIYCQKLISQTIWAEASTRSIG 333

Query: 356 TVLAFLLFTEWNPRAIHWKWADYANNPKLNDFSTSDTGINDYLKVGKRTTGLGAIRRSDR 415
           TVLAF++FTEWNPR+IH+KW+DYAN+P+LN+    ++      K  +  TG+GAIRRSDR
Sbjct: 334 TVLAFIIFTEWNPRSIHYKWSDYANDPELNNVGVRESKNISTKKDEEGLTGVGAIRRSDR 393

Query: 416 MAWMLCGTSVRIAQDMGFIENSSNVFVATHTSETFHAMNVGQRSSLNESLNDTYYSQGRM 475
           M+WML G++VR+AQDMGFIENSS +F+ TH SET  AMN+ QR  L ES +    +  + 
Sbjct: 394 MSWMLTGSAVRLAQDMGFIENSSKIFIVTHISETTSAMNMNQRPLLAESFSVLNLNVRKF 453

Query: 476 SSYRNKQQQT-LKNEIFYIENIFSENFKITERNYWKSQLQXXXXXXXXXXXXXALSDKVR 534
               NK  +  L NE FY+  I  ++     +  WK   +              L+D  R
Sbjct: 454 DDDGNKGNENYLGNEKFYLNEILPDD---ESKKRWKKVFK--DSEDDDDSEKNILTDWER 508

Query: 535 GFLNDEFALFYSNGNDPTYSNERNNQPYSSFSTLPLPVNLSKSQQANIELLRIFSTAYKT 594
            FLNDE+ L+YSN  D T +  +N  P       P P+  S +Q+A IE++RI S AY+T
Sbjct: 509 EFLNDEYVLYYSNKKDDT-NLAQNPMP-------PSPLRFSFAQRAKIEIIRILSIAYET 560

Query: 595 IYSRXXXXXXXXXXXXXXISLLDIFAPLLHNWTIAFGDLLQP-SDVCEPINLXXXXXXXX 653
           IY                +S+L +F+PL+  W   + ++L P SDV    +         
Sbjct: 561 IYCEKNKRKLATTDQRHNLSVLSVFSPLIEGWLSNYREVLVPISDV----SFLLADRKNK 616

Query: 654 XXEFNKI--IEGESLICDYNYCQLYIFSLALQIGLDGEILTVNEITKSSTYINLAYQSAK 711
              F+ I  + GE++I D+NYCQLYIFSLALQ+      L +NEI  S+ Y+ LAY+SAK
Sbjct: 617 KQVFDNINRLNGETIITDFNYCQLYIFSLALQVDGKTSRLNMNEIMTSARYVELAYRSAK 676

Query: 712 EYILSTERVFTLKMLKYMPVRWLTRLIRATAFLVKCYLSVAGTDQELNSISEINMIFKLG 771
           E + S +RV    MLKYMPVRW  R+IR+ AF+VKCYL++ G+  EL +  +   I KL 
Sbjct: 677 EILSSAKRVSRQGMLKYMPVRWAIRIIRSIAFIVKCYLTLTGS--ELATNPDARNILKLS 734

Query: 772 GTSANEVLELIKKSAILLGSSSPDELHLCSRYSSIIMCFYKEMSEKNLTRKRGSTDK 828
             S +E  ++I+ +A+ L  ++PDELHLC RY++I+M    EM      RK+  T++
Sbjct: 735 AISVDETFDIIRDTAVTLKEATPDELHLCQRYAAILMYLCTEMK----LRKKSYTER 787

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 27/37 (72%)

Query: 976  SHANEFLDWFSASGDIGLEFVESWTEMLEQRYMKDDD 1012
            S + E  DWF AS DIGL FVE WTE++EQRYM+  D
Sbjct: 881  SLSEEVTDWFGASEDIGLGFVEPWTELIEQRYMQCGD 917

>TDEL0A03890 Chr1 (695880..698375) [2496 bp, 831 aa] {ON} Anc_5.525
           YDR421W
          Length = 831

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/809 (40%), Positives = 474/809 (58%), Gaps = 81/809 (10%)

Query: 20  KSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLGTVENE 79
           K  +WRRSYKAC+NCRL+K+KCD+GPL+ PH PPC RCKRE + C F +  KK       
Sbjct: 11  KDTKWRRSYKACLNCRLRKIKCDMGPLDKPHEPPCKRCKREGKTCEFLQSRKK------- 63

Query: 80  NDSIDDNQRVPNSPE--DEIQQNTDIIQERISSIVATNESRFNNDISNSQKHERKDKPSE 137
             S+   Q   N  E  DE++++          +V T+E          ++H R    ++
Sbjct: 64  --SVFKRQHRTNGLELQDEVEKH----------VVITHEVDVGGPSDRIERHSR----NK 107

Query: 138 RKSNLKVNFTNMRNALEFLANAAGQAAXXXXXXXXXXXXXXXXXXXXDDHISIDSPATQS 197
                +   ++M+NALEFLA AAG  A                    D+ +        S
Sbjct: 108 IDGKWRFEISSMQNALEFLAKAAGSVAKE------------------DNQLHEIKQIDPS 149

Query: 198 TTSTDSVKHLDLSDESI----ASLF--LSENETNRKKVTSLIEAVIAARPISNRKLTDYD 251
             S D     DL+  S     A +   L  +E + +K   LI+ + + RP    KL++ +
Sbjct: 150 QVSRDDSSWKDLTPTSFEASRAGIMAPLEADEGSSRKAVPLIKKLSSVRPKPCIKLSNLE 209

Query: 252 YIGKSKMISEFEAIQLINAFFLTMHPFYPYLPDQLQDPHELARYPILLCTILTISSRHHK 311
           +IG S  ++E E I+L++ FFLTM+PF+P++P QLQDP ELARYP+LLC+I+T+S+R+H 
Sbjct: 210 FIGGSDQLTEEEVIKLVDVFFLTMYPFFPHIPLQLQDPEELARYPLLLCSIVTVSARYHS 269

Query: 312 FNELGTYNGVNDKRHIDVHEKLWVYCQKMISQTVWAEASTRSLGTVLAFLLFTEWNPRAI 371
           F ++G  + + + R+I+VHE+LW+YCQK+ISQT+WAEASTRS+GTVLAFLLFTEWNPRAI
Sbjct: 270 FCDIGLKDNMQNNRNIEVHEQLWIYCQKLISQTIWAEASTRSIGTVLAFLLFTEWNPRAI 329

Query: 372 HWKWADYANN----PKLNDFSTSDTGINDYLKVGKRTTGLGAIRRSDRMAWMLCGTSVRI 427
           HWKW+DYAN+     + NDFS S        +  +R TG+ AIRRSDRMAWML G +VR+
Sbjct: 330 HWKWSDYANSGDSKDRSNDFSIS--------RDSERLTGMAAIRRSDRMAWMLTGNAVRL 381

Query: 428 AQDMGFIENSSNVFVATHTSETFHAMNVGQRSSLNESLNDTYYSQGRMSSYRNKQQQTLK 487
           AQDMGF E SS +F ATH SET  AMNVGQRS+L ESLN+       + S +  +  ++ 
Sbjct: 382 AQDMGFNETSSKIFTATHISETHTAMNVGQRSTLTESLNEI-----NLGSIKFPRNNSVG 436

Query: 488 NEIFYIENIFSENFKITERNYWKSQLQXXXXXXXXXXXXXALSDKVRGFLNDEFALFYSN 547
           NE FY+E I   +     ++ W ++                L+D  R FLNDE+ L+Y+ 
Sbjct: 437 NEQFYLEKILEND---DSKDRW-TRFLHDIRDDYAHHDEGPLTDIEREFLNDEYVLYYTA 492

Query: 548 GNDPTYSNERNNQPYSSFSTLPLPVNLSKSQQANIELLRIFSTAYKTIYSRXXXXXXXXX 607
             D  + +  N         LP P+  SK Q+A IELLRI +  ++ IY           
Sbjct: 493 DGDSKHRDSSN--------LLPFPLRFSKIQRAKIELLRIITVGFEAIYCTKDKQQSLFN 544

Query: 608 XXXXXISLLDIFAPLLHNWTIAFGDLLQPSDVCEPINLXXXXXXXXXXEFNKIIEGESLI 667
                +SLL + +PL+ +W  ++ DLL+P++  +P  +             + I+ ESLI
Sbjct: 545 DPTRNLSLLHLISPLIESWYKSYHDLLEPAE-GKPCTVDLCRNKREVHYVVRKIDRESLI 603

Query: 668 CDYNYCQLYIFSLALQIGLDGEILTVNEITKSSTYINLAYQSAKEYILSTERVFTLKMLK 727
           C+Y YCQLYI+S ALQ+ +    L ++EIT+S+ Y+ LAY +AK  + S  R+  L +LK
Sbjct: 604 CEYYYCQLYIYSSALQVDVKEGQLKLHEITRSAKYVELAYNAAKMLLTSATRLHRLNLLK 663

Query: 728 YMPVRWLTRLIRATAFLVKCYLSVAGTDQELNSISEINMIFKLGGTSANEVLELIKKSAI 787
            MPVRW+TR++++ AF+VKCYL++ G     N ++  N I KL    A ++L+ I  +A+
Sbjct: 664 CMPVRWVTRIVKSVAFIVKCYLTLMGNAVVNNPLA--NTILKLTVIPAEDILKTIHTAAL 721

Query: 788 LLGSSSPDELHLCSRYSSIIMCFYKEMSE 816
           +L  +SPDELHLC RYS+I+M    EM E
Sbjct: 722 ILKEASPDELHLCMRYSTILMSLCSEMRE 750

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/31 (67%), Positives = 27/31 (87%)

Query: 979  NEFLDWFSASGDIGLEFVESWTEMLEQRYMK 1009
            N+ +DWFS S +IGLEFVESW EM+EQRY++
Sbjct: 785  NDVVDWFSTSDEIGLEFVESWAEMIEQRYLQ 815

>NDAI0H01580 Chr8 (382179..384908) [2730 bp, 909 aa] {ON} Anc_5.525
           YDR421W
          Length = 909

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/810 (40%), Positives = 466/810 (57%), Gaps = 54/810 (6%)

Query: 16  KSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLGT 75
           + +  + +W+R YKAC NC+L+KVKCD+GPLENPH PPC RC+RE + C+F     +   
Sbjct: 12  QKRAPNYKWKRGYKACTNCKLRKVKCDMGPLENPHDPPCARCRREGKTCVFLTTKGRKAD 71

Query: 76  VENENDSIDDNQRVPNS----PEDEIQQNTDIIQERISSIVATNESRFNNDISNSQKHER 131
           +             PNS     +  +  +TD++ E    I  T+ S   N IS ++    
Sbjct: 72  LGTSKIPSTTPTLKPNSGNSVSKKRLDSSTDLVNEVPVKIPKTSPS---NPISPTK---- 124

Query: 132 KDKPSERKSNLKVNFTNMRNALEFLANAAGQAAXXXXXXXXXXXXXXXXXXXXDDHISID 191
                      K+  T+M+N+LEFLA AAG                           +  
Sbjct: 125 ----------WKIGLTSMQNSLEFLAKAAGNVGFLSAPSAHSAREELNSAVVPK---ATS 171

Query: 192 SPATQSTTSTDSVKHLDLSDESIASLFLSENETNRKKVTSLIEAVIAARPISNRKLTDYD 251
            P  +S  +  S  H DL       L +S     + K   LI+ +   RP   RKLTD D
Sbjct: 172 LPQEESLMNMTSSLHSDL-------LNISPIGKLQHKSLPLIDKLNIVRPTPRRKLTDID 224

Query: 252 YIGKSKMISEFEAIQLINAFFLTMHPFYPYLPDQLQDPHELARYPILLCTILTISSRHHK 311
           YIG ++++SE +AI+LI+ FFLTM PF+P +P QLQ+P ELA+YPILLC ILTISSR+H 
Sbjct: 225 YIGPNRLLSESDAIELIDLFFLTMFPFFPNIPLQLQNPKELAQYPILLCAILTISSRYHS 284

Query: 312 FNELG--TYNGVNDKR-HIDVHEKLWVYCQKMISQTVWAEASTRSLGTVLAFLLFTEWNP 368
           F+       NG N+KR HIDVHEKLW+YCQ++ISQT+WAEASTRS+GT+LAF++FTEWNP
Sbjct: 285 FDTFADSINNGQNNKRRHIDVHEKLWIYCQRLISQTIWAEASTRSIGTILAFIIFTEWNP 344

Query: 369 RAIHWKWADYANNPKLNDFSTSDTGINDYLKVGKRTTGLGAIRRSDRMAWMLCGTSVRIA 428
           RAIHW W+DYA++P LND S  +       +  +  TG+ AIRRSDRMAWML GT+VR+A
Sbjct: 345 RAIHWNWSDYASDPALNDISKRNMEPQIIKREEEGLTGIDAIRRSDRMAWMLSGTAVRLA 404

Query: 429 QDMGFIENSSNVFVATHTSETFHAMNVGQRSSLNESLNDTYYSQGRMSSYRNKQQQTLKN 488
           QD G I  ++ V +ATH S+T  AMN+ QRS+L+ S N  ++     S Y  K    + N
Sbjct: 405 QDTGLIRTNTKVAIATHISDTHTAMNMNQRSALSHSFNSDFFDHLSKSRYIGKDSTQVVN 464

Query: 489 EIFYIENIFSENFKITERNYWKSQLQXXXXXXXXXXXXXALSDKVRGFLNDEFALFYSNG 548
           E FY+  I  +N +  ER  WK                  LSD    FLNDE+AL++S  
Sbjct: 465 ENFYLTQIL-QNKESKER--WKK--ISATFQKDNEETVGQLSDMEYEFLNDEYALYFSKE 519

Query: 549 NDPTYSNERNNQPYSSFSTLPLPVNLSKSQQANIELLRIFSTAYKTIYSRXXXXXXXXXX 608
           +     N+ + +P       PLP+  +  Q+A +ELLRI +  Y+TIY            
Sbjct: 520 D-----NDSSQRP-------PLPLKFTFVQRAKLELLRIVTLGYETIYYENGEQRLVSDD 567

Query: 609 XXXXISLLDIFAPLLHNWTIAFGDLLQPSDVCEPINLXXXXXXXXXXEFNKIIEGESLIC 668
               +++L+I +PL+ +W   +  LL+ +D   P++           + ++ I GE++I 
Sbjct: 568 QRRNLAVLNILSPLIDSWYSNYNSLLK-TDAVRPVSPGMHKRKQEAFKMSQNISGETMIS 626

Query: 669 DYNYCQLYIFSLALQIGLDGEILTVNEITKSSTYINLAYQSAKEYILSTERVFTLKMLKY 728
           DY YCQLYIFSLALQ+ +    L +NEIT+ + Y+  AY +AKE + S  RV  LKMLKY
Sbjct: 627 DYYYCQLYIFSLALQVDVGQNKLKLNEITRCAIYVEKAYVAAKEILESAGRVHKLKMLKY 686

Query: 729 MPVRWLTRLIRATAFLVKCYLSVAGTDQELNSISEINMIFKLGGTSANEVLELIKKSAIL 788
           MPV+W+ R++R+ AF+VKCYL++  T    +S  E   I  L   S +E ++ I+ +AI+
Sbjct: 687 MPVKWVMRIVRSVAFIVKCYLTL--TSGSFSSNPEARTILSLSAISVDETIQTIQDTAII 744

Query: 789 LGSSSPDELHLCSRYSSIIMCFYKEMSEKN 818
           L  ++PDELHL +RYS+I++   +EM  K+
Sbjct: 745 LKEAAPDELHLSTRYSAILLYLCREMKSKH 774

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 25/30 (83%)

Query: 983  DWFSASGDIGLEFVESWTEMLEQRYMKDDD 1012
            +WF+ SG+IGLEFVE WTEM+EQ Y++  D
Sbjct: 863  NWFTTSGNIGLEFVEPWTEMIEQMYLQSGD 892

>NCAS0F01070 Chr6 (211085..213799) [2715 bp, 904 aa] {ON} Anc_5.525
           YDR421W
          Length = 904

 Score =  583 bits (1504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/811 (39%), Positives = 468/811 (57%), Gaps = 71/811 (8%)

Query: 16  KSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLGT 75
           K   + ++W+RS++ACI+CR++KVKCDLGPLENPH PPCVRC+RE + CIF      + +
Sbjct: 19  KRSSRDIKWQRSFRACISCRMRKVKCDLGPLENPHKPPCVRCRREGKTCIFSSGGNGMSS 78

Query: 76  VENENDSIDDNQRVPNSPEDEIQQNTDIIQERISSIVATNESRFNNDISNSQKHERKDKP 135
                 +  +NQ             T I  +R  S+ A       N   NSQ H  K K 
Sbjct: 79  ANLSTMNGKNNQAT----------FTGI--KRALSVDA-------NSTLNSQYHTTKIKK 119

Query: 136 SER------KSNLKVNFTNMRNALEFLANAAGQAAXXXXXXXXXXXXXXXXXXXXDDHIS 189
           +E       +   K+   +M+N+LEFLA AA   A                    +D   
Sbjct: 120 TENTYKRLPREKWKLELASMQNSLEFLAKAADSVAHQSNPESFKETAKLAKNGASNDTSE 179

Query: 190 IDSPATQSTTSTDSVKHLDLSDESIASLFLSENETNRKKVTSLIEAVIAARPISNRKLTD 249
            D+P          V+  D  +E+  +   + + + R  +  L E  I+ RP S++ L+D
Sbjct: 180 NDTP----------VQQQDSPNENYLTPLTTPHNSRRSALPQL-EKSISIRPKSSQTLSD 228

Query: 250 YDYIGKSKMISEFEAIQLINAFFLTMHPFYPYLPDQLQDPHELARYPILLCTILTISSRH 309
            ++IG SK++SE EA +LI+ FFLTM+PF+P++P QLQD  EL RYPILLC ILTISSR+
Sbjct: 229 MEFIGPSKLLSEEEARELIDLFFLTMNPFFPHIPLQLQDADELVRYPILLCAILTISSRY 288

Query: 310 HKFNELGTYNGV--NDKRHIDVHEKLWVYCQKMISQTVWAEASTRSLGTVLAFLLFTEWN 367
           H F+E   YNG     KR+I VHEKLW+YCQ++ISQTVWAEASTRS+GT+ AF++FTEWN
Sbjct: 289 HPFDEFDGYNGTPGRQKRNIHVHEKLWIYCQRLISQTVWAEASTRSIGTIFAFIIFTEWN 348

Query: 368 PRAIHWKWADYANNPKLNDFSTSDTGINDYLKVGKRTTGLGAIRRSDRMAWMLCGTSVRI 427
           PRAIHWKW+DYANNP+  D +  ++   +  K     TG+ AIRRSDRMAWML GT+VR+
Sbjct: 349 PRAIHWKWSDYANNPEQYDMTKRESFSQEPNKDEDGLTGIAAIRRSDRMAWMLTGTAVRL 408

Query: 428 AQDMGFIENSSNVFVATHTSETFHAMNVGQRSSLNESLNDTYYSQGRMSSYRN----KQQ 483
           AQD+G IE S+ VFVATH SE++ A+N+ Q   L++S N+           RN       
Sbjct: 409 AQDIGAIETSAKVFVATHISESYTAINMNQGLILSQSFNE-----------RNLDGIDNL 457

Query: 484 QTLKNEIFYIENIFSENFKITERNYWKSQLQXXXXXXXXXXXXXALSDKVRGFLNDEFAL 543
             + NE  Y+E I   +     +  W   L+              L D  R FLNDE+ L
Sbjct: 458 NGVDNERLYLEQILQND---ESKARWNGILKLLDNEVGISEEY--LQDVEREFLNDEYTL 512

Query: 544 FYSNGNDPTYSNERNNQPYSSFSTLPLPVNLSKSQQANIELLRIFSTAYKTIYSRXXXXX 603
           +Y++ ++ T  + +            +P+  + +Q+A +ELLRI    Y+TIY       
Sbjct: 513 YYADHDEDTQQHTQQ----------IIPLKFTSTQKAKLELLRILILGYETIYYEKGDQR 562

Query: 604 XXXXXXXXXISLLDIFAPLLHNWTIAFGDLLQPSDVCEPINLXXXXXXXXXXEFNKIIEG 663
                    +++L+I APL+ +W   +  LL+  +  E ++L          E ++ I  
Sbjct: 563 LVSTDQRHNLAVLNILAPLIESWYNNYRSLLEIRE-GEVLSLNQRRNKRKAFEMSRQINT 621

Query: 664 ESLICDYNYCQLYIFSLALQIGLDGEILTVNEITKSSTYINLAYQSAKEYILSTERVFTL 723
           E++I DY YCQLYI+SLALQ+ ++   L +NEI + ++++  AY +AKE + S  RV  L
Sbjct: 622 ETMISDYYYCQLYIYSLALQVDVEENKLKLNEIRRCASFVEKAYIAAKEILESAGRVHKL 681

Query: 724 KMLKYMPVRWLTRLIRATAFLVKCYLSVAGTDQELNSISEINMIFKLGGTSANEVLELIK 783
            MLKYMPVRW+ R++R+ AF+VKCYL++  +D  L++  E N I +L   S +E ++ I+
Sbjct: 682 NMLKYMPVRWVLRIVRSVAFIVKCYLTLTCSD--LSTNPEANTILRLSAISVDETIQTIQ 739

Query: 784 KSAILLGSSSPDELHLCSRYSSIIMCFYKEM 814
            +AI L  ++PDELHLC+RYS+I+M   +EM
Sbjct: 740 TAAITLKEAAPDELHLCTRYSAILMYLCREM 770

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 42/79 (53%), Gaps = 6/79 (7%)

Query: 940  GTSSDLG------PTNRDLLSYNTRETSPNTGHTGVTGEPTGSHANEFLDWFSASGDIGL 993
            G +S+ G      P +    S    + S +  H+    +   S +N   DWF+  GDIGL
Sbjct: 802  GVASNFGNVPSTLPPSYAQKSTTKEQLSDDGAHSMSFMDEGPSLSNNVTDWFNVGGDIGL 861

Query: 994  EFVESWTEMLEQRYMKDDD 1012
            +FVE WTEM+EQRY++  D
Sbjct: 862  DFVEPWTEMIEQRYLQSGD 880

>TPHA0L00350 Chr12 complement(47367..49946) [2580 bp, 859 aa] {ON} 
          Length = 859

 Score =  575 bits (1481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/829 (38%), Positives = 482/829 (58%), Gaps = 95/829 (11%)

Query: 12  MSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLK 71
           M  K ++  S +W+RS++AC  CR +K+KC+LGPL+NPH PPC RCKRE R+CIF EP +
Sbjct: 1   MGSKSNRTSSKKWKRSFRACQTCRERKIKCNLGPLDNPHKPPCERCKREQRECIFVEPSR 60

Query: 72  KLGTVE----NENDSIDDNQR--VPNSPEDEIQQNTDIIQERISSIVATNESRFNNDISN 125
           K  ++     N  D  DDN+   +     D    N   IQ      +A  +S + +D+S+
Sbjct: 61  KSRSLSPKDINYGDDGDDNKLKFIHYQQGDNKGANNKEIQN-----MALEDSAWESDVSS 115

Query: 126 SQKHERKDKPSERKSNLKVNFTNMRNALEFLANAAGQAAXXXXXXXXXXXXXXXXXXXXD 185
                                  M+NALE+LA+AA   +                    +
Sbjct: 116 -----------------------MQNALEYLASAAKSVSQF------------------E 134

Query: 186 DHISIDSPATQSTTSTDSVKHLDLSDESIASLFLSENETNRKKVTSLIEAVIAARPISNR 245
           +H     P ++ +   +S    D++ E+I      + E  +   +SLI  +   R   ++
Sbjct: 135 NH----KPTSKLSDMVNSYSKDDMTQENIIKELFEKTEL-KNPASSLIAQLSRIRTKPHK 189

Query: 246 KLTDYDYIGKSKMISEFEAIQLINAFFLTMHPFYPYLPDQLQDPHELARYPILLCTILTI 305
           KL+D  YIG  K+++E EA +LI  FF  +HPF+PY+P QL +P +L RYPILLC ++TI
Sbjct: 190 KLSDIVYIGDDKLLTEEEARRLIEVFFQKLHPFFPYIPLQLHNPEQLVRYPILLCAVITI 249

Query: 306 SSRHHKFNELGTYNGVNDKRHIDVHEKLWVYCQKMISQTVWAEASTRSLGTVLAFLLFTE 365
           S+R++ F +L      +   +I +HEKLW+YCQ++IS+T+WAEASTRS+GT+LAFLLFTE
Sbjct: 250 SARYNNFGDLDLKTRESPDYNITIHEKLWMYCQRLISRTIWAEASTRSIGTILAFLLFTE 309

Query: 366 WNPRAIHWKWADYANNP------KLNDFSTSDTGINDYLKVGKRTTGLGAIRRSDRMAWM 419
           WNPRAIHW W+DYAN+       +LN+F      IN Y   G+  TG  A+R SDRMAWM
Sbjct: 310 WNPRAIHWNWSDYANDSETINFNELNEFDP----INSY--KGESITGFEAMRHSDRMAWM 363

Query: 420 LCGTSVRIAQDMGFIENSSNVFVATHTSETFHAMNVGQRSSLNESLNDTYYSQGRMSSYR 479
           L G++VR+AQDM FI+ S+ +F+ATH +ET++AMNV  RSSL+ESL++      ++   +
Sbjct: 364 LTGSAVRLAQDMKFIDTSNKIFLATHIAETYNAMNVNLRSSLSESLSNVNIHSKKIDPVK 423

Query: 480 ----NKQQQTLKNEIFYIENIFSENFKITERNYWKSQLQXXXXXXXXXXXXXALSDKVRG 535
                K ++   NE +Y+E IF +N K  E +Y                   A  D  R 
Sbjct: 424 IIDGKKSERYFGNEKYYLEQIF-KNAKDRESSY-----DLLENILRERRNAKAFPDNERD 477

Query: 536 FLNDEFALFYSNGNDPTYSNERNNQPYSSFSTLPLPVNLSKSQQANIELLRIFSTAYKTI 595
           FLNDE+ LFYSN +D T ++E           L  P++ +  Q+A IELL+I S  Y+TI
Sbjct: 478 FLNDEYILFYSNPDDATQNDE-----------LDTPLDFTVIQRAKIELLKIMSIGYETI 526

Query: 596 YSRXXXXXXXXXXXXXXISLLDIFAPLLHNWTIAFGDLLQPSDVCEPINLXXXXXXXXXX 655
           Y                +++L+IF+ L+ +W + + +LL P +  +P+            
Sbjct: 527 YLEKGRRYTTANNQKQNLAMLNIFSALIDSWYVNYNELLSPEETLDPV---LNASKMGLQ 583

Query: 656 EFNKIIEGESLICDYNYCQLYIFSLALQIGLDGEILTVNEITKSSTYINLAYQSAKEYIL 715
              +IIE ESLICDY YCQLYI+SL+LQ+  +   L + E+++S+ Y+++AY SAKE + 
Sbjct: 584 SMTQIIENESLICDYYYCQLYIYSLSLQVEDEESKLKLKELSQSAKYVSIAYSSAKEILN 643

Query: 716 STERVFTLKMLKYMPVRWLTRLIRATAFLVKCYLSVAGTDQELNSISEINMIFKLGGTSA 775
           S +R+  ++MLK++PVRW+ R++RA +F+VKCY  V  TD++  +  E+N +  L G   
Sbjct: 644 SAKRLQEVRMLKFIPVRWVIRIVRAISFIVKCY--VTATDKDSMNYKELNSLLSLSGIPV 701

Query: 776 NEVLELIKKSAILLGSSSPDELHLCSRYSSIIMCFYKEMSEKNLTRKRG 824
           +E LELI  +A+LL  S+PDELHLC+RYS I++C Y+E+    L+ ++ 
Sbjct: 702 DESLELIHTAAVLLKESTPDELHLCTRYSKILLCLYRELKMDTLSTQQA 750

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 29/40 (72%)

Query: 970  TGEPTGSHANEFLDWFSASGDIGLEFVESWTEMLEQRYMK 1009
            T  P  S   E +DWFS S DIGLEFVE WTEM+EQRY+K
Sbjct: 802  TTPPYASFPTEVVDWFSTSADIGLEFVEPWTEMIEQRYIK 841

>KLLA0A01804g Chr1 complement(159689..162526) [2838 bp, 945 aa] {ON}
            similar to uniprot|Q04052 Saccharomyces cerevisiae
            YDR421W ARO80 Zinc finger transcriptional activator of
            the Zn2Cys6 family activates transcription of aromatic
            amino acid catabolic genes in the presence of aromatic
            amino acids
          Length = 945

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/1014 (35%), Positives = 531/1014 (52%), Gaps = 94/1014 (9%)

Query: 14   DKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKL 73
            + ++  K   ++R YKAC+NC+++KVKCDLGP +NPH PPCVRCKRE+R+C+F E   K 
Sbjct: 7    ESQTAPKKQTFKRGYKACLNCKMRKVKCDLGPFDNPHGPPCVRCKRESRECMFTE--TKR 64

Query: 74   GTVENENDSIDDNQRVPNSPEDEIQQNTDIIQERISSIVATNESRFNNDISNSQKHERKD 133
            G       S+     V    E   +   D+I   I     T +   + D+   Q H + D
Sbjct: 65   GGFRVAKQSL-----VSLKEESAGKSMADVITSVIQG--QTLKKELDTDLDRLQTHTKDD 117

Query: 134  KPSERKSNLKVNFTNMRNALEFLANAAGQAAXXXXXXXXXXXXXXXXXXXXDD---HISI 190
                   ++  +   ++NA  FLA AAG  A                    D      S+
Sbjct: 118  ------ISINTDPPTLQNAFYFLAKAAGSVAKEDLRDQVDAATKYDEIEPTDAVSRQPSV 171

Query: 191  DSPATQSTTST---DSVKHLDLSDESIASLFLSENETNRKKVTSLIEAVIAARPISNRKL 247
             S   +  T +    S+  + L+D  + S    E E  +     LIE + + RP  + KL
Sbjct: 172  SSYGNKQATGSMEPSSIPKM-LTDSYVTSFV--EPEGQKPGTIPLIEKLSSVRPKPSMKL 228

Query: 248  TDYDYIGKSKMISEFEAIQLINAFFLTMHPFYPYLPDQLQDPHELARYPILLCTILTISS 307
             D +YIG  ++++E EA + I+AFFLTMHPF PY+P QLQD  ELARYP+LLCTILTIS+
Sbjct: 229  GDIEYIGPYQLLTEAEARKRIDAFFLTMHPFSPYIPLQLQDADELARYPLLLCTILTISA 288

Query: 308  RHHKFNELGTYNGVNDKRHIDVHEKLWVYCQKMISQTVWAEASTRSLGTVLAFLLFTEWN 367
            R+H  ++LG  N +++  H+++HE+LW+YCQ+++SQTVWAEASTRS+GT+LAFL+FTEWN
Sbjct: 289  RYHTLHDLG-LNEIDNTVHVELHERLWIYCQRLVSQTVWAEASTRSIGTILAFLIFTEWN 347

Query: 368  PRAIHWKWADYANNPKLNDFSTSDTGINDYLKVGKRTTGLGAIRRSDRMAWMLCGTSVRI 427
            PRAIHWK +DYAN P ++D     +      +     TGL A+RRSDRM+W+L G +VR+
Sbjct: 348  PRAIHWKGSDYANYPDISDLPKRPSSQTSQPQGSDSLTGLAAMRRSDRMSWLLTGNAVRL 407

Query: 428  AQDMGFIENSSNVFVATHTSETFHAMNVGQRSSLNESLNDTYYSQGRMSSYRNKQQQTLK 487
            AQD+  IE SS +FV TH  ET  AMN+ +RSSL+ESL++      R++ + +     L 
Sbjct: 408  AQDLNVIEFSSKIFVMTHICETHTAMNLNKRSSLSESLSEV-----RLNGFEDND---LD 459

Query: 488  NEIFYIENIFSENFKITERNYWKSQLQXXXXXXXXXXXXXALSDKVRGFLNDEFALFYSN 547
            NE F++E I  +N K  ER  W   L+             +L+D  R FLNDE+ L++ N
Sbjct: 460  NEQFFLERIL-QNDKSKER--WARFLE----RVGERSKKGSLTDIEREFLNDEYLLYHYN 512

Query: 548  GNDPTYSNERNNQPYSSFSTLPLPVNLSKSQQANIELLRIFSTAYKTIYSRXXXXXXXXX 607
              +P      N Q    F      +  SK Q+  +ELL+I S  Y+ +Y+          
Sbjct: 513  TENP------NTQSDPEFR-----LKFSKIQRGKVELLKIVSLGYENVYN----GKLSSH 557

Query: 608  XXXXXISLLDIFAPLLHNWTIAFGDLLQPSDVCEPINLXXXXXXXXXXEFNKIIEGESLI 667
                 +S+L + +PL+  W   +  LL P       ++          E  + +E ESLI
Sbjct: 558  DRHQRLSMLSVLSPLIEGWYNIYKSLLVPCGGAA-CSIAKSSNKSFVFEMTEKVEHESLI 616

Query: 668  CDYNYCQLYIFSLALQI---GLDGEILTVNEITKSSTYINLAYQSAKEYILSTERVFTLK 724
             DY YCQLYI+SLALQ          L +NEITKS+ Y+ LAY +AKE + S +RV  LK
Sbjct: 617  SDYYYCQLYIYSLALQWDHQDTSTSKLRLNEITKSARYVELAYNAAKEILNSAQRVHKLK 676

Query: 725  MLKYMPVRWLTRLIRATAFLVKCYLSVAGTDQELNSISEINMIFKLGGTSANEVLELIKK 784
            MLKYMPVRW+ R++R+  F++KCYL++ G     N   E N I  +     +E+++ I++
Sbjct: 677  MLKYMPVRWVMRIVRSIVFMIKCYLTLTGNGITQN--PEANTILTMSVLPTDEIIQTIQR 734

Query: 785  SAILLGSSSPDELHLCSRYSSIIMCFYKEMSEKNLTRKRGSTDKHNAIEELNKIRQHXXX 844
            +AI+L +++PDELHLCSRYS+I+M    EM  +     +    +  + + L+K       
Sbjct: 735  TAIILRAAAPDELHLCSRYSTILMYLCTEMKHRCKPNMQPPVPRSISNDYLDKTSNR--- 791

Query: 845  XXXXXXXXXXXXXXRVSSDTIRTKTNNFNQINLTRTTKGRPEVALDTEAQASHRKNLQTQ 904
                           V+ ++ R  +    Q++ T      P +   T  +    +  Q +
Sbjct: 792  ------------SENVADNSARHFSVGGYQVSDTANVSSSPFINKGTNVRFGSTEYKQQE 839

Query: 905  TAADESALSTSPSISEVGSKNSNQSLMQLTSQIEVGTSSDLGPTNRDLLSYNTRETSPNT 964
            T  DE      P    V S     S+           + D  P        +   T PN+
Sbjct: 840  TTNDEQQ---RPDTFTVDSALGVASINSAPPAPVPEPAPDTNPA-------SAINTGPNS 889

Query: 965  GHTGVTGEPTGSHANEFLDWFSASGDIGLEFVESWTEMLEQRYMKDDDNLLFNN 1018
                      G    + +DWF+ + +IGL+FV  WTEM+E++++   D+  + N
Sbjct: 890  S--------GGYLPPQLVDWFNDNNEIGLDFVGPWTEMVEKQFVNKVDDSSYEN 935

>KLTH0G03718g Chr7 (292858..295431) [2574 bp, 857 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421W ARO80
           Zinc finger transcriptional activator of the Zn2Cys6
           family activates transcription of aromatic amino acid
           catabolic genes in the presence of aromatic amino acids
          Length = 857

 Score =  538 bits (1387), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 328/817 (40%), Positives = 440/817 (53%), Gaps = 87/817 (10%)

Query: 21  SVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLGTVENEN 80
           S ++RR YKAC+NCR +K +CDLGP ++P  PPCVRCKRE ++C+F E  K+ G      
Sbjct: 14  SQKYRRGYKACLNCRSRKTRCDLGPPDSPRDPPCVRCKRERKECVFLENSKRGG------ 67

Query: 81  DSIDDNQRVPNSPEDEIQQNTDIIQERISSIVATNESRFNNDISNSQKHERKDKPSERKS 140
                 +R+    E  +  NTD+             +RF  +         KD  S ++ 
Sbjct: 68  -----RKRI----EWTVDGNTDV----------NATARFEAEDKYIPVATLKDTTSIKEG 108

Query: 141 NLKVNFTNMRNALEFLANAAGQAAXXXXXXXXXXXXXXXXXXXXDDHISIDSPATQSTTS 200
           +L     +M NALEFLA AAG AA                    D    I S   Q  T 
Sbjct: 109 SLTPELNSMHNALEFLAKAAGSAAKE------------------DSRSRIPSYERQDKTI 150

Query: 201 TDSVKHLDLSDESIASLFLSENETNRKKVTSLIEAVIAARPISNRKLTDYDYIGKSKMIS 260
            +   H + S    AS        +      LIE +   +P S   L D +YIG  K+++
Sbjct: 151 REKTYHREESPNQHAS---GSKRASLATPGKLIEKLSDWKPGSLYDLGDVEYIGGHKLLT 207

Query: 261 EFEAIQLINAFFLTMHPFYPYLPDQLQDPHELARYPILLCTILTISSRHHKFNELGTYNG 320
           E EA +LI+ FFL MHPF+PY+P QL+   EL RYPILLC ILTIS+R+H F E     G
Sbjct: 208 EKEATRLIDLFFLNMHPFFPYIPFQLRCSQELKRYPILLCAILTISARYHNFAEHKVSEG 267

Query: 321 VNDKRHIDVHEKLWVYCQKMISQTVWAEASTRSLGTVLAFLLFTEWNPRAIHWKWADYAN 380
               R+I+VH++LW+YCQ++ISQ+VWAEASTRS+GT+LAFLLFTEWNPRAIHW W DYAN
Sbjct: 268 ERSSRNIEVHDRLWIYCQRLISQSVWAEASTRSVGTILAFLLFTEWNPRAIHWHWTDYAN 327

Query: 381 NPKLNDFSTSDTGINDYLKVGKRT-----TGLGAIRRSDRMAWMLCGTSVRIAQDMGFIE 435
           +  L+D S       DY    KR+     TG+GA+RRSDRMAWML GT+VR+AQDMGF+ 
Sbjct: 328 DTSLSDISR-----RDYHSEAKRSDNTSLTGMGAMRRSDRMAWMLTGTAVRLAQDMGFMN 382

Query: 436 NSSNVFVATHTSETFHAMNVGQRSSLNESLNDTYYSQGRMSSYRNKQQQTLKNEIFYIEN 495
           NS  +F A H +ET  AMN+ QRS L++SL         +S   +     L +    IE 
Sbjct: 383 NSPKIFTALHITETQTAMNMNQRSILSQSL-------AEVSLNGHDGDSGLSSAC--IEE 433

Query: 496 IFSENFKITERNYWKSQLQXXXXXXXXXXXXXALSDKVRGFLNDEFALFYSNGNDPTYSN 555
           IF        +  WKS  Q                D  + FL DE+A F++  +D  Y +
Sbjct: 434 IFRNE---DSKRRWKSYTQ---QRDSVEGKSVGFCDNEKEFLIDEYAFFHNEDSD-AYRD 486

Query: 556 ERNNQPYSSFSTLPLPVNL--SKSQQANIELLRIFSTAYKTIYSRXXXXXXXXXXXXXXI 613
             N   +   S L     L  +  Q+A +ELLRI S  Y+ IY +              +
Sbjct: 487 LSNLGTHEK-SKLSAADKLLFTPRQRAKVELLRIMSIGYEAIYYK--DTKLTLIDHKHKL 543

Query: 614 SLLDIFAPLLHNWTIAFGDLLQP--SDVCEPINLXXXXXXXXXXEFNKIIEGESLICDYN 671
           ++L I AP++  W   +  LL P     C P             +    I+ ESLI DY 
Sbjct: 544 AVLGILAPMIKGWHNTYKHLLVPFAGGQCPPTR---DENKNATYDTPSKIDSESLISDYF 600

Query: 672 YCQLYIFSLALQIGLDGE---ILTVNEITKSSTYINLAYQSAKEYILSTERVFTLKMLKY 728
           YCQLYI+SLALQI    E      +NE+TKS+ Y+ LAY +AKE + S  RV  L+ LKY
Sbjct: 601 YCQLYIYSLALQIEAGTEKDKKPNINELTKSAKYVELAYNAAKEVLHSAIRVHKLRALKY 660

Query: 729 MPVRWLTRLIRATAFLVKCYLSVAGTDQELNSISEINMIFKLGGTSANEVLELIKKSAIL 788
           MPVRW  R+IRA AF+V+CY+++ G+   L S      I  +   SA E++E+I+K+AI 
Sbjct: 661 MPVRWAARIIRAVAFVVRCYMTLTGSG--LGSDPRATTILAVCVISAEEIIEMIQKAAIT 718

Query: 789 LGSSSPDELHLCSRYSSIIMCFYKEMSEKNLTRKRGS 825
           L  +SPDELHLCSR+S+++M    EM  K  +  + S
Sbjct: 719 LREASPDELHLCSRFSTVLMFLCTEMKRKQHSEPQNS 755

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 1/47 (2%)

Query: 973  PTGSH-ANEFLDWFSASGDIGLEFVESWTEMLEQRYMKDDDNLLFNN 1018
            P  SH  +E  DWF  S D+GL+FVE W EMLEQ+++ +D N+ F N
Sbjct: 797  PHPSHLPSELEDWFCTSDDVGLDFVEPWAEMLEQQFINNDKNMTFEN 843

>KNAG0C03250 Chr3 complement(635995..638805) [2811 bp, 936 aa] {ON}
           Anc_5.525 YDR421W
          Length = 936

 Score =  521 bits (1343), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 314/822 (38%), Positives = 438/822 (53%), Gaps = 61/822 (7%)

Query: 16  KSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLGT 75
           K+ G    W R +KAC NCR+KKV+CD GP +NPH PPC RCKRE+++C F     K   
Sbjct: 11  KAVGPQTHWIRGFKACTNCRIKKVRCDFGPSDNPHPPPCARCKRESKNCTFTAKTGK--- 67

Query: 76  VENENDSIDDNQRVPNSPEDEIQQNT---DIIQERISSIVATNESRFNNDISNSQKHERK 132
            E +  + +    +P      +++N      +   +S  +  N S   N+          
Sbjct: 68  -EQDMVTGEATNGIPTVDTVPVKKNELALPALAVTVSPGLIQNRSEMGNE---------- 116

Query: 133 DKPSERKSNLKVNFTNMRNALEFLANAAGQAAXXXXXXXXXXXXXXXXXXXXDDHISIDS 192
              +   +  K+  T+M N L FLA AAG  +                       + I  
Sbjct: 117 ---ANPNTGWKLELTSMHNTLAFLAQAAGTVSNTLNKGLMKKTLPSDRSTPS---LEISR 170

Query: 193 PATQSTTSTDSVKHLDLSDESIASLFLSENETNRKKVTSLIEAVIAARPISNRKLTDYDY 252
             +++ T   S   L +      +L L E ET  K    LIE     +    + L D   
Sbjct: 171 LGSKTPTGFASSLGLGMPSNPTKTL-LQEIETQNK--VQLIEKSKNTKSKVPKTLKDIKC 227

Query: 253 IGKSKMISEFEAIQLINAFFLTMHPFYPYLPDQLQDPHELARYPILLCTILTISSRHHKF 312
           IG++ ++SE EA   I+AFF TMHPF+PY+P QLQDP EL  YPILLC ILTIS+R+H F
Sbjct: 228 IGENGLLSEQEATAFIDAFFCTMHPFFPYIPLQLQDPLELLEYPILLCAILTISTRYHSF 287

Query: 313 NELGTYNGVNDKRHIDVHEKLWVYCQKMISQTVWAEASTRSLGTVLAFLLFTEWNPRAIH 372
           +E G  NG  +KR+ +VHEKLW  CQ M+S+T+W EASTRS+GTVLAF+LFTEWNPR IH
Sbjct: 288 SEFGFDNGDYNKRNFEVHEKLWDNCQVMLSKTIWGEASTRSIGTVLAFILFTEWNPRQIH 347

Query: 373 WKWADYANNPKLNDFSTSDTGINDYLKVGKRTTGLGAIRRSDRMAWMLCGTSVRIAQDMG 432
           WK +DYAN+   +D + S+   ++     +  TG  AIRRSDRMAWML G++VR+AQDMG
Sbjct: 348 WKKSDYAND---DDEAVSELSNDE----AEELTGTKAIRRSDRMAWMLTGSAVRLAQDMG 400

Query: 433 FIENSSNVFVATHTSETFHAMNVGQRSSLNESLN-----DTYYSQGRMSSYRNKQQQTLK 487
           F+E ++ V VATH S+ F +MN+ Q+  L+ + N        Y+   ++S  +  + T  
Sbjct: 401 FMETNAKVCVATHISDAFASMNMNQKPVLSGNFNVLQGGTNNYTSDPLNSSGSSHESTCS 460

Query: 488 NEIFYIENIFSENFKITERNYWKSQLQXXXXXXXXXXXXXALSDKVRGFLNDEFALFYSN 547
            + F  + + + N     R+   S                 LSD  R FLNDEF L+YS 
Sbjct: 461 EQAFMKQMLENTNSHTRWRHILSSLQMEDLFQRQRNEYSNDLSDLEREFLNDEFILYYS- 519

Query: 548 GNDPTYSNERNNQPYSSFSTLPLPVNLSKSQQANIELLRIFSTAYKTIYSRXXXXXXXXX 607
                     +NQ      T P P+  S +Q+A IEL  I    Y TIY           
Sbjct: 520 -----LERRSDNQ-----ETPPFPLQFSYAQKAKIELTNIMLLGYDTIYYDRGRKKLASN 569

Query: 608 XXXXXISLLDIFAPLLHNWTIAFGDLL-QPSDVCEPINLXXXXXXXXXXEFNKIIEGESL 666
                +S+L I +PL+  W   + +LL  PS    P             E +K I+ ES+
Sbjct: 570 NQLHNLSVLSILSPLMEGWHNVYKNLLIAPS--ANPYTTTTRGDKRAMYELSKNIDSESI 627

Query: 667 ICDYNYCQLYIFSLALQIGLDGEILTVNEITKSSTYINLAYQSAKEYILSTERVFTLKML 726
           ICDY Y QLYI+SLALQ       LTV+EIT+++ Y+ +A+ +AKE I S  RV  L +L
Sbjct: 628 ICDYRYSQLYIYSLALQADFKRAELTVSEITQNAKYVEIAFNAAKEIIFSAFRVHKLNLL 687

Query: 727 KYMPVRWLTRLIRATAFLVKCYL-----SVAGTDQELNSISEINMIFKLGGTSANEVLEL 781
           KYMPVRW+ RL+RA +FLVKC L     S+ G     +S +E+  I KL   S  +    
Sbjct: 688 KYMPVRWVMRLVRAVSFLVKCCLILNATSIGGGG---SSEAEVRTILKLCSISVKDTANT 744

Query: 782 IKKSAILLGSSSPDELHLCSRYSSIIMCFYKEM-SEKNLTRK 822
           IK +A+ L  ++PDELHL  RYS+I++   +E+ SEK+ ++K
Sbjct: 745 IKMAAMTLKEATPDELHLSMRYSAILLYLCRELESEKDSSKK 786

 Score = 53.1 bits (126), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 20/36 (55%), Positives = 29/36 (80%)

Query: 974  TGSHANEFLDWFSASGDIGLEFVESWTEMLEQRYMK 1009
            TGS  +E  +WFS + +IGLEFVE WT+M+EQR+++
Sbjct: 883  TGSLPDEVTNWFSGNAEIGLEFVEPWTDMIEQRFLQ 918

>ADR199C Chr4 complement(1048528..1051362) [2835 bp, 944 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR421W
           (ARO80)
          Length = 944

 Score =  475 bits (1223), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 315/858 (36%), Positives = 438/858 (51%), Gaps = 108/858 (12%)

Query: 19  GKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLGTVEN 78
           G   +WRR YKAC+NCR +KV+CDLGP++ P  PPCVRC RE ++CIF E    L    N
Sbjct: 20  GSGRKWRRIYKACLNCRTRKVRCDLGPVDKPREPPCVRCSRERKECIFTE----LRRGRN 75

Query: 79  ENDSIDDNQR-----------VPNSPEDEIQQNTDIIQERI--------SSIVATNESRF 119
               +  N R           V N+  D          E          S   A+N  R 
Sbjct: 76  RRIRVAKNDRAGHAEPDGGICVANAHGDPSSATGRFSGEPTALSAGSDPSPDSASNRGR- 134

Query: 120 NNDISNSQKHERKDKPSERKSNLKVNFTNMRNALEFLANAAGQAAXXXXXXXXXXXXXXX 179
           ++  SNS + E  ++P   + +L   FT + N LEFL  AAG  A               
Sbjct: 135 DDQSSNSDEPEFSERP---ELSLSSEFTTLHNTLEFLTKAAGSVAKDNGRLLSSSTAVGK 191

Query: 180 XXXXXDDHISID--SP---ATQSTTSTDSVKHLDLSDESIASLFLSENETNRKKVTSLIE 234
                 + I++   +P      ++  +       ++D++ AS    E   + K       
Sbjct: 192 HSAAICESITLQLYNPLHNGQYASVVSGPRNPEAITDQAAASRTPQEEPESTKY------ 245

Query: 235 AVIAARPISNRKLTDYDYIGKSKMISEFEAIQLINAFFLTMHPFYPYLPDQLQDPHELAR 294
                 P+    L + +Y+G +  ++  E I+L   FF+T +PF+P++P  +QDP ELAR
Sbjct: 246 ------PL----LRNIEYVGPNNTLTVEEVIRLTELFFVTHYPFFPHIPLHMQDPEELAR 295

Query: 295 YPILLCTILTISSRHHKFNELGTYNGVNDKRHIDVHEKLWVYCQKMISQTVWAEASTRSL 354
           YPILLC +L+IS+R+HKF ++G  N  +  R+IDVHE LW YCQ+MISQTVW EASTRS+
Sbjct: 296 YPILLCGVLSISARYHKFEDIGLSNRGSPTRNIDVHEYLWRYCQQMISQTVWTEASTRSI 355

Query: 355 GTVLAFLLFTEWNPRAIHWKWADYAN-NPKLNDFSTSD--------TGINDYLKVGKR-- 403
           GTVL FL+FTEWNPRAIH K  DYAN   + N+ S S+        +GI    + G R  
Sbjct: 356 GTVLVFLIFTEWNPRAIHRKCNDYANATDRQNEQSHSEKANTAHCGSGIPATERNGPRRF 415

Query: 404 ------TTGLGAIRRSDRMAWMLCGTSVRIAQDMGFIENSSNVFVATHTSETFHAMNVGQ 457
                 ++GL A+RRS RMAWML G +VR+AQDM FI  SS +FVATHTSET  AMN+GQ
Sbjct: 416 VLADQGSSGLSAMRRSKRMAWMLVGNAVRLAQDMDFINTSSKIFVATHTSETNCAMNMGQ 475

Query: 458 RSSLNESLNDTYYSQGRMSSYRNKQQQTLKNEIFYIENIFSENFKITERNYWKSQLQXXX 517
            S+L+ SL +        S+        + N     E         TE  Y KS LQ   
Sbjct: 476 NSTLSHSLMNANIIGSESST-------AISNPPMPSE---------TEERY-KSVLQRLG 518

Query: 518 XXXXXXXXXXALSDKVRGFLNDEFALF-----------YSNGNDPTYSNERNNQPYSS-- 564
                      LS     FL DE  L+           Y +  D T +N      Y S  
Sbjct: 519 KHVPRGR---GLSQLYNEFLEDERILYGLGGGSEYVEAYCDSLDQTKNNVSIETAYESSL 575

Query: 565 FSTLPLPVNLSKSQQANIELLRIFSTAYKTIYSRXXXXXXXXXXXXXXISLLDIFAPLLH 624
                  V LS +Q+A IELLRI S  Y+TIYS               +S+L + +P + 
Sbjct: 576 LERGGQQVFLSFAQRAKIELLRIMSVGYETIYSNHAKLVLREKHHI--LSVLGLLSPQIE 633

Query: 625 NWTIAFGDLLQPSDVCEPINLXXXXXXXXXXEFNKIIEGESLICDYNYCQLYIFSLALQI 684
           NW   +  LL P+    P N           +  + I+ ES+ICDY YCQLYI+SLAL +
Sbjct: 634 NWYTQYNSLLVPAGGA-PFNPTADFSRINPLDLVRRIDAESIICDYYYCQLYIYSLALTV 692

Query: 685 GL----DGEILTVNEITKSSTYINLAYQSAKEYILSTERVFTLKMLKYMPVRWLTRLIRA 740
                       ++ + KS+ Y+ LAY +A+E + S  RV  ++MLKYMP RW+ R++ A
Sbjct: 693 DFRKPRHPNASWLDRLMKSARYVELAYNAAREVLRSAIRVHRIRMLKYMPTRWVERIVGA 752

Query: 741 TAFLVKCYLSVAGTDQELNSISEINMIFKLGGTSANEVLELIKKSAILLGSSSPDELHLC 800
            AF+VKCYL++A     L +  E + I  L     +EV+  I+++AI L  +SPD++HLC
Sbjct: 753 VAFIVKCYLTMAA---HLTASHEASAILTLSAIPPDEVVNTIQRAAITLREASPDDVHLC 809

Query: 801 SRYSSIIMCFYKEMSEKN 818
           ++YS+I+M    EM  +N
Sbjct: 810 NKYSTILMYLCSEMKLRN 827

 Score = 41.2 bits (95), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 23/35 (65%)

Query: 980  EFLDWFSASGDIGLEFVESWTEMLEQRYMKDDDNL 1014
            E +DW   S +IGL+FVE WT+++E+      DN+
Sbjct: 904  ELIDWLHTSDEIGLDFVEPWTDVIERLMESGPDNI 938

>CAGL0F03025g Chr6 (295783..298569) [2787 bp, 928 aa] {ON} similar
           to uniprot|Q04052 Saccharomyces cerevisiae YDR421w
           positive transcription regulator of ARO9 and ARO10
          Length = 928

 Score =  458 bits (1179), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 274/819 (33%), Positives = 437/819 (53%), Gaps = 65/819 (7%)

Query: 17  SKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLGTV 76
           S  +  + + ++ AC+ C+ KK+KCDLGP + P SPPC  C+R    C F+ P  K+G +
Sbjct: 24  SSSQGQKHKNTFGACLRCKYKKIKCDLGPADRPVSPPCAACRRSRSHCFFNAPKVKIGKL 83

Query: 77  ENENDS---------IDDNQRVPNSPEDEIQQ------NTDIIQERISSIVATNESRFNN 121
            N  DS            +  + N+    +Q       N ++    +S++V         
Sbjct: 84  GNILDSQGLQSSQSTSPTSASMLNAITQSLQNHRAMNGNQNMHLNNLSNLVGLKNQNLEG 143

Query: 122 DISNSQKHERKDKPSERKSNL--KVNFTNMRNALEFLANAAGQAAXXXXXXXXXXXXXXX 179
              NS      +     KS+   K+  T+M++ALEFLA A                    
Sbjct: 144 VSLNSPNTALIEACDRVKSDTAWKLELTSMQSALEFLAKAT---------------KLRN 188

Query: 180 XXXXXDDHISIDSPATQSTTSTDSVKHLDLSDESIASLFLSENETNRKKVTSLIEAVIAA 239
                +   S  S A  +T+ T  +   D  +ES ++   +  +T+ +     IEA+   
Sbjct: 189 DYKNNEPFGSTRSDAASTTSETRDLSEKDNGNESDSTTNSTSKDTSTRSSYPSIEAIKPE 248

Query: 240 RPISNRKLTDYDYIGKSKMISEFEAIQLINAFFLTMHPFYPYLPDQLQDPHELARYPILL 299
            P  +    +YD +G  K+++  EA  L+N FF  MHPFYPY+P  LQD  EL +YP+LL
Sbjct: 249 VPTPSNH--NYDLLGDGKLVTMDEARMLVNIFFNFMHPFYPYIPLHLQDFDELFKYPLLL 306

Query: 300 CTILTISSRHHKFNELGTYNGVNDKRHIDVHEKLWVYCQKMISQTVWAEASTRSLGTVLA 359
             IL IS+R++ F+++G  NG+   R++ +H KLW +CQ+++SQTVW++ASTRS+GT LA
Sbjct: 307 HCILAISARYNPFDKVGFDNGIEGNRNVIIHNKLWTHCQQLLSQTVWSQASTRSIGTTLA 366

Query: 360 FLLFTEWNPRAIHWKWADYANNPKLNDFSTSDTGINDYLKVGKRTTGLGAIRRSDRMAWM 419
           FLLFTEWNPRAIHW+ +D A+    N+ S+S     D   +G    G+  ++RSDRMAWM
Sbjct: 367 FLLFTEWNPRAIHWEVSDTAHYLSDNNVSSSK---EDPDGLG----GIATVKRSDRMAWM 419

Query: 420 LCGTSVRIAQDMGFIENSSNVFVATHTSETFHAMNVGQRSSLNESLNDTYYSQGRMSSYR 479
             GT++R+AQ+M  +EN++ ++ A + +E  +A N+  + +L ESL              
Sbjct: 420 FTGTAIRLAQEMDILENNAKIYTAANIAEICYASNMNLKPTLGESLVSIDGGMKEFEIDN 479

Query: 480 NKQQQTLKNE-IFYIENIFSENFKITERNYWKSQLQXXXXXXXXXXXXXALSDKVRGFLN 538
            K Q  ++NE +     + ++N + T++  W   +               + D    FLN
Sbjct: 480 PKSQDDIENEDLLKFVQLVAQNKESTKK--W--AIHKAYSDKLKEENPDLIIDLETEFLN 535

Query: 539 DEFALFYSNGNDPTYSNERNNQPYSSFSTLPLPVNLSKSQQANIELLRIFSTAYKTIYSR 598
           DE+++ Y + N             SSF   P+P   +  Q+A +ELLRI +  Y+TIY  
Sbjct: 536 DEYSINYLDEN-------------SSFLKNPIPY--TTYQKAQLELLRIVTITYQTIYYE 580

Query: 599 XXXXXXXXXXXXXXISLLDIFAPLLHNWTIAFGDLLQPSDVCEPINLXXXXXXXXXXEFN 658
                         + +LD+ +P+L+ W + +  L++P    +P+ +            N
Sbjct: 581 KMKKRVSSVDQKKNLMILDVLSPILNAWYLNYYKLMKPVSDEKPVIISLDDLSKFKRTAN 640

Query: 659 KIIEGESLICDYNYCQLYIFSLALQIGLDGEILTVNEITKSSTYINLAYQSAKEYILSTE 718
             I GES I DY YCQLY FSLALQ+ +    LT+NE+ KS+ ++  AY++AKE + S  
Sbjct: 641 --IRGESFISDYYYCQLYTFSLALQVEVKESKLTLNEMIKSARFVEQAYRAAKEILKSAI 698

Query: 719 RVFTLKMLKYMPVRWLTRLIRATAFLVKCYLSVAGTDQELNSISEINMIFKLGGTSANEV 778
           RV  + MLKYMPVRW+ R++R+ +F+VKCY+++   D  + + SE   I KL G   ++ 
Sbjct: 699 RVHKVDMLKYMPVRWVMRIVRSASFIVKCYITLC--DHSMATNSEAKSILKLSGILVDDT 756

Query: 779 LELIKKSAILLGSSSPDELHLCSRYSSIIMCFYKEMSEK 817
           + +I+++A++L  S+PDELHL S++S+I+M   KE+ E+
Sbjct: 757 VHMIRQAAVILKESTPDELHLASKFSTILMFLCKEIDER 795

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 38/58 (65%), Gaps = 2/58 (3%)

Query: 957  TRETSPNTGHTGVTGEPTGSHANEFLDWFSASGDIGLEFVESWTEMLEQRYMKDDDNL 1014
            TR+  PN+      G+ T     + +DWFSAS +IGL+FVE WTE++EQ+Y+++ D  
Sbjct: 858  TRKVGPNS--IDEIGQFTAYLPEDVIDWFSASNNIGLDFVEPWTELIEQKYIQNKDGF 913

>TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON}
          Anc_2.231 YIL130W possible pseudogene; NNN added to
          avoid internal stop codon
          Length = 852

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 40/82 (48%), Gaps = 7/82 (8%)

Query: 12 MSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLK 71
          M D++ +    + RR  +AC  CR KKVKCD          PC+ C   + +C +++P K
Sbjct: 1  MGDQQQQILQNKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPTK 53

Query: 72 KLGTVENENDSIDDNQRVPNSP 93
          +  T  +       NQ+ P+ P
Sbjct: 54 RSNTSASTQSPQSANQQRPHGP 75

>NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON} 
          Length = 865

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 6/50 (12%)

Query: 20 KSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEP 69
          KS+R +R    CI C+ +K++CD         P C RC+R  RDC+++ P
Sbjct: 20 KSLRRQRRSHVCITCKNQKLRCD------RERPSCSRCRRIGRDCVYESP 63

>KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON}
          similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 833

 Score = 48.9 bits (115), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 28/55 (50%), Gaps = 6/55 (10%)

Query: 10 KRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDC 64
          KR S    K K VR  +++  C  CR +KVKCDLG       P C RC +   +C
Sbjct: 2  KRQSSAGGKAKEVRRVKTFTGCWTCRSRKVKCDLG------KPTCQRCDKSGLEC 50

>Kwal_27.9688 s27 complement(21328..23853) [2526 bp, 841 aa] {ON}
           YML099C (ARG81) - zinc-finger transcription factor of
           the Zn(2)-Cys(6) binuclear cluster domain type [contig
           336] FULL
          Length = 841

 Score = 48.9 bits (115), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 46/89 (51%), Gaps = 8/89 (8%)

Query: 17  SKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDC-IFDEPLKKLGT 75
           +KGK VR  +++  C  CR +KVKCDLG       P C RC++   +C  +D  L+   +
Sbjct: 9   TKGKEVRRVKTFTGCWTCRSRKVKCDLG------KPNCQRCEKSGLECGGYDIKLRWSPS 62

Query: 76  VE-NENDSIDDNQRVPNSPEDEIQQNTDI 103
           ++ N+   +D N    N  E+   Q  ++
Sbjct: 63  IKFNKFGQVDSNGSPANGTEEPQSQRRNV 91

>Kwal_56.23058 s56 complement(381390..383717) [2328 bp, 775 aa] {ON}
           YDR034C (LYS14) - 1:1 [contig 183] FULL
          Length = 775

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 52/105 (49%), Gaps = 10/105 (9%)

Query: 13  SDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIF----DE 68
           S   + GK+V+ + S   C  C+ +++KCD G       P C +C R  R+C++      
Sbjct: 131 SSSGADGKTVKRKYSRNGCTECKRRRMKCDEG------KPTCWQCARLNRECVYVIRTKN 184

Query: 69  PLKKLGTVENENDSIDDNQRVPNSPEDEIQQNTDIIQERISSIVA 113
             ++  + +N  D+    QRV  S +  + +   ++++ I+S V+
Sbjct: 185 RKRRPKSTDNSKDTSKPGQRVQKSEKGILPRTNTVVEKAIASPVS 229

>AAL175W Chr1 (32874..35525) [2652 bp, 883 aa] {ON} Non-syntenic
          homolog of Saccharomyces cerevisiae YML099C (ARG81)
          Length = 883

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 30/55 (54%), Gaps = 8/55 (14%)

Query: 12 MSDKKSKGKSVRWRRS--YKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDC 64
          +  K+  G +VR  R+  +  C  CRL+KVKCDLG       P C RC++   DC
Sbjct: 23 LQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLG------KPSCQRCEKSGLDC 71

>YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc
          cluster protein proposed to function as a
          transcriptional regulator involved in the stress
          response; null mutants have a respiratory deficiency,
          calcofluor white sensitivity and slightly increased
          cycloheximide resistance
          Length = 964

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 8/62 (12%)

Query: 12 MSDKKSKG-KSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPL 70
          M ++  +G +SV+ RR  +AC  CR KKVKCD          PC+ C   + +C + +P 
Sbjct: 1  MPEQAQQGEQSVKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYKKPT 53

Query: 71 KK 72
          K+
Sbjct: 54 KR 55

>Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W
          (REAL)
          Length = 926

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 8/62 (12%)

Query: 12 MSDKKSKG-KSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPL 70
          M ++  +G +SV+ RR  +AC  CR KKVKCD          PC+ C   + +C + +P 
Sbjct: 1  MPEQAQQGEQSVKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYKKPT 53

Query: 71 KK 72
          K+
Sbjct: 54 KR 55

>Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W
          (REAL)
          Length = 1012

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 8/62 (12%)

Query: 12 MSDKKSKG-KSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPL 70
          M ++  +G +SV+ RR  +AC  CR KKVKCD          PC+ C   + +C + +P 
Sbjct: 1  MPEQAQQGEQSVKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYKKPT 53

Query: 71 KK 72
          K+
Sbjct: 54 KR 55

>Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W
          (REAL)
          Length = 954

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 8/62 (12%)

Query: 12 MSDKKSKG-KSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPL 70
          M ++  +G +SV+ RR  +AC  CR KKVKCD          PC+ C   + +C + +P 
Sbjct: 1  MPEQPQQGEQSVKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYKKPT 53

Query: 71 KK 72
          K+
Sbjct: 54 KR 55

>NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa]
          {ON} Anc_2.231
          Length = 906

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 35/66 (53%), Gaps = 7/66 (10%)

Query: 7  RLSKRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIF 66
          ++    S ++++ + V+ RR  +AC  CR KKVKCD          PC+ C   + +C +
Sbjct: 13 KIKNEPSPRQTEHQIVKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTY 65

Query: 67 DEPLKK 72
          + P K+
Sbjct: 66 NHPSKR 71

>TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {ON}
           Anc_2.231 YIL130W
          Length = 890

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 29/56 (51%), Gaps = 7/56 (12%)

Query: 23  RWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLGTVEN 78
           + RR  +AC  CR KKVKCD          PC+ C   +  C +D+P+KK  T  N
Sbjct: 64  KRRRVTRACDECRKKKVKCD-------GQNPCIHCTVYSYKCSYDQPVKKNNTNHN 112

>NCAS0D02960 Chr4 complement(563406..566924) [3519 bp, 1172 aa] {ON}
           Anc_6.75 YLR278C
          Length = 1172

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 63/154 (40%), Gaps = 35/154 (22%)

Query: 2   FLKELRLSKRMSD---KKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCK 58
           F KEL L+    D   +  KG+S        AC+ CR +K KCD         P C  C 
Sbjct: 16  FQKELELAGDQIDTLLRDKKGRST-------ACLLCRRRKQKCDH------QLPSCTACL 62

Query: 59  REARDCIFDEPLKKLGTVENENDSIDDNQRVPNSPEDEIQQNTDIIQ------------E 106
           + A  C+  +P +      NE    DDN  V N  E   +Q  D +Q            +
Sbjct: 63  KAAVKCV--QPSRY-----NEKHESDDNDEVDNENEQLTKQQDDHVQAPLNTHLLSFPIQ 115

Query: 107 RISSIVATNESRFNNDISNSQKHERKDKPSERKS 140
           ++S +   N +  + +I   QK  +  KP + KS
Sbjct: 116 KLSVLPLANNNSISMEIKEQQKPNKITKPKQNKS 149

>CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130w
          Length = 847

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 7/51 (13%)

Query: 23 RWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKL 73
          + R+  +AC +CR KKVKCD        + PC+ C   + +C ++ PLK+L
Sbjct: 12 KRRKVTRACDDCRKKKVKCD-------GNQPCIHCTVYSYECTYNHPLKRL 55

>KAFR0B06340 Chr2 (1311310..1313904) [2595 bp, 864 aa] {ON}
          Anc_8.423 YLR228C
          Length = 864

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 31/65 (47%), Gaps = 6/65 (9%)

Query: 6  LRLSKRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCI 65
          L +  +   K S GK     +S   C+NC+ ++VKCD         P C++C     DC+
Sbjct: 30 LEIDGKKVSKTSTGKRKFHNKSKTGCLNCKRRRVKCD------ETKPFCIKCTNMKLDCV 83

Query: 66 FDEPL 70
          +  PL
Sbjct: 84 YVTPL 88

>Kwal_47.16862 s47 complement(147009..149240) [2232 bp, 743 aa] {ON}
           YML076C (WAR1) - ORF [contig 219] FULL
          Length = 743

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 44/91 (48%), Gaps = 2/91 (2%)

Query: 5   ELRLSKRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDC 64
           +LRLS+          + R +R+  AC NC  +K KC    + + +  PCVRC++  + C
Sbjct: 34  DLRLSQPTPLDSPTTSAGRPKRNTFACTNCHAQKSKCVPSDVLDIYRKPCVRCRKRNKLC 93

Query: 65  IFDEPLKKLGTVENENDSIDDNQRVPNSPED 95
            FD  L +     + N S   N  VP +P D
Sbjct: 94  TFD--LSRRTRRRHRNSSSSSNASVPVTPAD 122

>SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 823

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 12/64 (18%)

Query: 12 MSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLK 71
          MS+ +SK      RR  +AC  CR KKVKCD          PC+ C   + +C +++P K
Sbjct: 1  MSEPQSK-----RRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPTK 48

Query: 72 KLGT 75
          + G+
Sbjct: 49 RGGS 52

>NDAI0C00260 Chr3 (40019..43144) [3126 bp, 1041 aa] {ON} Anc_2.654
          YKL015W
          Length = 1041

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 31/62 (50%), Gaps = 11/62 (17%)

Query: 26 RSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKK----LGTVENEND 81
          R   ACI CR + VKC       P+  PC+RC +    C + EP +K    L  ++N  D
Sbjct: 35 RKSNACIQCRRRHVKC-------PNGNPCLRCVKSKLQCEYSEPSRKIVVSLSYLQNLQD 87

Query: 82 SI 83
          SI
Sbjct: 88 SI 89

>KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa]
          {ON} Anc_2.231 YIL130W
          Length = 848

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 7/51 (13%)

Query: 22 VRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKK 72
          V+ RR  +AC  CR KKVKCD          PC+ C   + +C +++P K+
Sbjct: 9  VKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPSKR 52

>Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar to
          Ashbya gossypii AER370W
          Length = 826

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 35/64 (54%), Gaps = 7/64 (10%)

Query: 15 KKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLG 74
          ++   +  + RR  +AC  CR KKVKCD     N H  PC+ C   + +C +++P ++ G
Sbjct: 6  ERQGSRIAKRRRITRACDECRKKKVKCD-----NRH--PCIHCTVYSYECTYNQPARRTG 58

Query: 75 TVEN 78
            +N
Sbjct: 59 GNKN 62

>NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa]
          {ON} Anc_2.231 YIL130W
          Length = 930

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 7/62 (11%)

Query: 11 RMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPL 70
          R+    ++    + RR  +AC  CR KKVKCD          PC+ C   + +C +++P 
Sbjct: 19 RLLQDPAQQHMAKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPT 71

Query: 71 KK 72
          K+
Sbjct: 72 KR 73

>CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa]
           {ON} similar to uniprot|Q12180 Saccharomyces cerevisiae
           YOL089c HAL9
          Length = 1053

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 53/118 (44%), Gaps = 27/118 (22%)

Query: 25  RRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIF-DEPLKKLGTVENENDSI 83
           RR+ KAC  CR +K KCD     +P++  C  C +   DCIF  EP KK     +E   +
Sbjct: 172 RRAAKACEYCRKRKTKCDEV---SPYTNKCSNCSKAGVDCIFITEPTKKKRKSSSEGTKV 228

Query: 84  D----------------------DNQRVPNSPEDEIQQNTDIIQERISSIVATNESRF 119
           +                      DN+ V  +  + I +  +I+  ++S+++  N +RF
Sbjct: 229 NKSPKPAAKTNSTKHKVKKQSDGDNEPVHQNTVENIAKRMEILDRKMSTVI-DNIARF 285

>TBLA0I02540 Chr9 (590352..594131) [3780 bp, 1259 aa] {ON} Anc_8.423
           YLR228C
          Length = 1259

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 32/65 (49%), Gaps = 6/65 (9%)

Query: 2   FLKELRLSKRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREA 61
            ++ + ++ +   K S GK     +S   C+NC+ ++VKCD G       P C +C    
Sbjct: 174 IIELIEVNGKKVSKTSTGKRKFHNKSKNGCVNCKRRRVKCDEG------KPTCKKCLNMK 227

Query: 62  RDCIF 66
            DC++
Sbjct: 228 LDCVY 232

>Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}
          YKL222C (REAL)
          Length = 688

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 38/78 (48%), Gaps = 12/78 (15%)

Query: 18 KGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLGTVE 77
          K K+VR  ++ KAC+NCR KK KCD         P C +C+    +C++      LG   
Sbjct: 3  KKKAVRRNKAIKACLNCRRKKQKCDQA------RPQCYQCRIRKTECVY------LGEKA 50

Query: 78 NENDSIDDNQRVPNSPED 95
          ++N     N  +  +P D
Sbjct: 51 DKNSISIPNSILDTTPFD 68

>KLTH0C07480g Chr3 (645219..647546) [2328 bp, 775 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co- inducer
          Length = 775

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 6/59 (10%)

Query: 8   LSKRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIF 66
           L+ + +   S GK+V+ + S   C  C+ +++KCD G       P C +C R  R+C++
Sbjct: 126 LASQPASSNSNGKTVKRKYSRNGCTECKRRRMKCDEG------KPTCWQCARLNRECVY 178

>Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON}
          (29727..32705) [2979 nt, 993 aa]
          Length = 992

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 40/73 (54%), Gaps = 12/73 (16%)

Query: 23 RWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKK----LGTVEN 78
          + RR  +AC  CR KKVKCD          PC+ C   + +C +++P K+    L  ++N
Sbjct: 28 KRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYNCTYNQPSKRSNSNLQHLKN 80

Query: 79 ENDSI-DDNQRVP 90
           ++++ + N+ +P
Sbjct: 81 SSENLANKNENIP 93

>SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON}
          similar to uniprot|P05085 Saccharomyces cerevisiae
          YML099C ARG81 Zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type involved in
          the regulation of arginine-responsive genes acts with
          Arg80p and Arg82p
          Length = 848

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 6/53 (11%)

Query: 12 MSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDC 64
          M  +KS  +  R  +++  C  CR +KVKCDLG       P C RC+R   +C
Sbjct: 1  MKVEKSDIRKPRRAKTFTGCWTCRSRKVKCDLG------RPSCKRCERSGFEC 47

>TBLA0E04750 Chr5 (1222163..1226014) [3852 bp, 1283 aa] {ON}
           Anc_4.344 YML076C
          Length = 1283

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 33/66 (50%)

Query: 2   FLKELRLSKRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREA 61
            ++ + L      K ++ +    +R+  AC++C   KVKC    L++ +  PC RC +  
Sbjct: 93  IIQGIELDDARVQKPTRSEGGSSKRNTFACVSCHSSKVKCIPSQLDDIYRKPCQRCLKNG 152

Query: 62  RDCIFD 67
           + C FD
Sbjct: 153 KVCTFD 158

>ZYRO0E00572g Chr5 (35940..38456) [2517 bp, 838 aa] {ON} similar to
           uniprot|P25502 Saccharomyces cerevisiae YKL015W PUT3
           Positive regulator of PUT (proline utilization) genes
           zinc-finger transcription factor of the Zn(2)-Cys(6)
           binuclear cluster domain type
          Length = 838

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 51/107 (47%), Gaps = 22/107 (20%)

Query: 25  RRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLGTVENENDSID 84
           RRS  AC+ CR K VKC       P   PC +C      C + EP KKL TV     S+ 
Sbjct: 36  RRSTLACVRCRRKHVKC-------PGGDPCSKCSAARIACEYLEPNKKL-TV-----SMK 82

Query: 85  DNQRVPNSPEDEIQQNTDIIQERISSIVATNESRFNNDISNSQKHER 131
             Q++  +  D  ++N      ++ SIV T     N+D++ S+  ER
Sbjct: 83  YLQQLQENLADLKRENV-----KLQSIVNT----VNSDVTESKIKER 120

>KNAG0A04480 Chr1 complement(626229..629270) [3042 bp, 1013 aa] {ON}
           Anc_8.423 YLR228C
          Length = 1013

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 32/65 (49%), Gaps = 6/65 (9%)

Query: 2   FLKELRLSKRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREA 61
           +++ + +  +   K S GK     +S   CINC+ ++VKCD G       P C +C   +
Sbjct: 68  YIELIEVDGKTVSKTSTGKRKFHNKSKTGCINCKKRRVKCDEG------KPACKKCTNMS 121

Query: 62  RDCIF 66
             C++
Sbjct: 122 LSCVY 126

>Ecym_3392 Chr3 (741359..743902) [2544 bp, 847 aa] {ON} similar to
          Ashbya gossypii ACL096W
          Length = 847

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 35/70 (50%), Gaps = 9/70 (12%)

Query: 4  KELRLSKRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARD 63
          KE+RLS+    K+  G   R +R+  AC+ CR + V+C       P   PC +C      
Sbjct: 32 KEVRLSEDY--KEGGGNKERKKRAPLACLRCRKRHVRC-------PGGNPCSKCVSANIA 82

Query: 64 CIFDEPLKKL 73
          C + EP KKL
Sbjct: 83 CEYLEPSKKL 92

>NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON} 
          Length = 656

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 42/86 (48%), Gaps = 16/86 (18%)

Query: 18  KGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLGTVE 77
           + KS+R +R    C  CR +K++C      N   P C RC+R  R C++++         
Sbjct: 2   QKKSIRGQRPTHVCAACRTQKLRC------NRERPSCSRCQRIGRTCVYEK--------H 47

Query: 78  NENDSIDDNQRVPNSPEDEIQQNTDI 103
           +E+  + +N+  P +P   I +  D+
Sbjct: 48  SEDTLVSNNE--PITPSSIISKAHDV 71

>KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly
          similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 782

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 33/62 (53%), Gaps = 12/62 (19%)

Query: 12 MSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLK 71
          MSD ++K      RR  +AC  CR KKVKCD          PC+ C   + +C +++P K
Sbjct: 1  MSDLQNK-----RRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPSK 48

Query: 72 KL 73
          ++
Sbjct: 49 RV 50

>Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W
          (GIN1) - 1:1 [contig 5] FULL
          Length = 812

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 32/61 (52%), Gaps = 12/61 (19%)

Query: 12 MSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLK 71
          MSD ++K      RR  +AC  CR KKVKCD          PC+ C   + +C +++P K
Sbjct: 1  MSDLQNK-----RRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQPSK 48

Query: 72 K 72
          +
Sbjct: 49 R 49

>Smik_2.151 Chr2 (282822..285581) [2760 bp, 919 aa] {ON} YBR033W
           (REAL)
          Length = 919

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 43/86 (50%), Gaps = 5/86 (5%)

Query: 9   SKRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDE 68
           S R+ +++ +G + + +++ +AC  CR K++KC      N H+  C  C      C+F  
Sbjct: 34  SSRICERRGEGVTKQRKKASRACDQCRKKRIKCRF----NQHTGVCQGCLEVNEKCLFVR 89

Query: 69  -PLKKLGTVENENDSIDDNQRVPNSP 93
            PLK+    +  N+  +DN    N P
Sbjct: 90  VPLKRGPAKKRSNEVSNDNFSSGNGP 115

>TPHA0B00410 Chr2 complement(84722..87559) [2838 bp, 945 aa] {ON}
          Anc_4.344 YML076C
          Length = 945

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 22/43 (51%)

Query: 25 RRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFD 67
          +R+  ACI C   K KC    L N    PC+RC +  R C FD
Sbjct: 36 KRNTVACITCHSSKQKCVPSDLNNIFWKPCIRCLKSKRQCTFD 78

>KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa]
          {ON} Anc_8.423 YLR228C
          Length = 730

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 30/60 (50%), Gaps = 7/60 (11%)

Query: 10 KRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEP 69
          KR+S K S GK     +S   C NC+ ++VKCD G       P C +C     +C+F  P
Sbjct: 14 KRVS-KNSTGKRKFHNKSKNGCDNCKRRRVKCDEG------KPFCQKCANMRLECVFTPP 66

>AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YIL130W
          Length = 801

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 31/54 (57%), Gaps = 7/54 (12%)

Query: 16 KSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEP 69
          +S G  ++ RR  +AC  CR KKVKCD     + H  PC+ C   + +C +++P
Sbjct: 3  ESAGLGLKRRRVTRACDECRKKKVKCD-----SRH--PCIHCTVYSYECTYNQP 49

>CAGL0H06875g Chr8 complement(682518..684626) [2109 bp, 702 aa]
          {ON} some similarities with uniprot|P05085
          Saccharomyces cerevisiae YML099c ARG81
          Length = 702

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 24/45 (53%), Gaps = 6/45 (13%)

Query: 20 KSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDC 64
          KS R  ++Y  C  CR +KVKCDL        P C+RC+R    C
Sbjct: 4  KSTRSVKTYSGCWTCRARKVKCDLV------RPSCLRCRRSKVQC 42

>TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa]
          {ON} Anc_2.231 YIL130W
          Length = 1000

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 7/57 (12%)

Query: 13 SDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEP 69
          S+ +     ++ RR  +AC  CR KKVKCD          PC+ C   + +C +++P
Sbjct: 48 SNTQGNPIQLKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNQP 97

>KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON}
          Anc_2.231 YIL130W
          Length = 902

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 7/51 (13%)

Query: 22 VRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKK 72
           + RR  +AC  CR KKVKCD          PC+ C   + +C ++ P K+
Sbjct: 28 AKRRRVTRACDECRKKKVKCD-------GQQPCIHCTVYSYECTYNHPTKR 71

>TPHA0L01060 Chr12 (220857..223778) [2922 bp, 973 aa] {ON}
          Anc_8.423 YLR228C
          Length = 973

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 6/52 (11%)

Query: 15 KKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIF 66
          K S GK     +S   C NC+ ++VKCD         P CV+C     DC++
Sbjct: 36 KTSTGKRKFHNKSKNGCDNCKRRRVKCDEA------KPACVKCSNMKLDCVY 81

>NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa]
          {ON} Anc_6.279 YPL248C
          Length = 1033

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/80 (32%), Positives = 43/80 (53%), Gaps = 15/80 (18%)

Query: 29 KACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKK-------LGTVENEND 81
          +AC NCRLKK+KC      + H P C +C +    CI+   +K+       L  +EN+ +
Sbjct: 9  QACDNCRLKKLKC------SKHFPKCGQCLKNNWPCIYSPKVKRSPLTRVHLTNLENKLE 62

Query: 82 SIDD--NQRVPNSPEDEIQQ 99
           +++  N+ +PN   +EI Q
Sbjct: 63 KLENLFNKLLPNENINEILQ 82

>KLLA0F18084g Chr6 complement(1652031..1654613) [2583 bp, 860 aa]
          {ON} conserved hypothetical protein
          Length = 860

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 31/61 (50%), Gaps = 8/61 (13%)

Query: 30 ACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKK--LGTVENENDSIDDNQ 87
          +C NCR  + KCD G       P C RC +   DC+++ P K     +V+  ND I + Q
Sbjct: 4  SCQNCRKTRRKCDRG------KPTCARCIKYKIDCVYELPPKHKIKQSVDIGNDMISETQ 57

Query: 88 R 88
          R
Sbjct: 58 R 58

>TBLA0A04280 Chr1 complement(1059254..1061932) [2679 bp, 892 aa]
           {ON} Anc_7.17 YOR363C
          Length = 892

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 51/116 (43%), Gaps = 22/116 (18%)

Query: 20  KSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLGTVENE 79
           + V+  R  K C+ CR +KVKCD         P C+RC + +  C +        +    
Sbjct: 4   RGVKKPRPSKVCLTCRRRKVKCD------QQHPSCMRCIKSSTLCTYTY------STPVS 51

Query: 80  NDSIDDNQRVPNS---PEDEIQQNTDIIQ-----ERISSIVATNESRFNNDISNSQ 127
           +DS+ D+   P S   P+  +   TD +         SSI  T+   FNN++  S+
Sbjct: 52  DDSLPDSLDTPKSMSQPKKSVMPTTDQLMTIGYTHTPSSI--TDHHDFNNNLPPSE 105

>TBLA0H00680 Chr8 complement(144914..147556) [2643 bp, 880 aa] {ON}
           Anc_8.423 YLR228C
          Length = 880

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 49/99 (49%), Gaps = 18/99 (18%)

Query: 15  KKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIF------DE 68
           K SKGK     +S   C NC+ ++VKCD G       P C +C      C++      ++
Sbjct: 90  KTSKGKRKFHNKSKNGCANCKRRRVKCDEG------KPTCQKCLNMKLQCVYLPVTARNK 143

Query: 69  P-LKKLGTVEN-----ENDSIDDNQRVPNSPEDEIQQNT 101
           P + ++ T+ N      N +I+ N+++ +  + +++ N+
Sbjct: 144 PKISQVETLPNPSIMTSNSTINSNEKIKSESDIKVKDNS 182

>NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879
          Length = 839

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 6/49 (12%)

Query: 16 KSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDC 64
          K++ K  R  +++  C  CR +KVKCDL        P CVRC +   +C
Sbjct: 6  KTQTKRPRRAKTFTGCWTCRSRKVKCDL------RRPGCVRCDKSGLEC 48

>KAFR0E01250 Chr5 complement(249538..251748) [2211 bp, 736 aa] {ON}
           Anc_3.264 YDR034C
          Length = 736

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 47/104 (45%), Gaps = 10/104 (9%)

Query: 15  KKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFD-EPLKKL 73
           K  KG  V+ + S   C  C+ +++KCD         P C +C R  R+C++   P  K 
Sbjct: 139 KDGKGNIVKRKYSRNGCTECKRRRMKCD------ETKPSCWQCARLNRECVYVLNPKNKK 192

Query: 74  GTVENENDSIDDN-QRVPNSPEDEIQQNTDIIQERISSIVATNE 116
              ++ + SI    +  P +  DE+  N D I  RI S    N+
Sbjct: 193 RKTQSTSSSIHTKIKEPPTNKADEVVANADDI--RIPSFEPLND 234

>YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}
          MAL33MAL-activator protein, part of complex locus MAL3;
          nonfunctional in genomic reference strain S288C
          Length = 468

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 7/46 (15%)

Query: 30 ACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLGT 75
          AC  CR+++VKCD          PC RC     DC + +PLKK G+
Sbjct: 7  ACDYCRVRRVKCD-------GKKPCSRCIEHNFDCTYQQPLKKRGS 45

>NDAI0K01800 Chr11 (401055..404687) [3633 bp, 1210 aa] {ON}
           Anc_2.547
          Length = 1210

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 5/48 (10%)

Query: 26  RSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDE-PLKK 72
           ++ +AC  CR KK+KCD    +N     C  C+R A  C F+  PLK+
Sbjct: 86  KASRACDQCRKKKIKCDFTEAKN----ICSNCQRNAEKCTFERVPLKR 129

>Skud_15.334 Chr15 (602966..605338) [2373 bp, 790 aa] {ON} YOR172W
           (REAL)
          Length = 790

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 44/92 (47%), Gaps = 17/92 (18%)

Query: 19  GKSVRWRRS-YKACINCRLKKVKCDLGPLENPHSPPCVRCKREAR-DCIFDEPLKKLGTV 76
           GK+VR RR   K+C  CR +K++CD         P C  CK   R DC++ E        
Sbjct: 18  GKNVRKRRKPIKSCAFCRKRKLRCD------QQKPVCSTCKARRRTDCLYTEEF------ 65

Query: 77  ENENDSIDDNQRVPNSPEDEIQQNTDIIQERI 108
                SI+  +   N+P  E+ +  + +++R+
Sbjct: 66  ---GHSIESEELFGNTPNIELLKRVEELEKRL 94

>TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3.109
           YOL089C
          Length = 1046

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 54/109 (49%), Gaps = 17/109 (15%)

Query: 25  RRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLGTVENENDSID 84
           RR  KAC NCR +K+KCD     +P    C  C +  + C F E   ++ T  N + +  
Sbjct: 157 RRVVKACYNCRRRKIKCDAI---DPSKNKCSNCLKLNKICSFSEN-DEINTPFNISHNST 212

Query: 85  DNQRVPNSPE----------DEIQQNTDIIQERISSIVATNESRFNNDI 123
           +N++  ++P             I  +T+++ ER+  IV  N SR NND+
Sbjct: 213 NNKKQKSNPPIHSSNIQHSISGIHPDTNLLSERL--IVLEN-SRDNNDL 258

>KLLA0E19603g Chr5 complement(1739869..1741914) [2046 bp, 681 aa]
          {ON} weakly similar to uniprot|P26370 Saccharomyces
          cerevisiae YDL170W
          Length = 681

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 6/61 (9%)

Query: 12 MSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLK 71
          M+   S+G+  R R S K C+ C+++K +C      +   P C  C R + DC+F + L 
Sbjct: 1  MAVDLSEGEPKRRRHSKKGCLTCKVRKKRC------SEDRPICKDCARLSLDCVFPDNLT 54

Query: 72 K 72
          K
Sbjct: 55 K 55

>Smik_12.289 Chr12 complement(540824..543262) [2439 bp, 812 aa]
          {ON} YLR228C (REAL)
          Length = 812

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 7/57 (12%)

Query: 10 KRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIF 66
          KR+S K S GK     +S   C NC+ ++VKCD G       P C +C     DC++
Sbjct: 24 KRVS-KTSTGKRKFHNKSKTGCDNCKRRRVKCDEG------KPFCKKCTNMKLDCVY 73

>KLLA0E18129g Chr5 (1613115..1615712) [2598 bp, 865 aa] {ON}
          similar to uniprot|P25502 Saccharomyces cerevisiae
          YKL015W PUT3 Positive regulator of PUT (proline
          utilization) genes zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 865

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 30/62 (48%), Gaps = 12/62 (19%)

Query: 12 MSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLK 71
          ++DKK K K     RS  AC  CR + +KC       P   PC +C +    C + EP K
Sbjct: 32 LNDKKKKVK-----RSSLACTRCRRRHIKC-------PGGNPCSKCLKAGVACEYVEPNK 79

Query: 72 KL 73
          KL
Sbjct: 80 KL 81

>KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa]
          {ON} similar to uniprot|P40467 Saccharomyces cerevisiae
          YIL130W ASG1 Proposed transcriptional activator member
          of the Gal4p family of zinc cluster proteins
          Length = 916

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 7/53 (13%)

Query: 23 RWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLGT 75
          + RR  +AC  CR KKVKCD          PC+ C     +C +++P ++  T
Sbjct: 6  KRRRVTRACDECRKKKVKCD-------GKQPCIHCTVYNYECTYNQPTRRTVT 51

>SAKL0G19470g Chr7 complement(1677759..1680254) [2496 bp, 831 aa]
          {ON} similar to uniprot|P25502 Saccharomyces cerevisiae
          YKL015W PUT3 Positive regulator of PUT (proline
          utilization) genes zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 831

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 30/64 (46%), Gaps = 9/64 (14%)

Query: 12 MSDKKSKGKSVRWR--RSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEP 69
          + D   +G  +R R  RS  AC+ CR + VKC       P   PC +C      C + EP
Sbjct: 27 LEDLHDEGGQLRKRQKRSSMACVRCRRRHVKC-------PGGNPCSKCIAANIACEYIEP 79

Query: 70 LKKL 73
           KKL
Sbjct: 80 NKKL 83

>TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON} Anc_2.654
           YKL015W
          Length = 1037

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 33/73 (45%), Gaps = 21/73 (28%)

Query: 25  RRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKK------------ 72
           R+  +ACI CR + +KC       P + PC +C      C F EP KK            
Sbjct: 53  RKITRACIRCRERHIKC-------PGNDPCQKCLEANHICKFSEPNKKVIVSINYLTKLH 105

Query: 73  --LGTVENENDSI 83
             + T+E+EN S+
Sbjct: 106 DNIKTLEDENSSL 118

>KLLA0A04169g Chr1 complement(376273..378600) [2328 bp, 775 aa]
          {ON} similar to uniprot|Q05958 Saccharomyces cerevisiae
          YLR228C ECM22 Sterol regulatory element binding protein
          regulates transcription of the sterol biosynthetic
          genes ERG2 and ERG3 member of the fungus-specific
          Zn[2]-Cys[6] binuclear cluster family of transcription
          factors homologous to Upc2p
          Length = 775

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 32/61 (52%), Gaps = 6/61 (9%)

Query: 6  LRLSKRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCI 65
          + L  +   K + GK    ++S   C +C+ ++VKCD      PH   C+ CK+ + DC+
Sbjct: 32 IELHGKTVSKTATGKRKFHKKSKNGCDHCKRRRVKCD---ETRPH---CLNCKKMSLDCV 85

Query: 66 F 66
          +
Sbjct: 86 Y 86

>KNAG0E04100 Chr5 (814663..817374) [2712 bp, 903 aa] {ON}
          Anc_4.344 YML076C
          Length = 903

 Score = 41.6 bits (96), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 26/49 (53%)

Query: 19 GKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFD 67
          G+  + +R+  AC+ C   K KC      + +  PCVRC R+ + C FD
Sbjct: 47 GRGGKNKRNTFACVGCHSLKQKCVPSDFNDIYRKPCVRCFRQRKKCKFD 95

>KLLA0E02663g Chr5 (244696..248025) [3330 bp, 1109 aa] {ON}
          conserved hypothetical protein
          Length = 1109

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 3/64 (4%)

Query: 6  LRLSKRMSDKKSKGKSVRWRRSYK-ACINCRLKKVKCDLGPLENPHSPP--CVRCKREAR 62
          +++S   S + S+    R R+  K AC+ CR +K+KCD     +P   P  C  C R   
Sbjct: 1  MKISNEESARDSRHPDSRKRKVAKRACLACRERKIKCDGEANPDPSGGPGKCTNCVRSTL 60

Query: 63 DCIF 66
          +C+F
Sbjct: 61 ECVF 64

>CAGL0K11902g Chr11 complement(1149210..1151705) [2496 bp, 831 aa]
           {ON} similar to uniprot|P40971 Saccharomyces cerevisiae
           YDR034c LYS14 transcriptional activator of lysine
           pathway genes
          Length = 831

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 28/52 (53%), Gaps = 6/52 (11%)

Query: 15  KKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIF 66
           K ++G +V+ + S   C  C+ +++KCD         P C +C R  RDC++
Sbjct: 188 KDAEGNTVKRKYSRNGCAECKRRRMKCD------ESKPKCWQCTRLNRDCVY 233

>KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON}
          Anc_2.654 YKL015W
          Length = 818

 Score = 41.6 bits (96), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 11/73 (15%)

Query: 20 KSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKK----LGT 75
          K+ + +R   AC+ CR + +KC       P+  PC +C +    C + EP +K    +  
Sbjct: 23 KTKKQKRQQIACLECRKRHIKC-------PNGNPCFKCLKNNLKCEYIEPSRKIVISMKY 75

Query: 76 VENENDSIDDNQR 88
          + N  DS+ D +R
Sbjct: 76 LSNLQDSLVDLKR 88

>TDEL0F05470 Chr6 (1017743..1020175) [2433 bp, 810 aa] {ON}
          Anc_8.423 YLR228C
          Length = 810

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 9/66 (13%)

Query: 9  SKRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFD- 67
           KR+S + S GK     +S   C NC+ ++VKCD G       P C +C     DC++  
Sbjct: 29 GKRVS-RTSTGKRKFHNKSKNGCDNCKRRRVKCDEG------KPACQKCLNMKLDCVYTP 81

Query: 68 -EPLKK 72
           +P KK
Sbjct: 82 VQPKKK 87

>KAFR0C03660 Chr3 complement(745068..747611) [2544 bp, 847 aa] {ON} 
          Length = 847

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 38/91 (41%), Gaps = 8/91 (8%)

Query: 20  KSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLGTVENE 79
           K  R  R    C+ CR +K+KCD         P C RC +  R C+++         EN 
Sbjct: 4   KDFRKIRPSYVCVTCRTQKLKCD------KQRPSCGRCLKNKRKCVYEINSSLDSLHENS 57

Query: 80  NDSIDDNQRVPNSPEDEIQQNTDIIQERISS 110
             S  +NQ  P S       N  +I+  ISS
Sbjct: 58  MRSHSNNQISPASSSG--HSNATLIENSISS 86

>KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON} Anc_2.547
           YKL038W
          Length = 1088

 Score = 41.2 bits (95), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 5/51 (9%)

Query: 23  RWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDE-PLKK 72
           R  ++ +AC  CR KKVKCD G   +     C  C+R    C F+  PLK+
Sbjct: 55  RRTKASRACDQCRKKKVKCDNGDDRS----VCTNCQRNGEKCTFERVPLKR 101

>KLTH0D16852g Chr4 (1392572..1395007) [2436 bp, 811 aa] {ON} similar
           to uniprot|Q03631 Saccharomyces cerevisiae YML076C WAR1
           zinc finger transcription factor
          Length = 811

 Score = 40.8 bits (94), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 35/65 (53%)

Query: 3   LKELRLSKRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREAR 62
           L + RL++  + + +   + + +R+  AC NC  +K KC    + + +  PCVRC +  +
Sbjct: 84  LGDPRLTQPTALEAAPTGAGKPKRNTFACTNCHSQKSKCVPSDVSDIYRKPCVRCHKRRK 143

Query: 63  DCIFD 67
            C FD
Sbjct: 144 LCKFD 148

>Suva_8.225 Chr8 (404288..406693) [2406 bp, 801 aa] {ON} YOR172W
           (REAL)
          Length = 801

 Score = 40.8 bits (94), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 51/117 (43%), Gaps = 17/117 (14%)

Query: 3   LKELRLSKRMSDKKSKGKSVRWRRS-YKACINCRLKKVKCDLGPLENPHSPPCVRCKREA 61
           LK  RL   +S  +   K  R RR   K+C  CR +K++CD         P C+ C    
Sbjct: 2   LKRDRLQGDISSSEDTAKKGRKRRKPIKSCAFCRKRKLRCD------QQKPMCLTCVSRG 55

Query: 62  R-DCIFDEPLKKLGTVENENDSIDDNQRVPNSPEDEIQQNTDIIQERISSIVATNES 117
           R DC + +             SI+ N+   ++P  E+ Q  D ++++++      ES
Sbjct: 56  RPDCFYTDGFTH---------SIEPNELFGSTPNIELLQRVDELEKKLNGAGLKKES 103

>KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]
          {ON} Anc_2.547 YKL038W
          Length = 1286

 Score = 40.8 bits (94), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 5/64 (7%)

Query: 10 KRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDE- 68
          +R +D   +    +  ++ +AC  CR KK+KCD   + N     C  C+R    C F+  
Sbjct: 34 RRTADPPMEMHGKKRTKASRACDQCRRKKIKCDYNDMRN----ICTNCQRIGERCSFERV 89

Query: 69 PLKK 72
          PLK+
Sbjct: 90 PLKR 93

>Skud_12.296 Chr12 complement(540407..542851) [2445 bp, 814 aa]
          {ON} YLR228C (REAL)
          Length = 814

 Score = 40.8 bits (94), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 6/52 (11%)

Query: 15 KKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIF 66
          K S GK     +S   C NC+ ++VKCD G       P C +C     DC++
Sbjct: 29 KTSTGKRKFHNKSKTGCDNCKRRRVKCDEG------KPFCKKCTNMKLDCVY 74

>TBLA0I01890 Chr9 complement(423851..426328) [2478 bp, 825 aa] {ON}
           Anc_3.264 YDR034C
          Length = 825

 Score = 40.8 bits (94), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 6/52 (11%)

Query: 15  KKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIF 66
           K  KGK ++ + S   C  C+ +++KCD         P C +C R  R CI+
Sbjct: 147 KNEKGKVIKRKYSRNGCTECKKRRMKCD------ETKPICWQCSRLNRSCIY 192

>Kpol_1061.11 s1061 complement(31679..33880) [2202 bp, 733 aa] {ON}
           complement(31679..33880) [2202 nt, 734 aa]
          Length = 733

 Score = 40.4 bits (93), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 6/52 (11%)

Query: 15  KKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIF 66
           K SKG  V+ + S   C  C+ +++KCD         P C +C R  R+C++
Sbjct: 103 KDSKGNVVKRKYSRNGCAECKRRRMKCD------ETKPTCWQCSRLNRECVY 148

>KLLA0F04213g Chr6 (400673..402979) [2307 bp, 768 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 768

 Score = 40.4 bits (93), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 6/50 (12%)

Query: 17  SKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIF 66
           + GK V+ + S   C+ C+ +++KCD G       P C +C R  R C++
Sbjct: 141 ADGKIVKRKYSRNGCLECKKRRMKCDEG------KPTCWQCARLNRKCVY 184

>Smik_15.67 Chr15 complement(113506..116598) [3093 bp, 1030 aa] {ON}
           YOL089C (REAL)
          Length = 1030

 Score = 40.8 bits (94), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 63/141 (44%), Gaps = 24/141 (17%)

Query: 14  DKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIF---DEPL 70
           D    GK+++ R S KAC +CR +K++CD     + ++  C  C +    C F   DE L
Sbjct: 120 DLSGSGKNLKKRVS-KACDHCRKRKIRCDEV---DQYTKKCSNCVKFESPCTFKHRDEIL 175

Query: 71  KKLGTVENENDSIDD-----NQRVPNSPEDEIQQNTDIIQERISSIVATNESRFN--NDI 123
           KK   +E + +S  D        VPNS    I  N     E  +S V+   S  N  +D+
Sbjct: 176 KKKRKLEIKQNSAPDKSPQAQNNVPNSVSSSIVGNKSEF-ESFNSNVSLENSIINKVSDV 234

Query: 124 SNSQKHERKDKPSERKSNLKV 144
            NS           RK NLK+
Sbjct: 235 QNSL---------NRKMNLKI 246

>NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON} 
          Length = 508

 Score = 40.4 bits (93), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%), Gaps = 6/53 (11%)

Query: 12 MSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDC 64
          M   ++K + +   RSY  C  CR +KVKCD         P C RCK+   +C
Sbjct: 1  MYKVRNKHEQLHRNRSYSGCWTCRARKVKCDT------QRPKCCRCKQLGIEC 47

>TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON}
          Anc_6.60 YLR266C
          Length = 795

 Score = 40.4 bits (93), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 6/48 (12%)

Query: 19 GKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIF 66
           K+ + R+  KAC+ CR +K+KCDL        P C +C     +CI+
Sbjct: 2  NKTRKRRKIIKACVFCRKRKLKCDLT------KPKCKQCSSRNLNCIY 43

>Ecym_8159 Chr8 (330207..332933) [2727 bp, 908 aa] {ON} similar to
          Ashbya gossypii AAL175W
          Length = 908

 Score = 40.4 bits (93), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 6/39 (15%)

Query: 26 RSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDC 64
          +++  C  CR++KVKCDLG       P C RC++    C
Sbjct: 41 KTFTGCWTCRIRKVKCDLG------KPNCQRCEKSGLSC 73

>Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON}
          YGR288W (REAL)
          Length = 143

 Score = 38.1 bits (87), Expect = 0.026,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 7/46 (15%)

Query: 29 KACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLG 74
          +AC  CR+++VKCD          PC RC +   +C + +PL+K G
Sbjct: 39 QACDCCRVRRVKCD-------GKGPCGRCLQRDLNCTYLQPLRKRG 77

>KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {ON}
           
          Length = 1136

 Score = 40.4 bits (93), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 6/59 (10%)

Query: 30  ACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLGTVENENDSIDDNQR 88
            C NCR  K+KCD         P C RC ++   C++DE  +    + N++ +I   +R
Sbjct: 49  VCQNCRKSKMKCDR------EKPECTRCLKQGIKCVYDEERQPRPRIPNKDATIAKLER 101

>Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976
          aa] {ON} YKL015W (REAL)
          Length = 976

 Score = 40.4 bits (93), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 7/57 (12%)

Query: 17 SKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKL 73
          +K +  R +RS  AC++CR + +KC       P   PC +C      C + EP KK+
Sbjct: 20 NKQRQGRQQRSSIACLSCRKRHIKC-------PGGNPCQKCVASNAICEYLEPSKKI 69

>Kpol_538.42 s538 complement(89752..93018) [3267 bp, 1088 aa] {ON}
           complement(89752..93018) [3267 nt, 1089 aa]
          Length = 1088

 Score = 40.4 bits (93), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 59/131 (45%), Gaps = 10/131 (7%)

Query: 14  DKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKL 73
           D+ + G   R  R    C  CR  K +CD         P C RC +   +CI+D  L+K 
Sbjct: 22  DRSTDGIVKRRNRISFVCQQCRKAKTRCD------KEQPNCTRCIKNNLNCIYDIELQKK 75

Query: 74  GTVENENDSIDDNQRVPNSPEDEIQQNTDIIQERISSIVATNESRFNNDISNSQKHERKD 133
               ++N  I   +R+ N  E+   +   ++QE+ ++     + + N        + +K+
Sbjct: 76  PKNPSKNAII---KRLENDVENYKTKYFALLQEKQNTPQQHPQIQPNIQTETGTGNVKKE 132

Query: 134 KPSERKSNLKV 144
            P ++K NL++
Sbjct: 133 NP-QQKENLQI 142

>NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}
          Anc_7.17 YAL051W
          Length = 944

 Score = 40.4 bits (93), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 8/59 (13%)

Query: 9  SKRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFD 67
          SK ++D +   K  R+R S+  C  CR  KVKCD         P C RC +   +C++D
Sbjct: 20 SKSINDSQVTKKK-RYRLSF-VCQGCRRSKVKCD------QEKPVCSRCSKHDLECVYD 70

>NCAS0A15020 Chr1 (2957420..2959849) [2430 bp, 809 aa] {ON}
          Anc_7.512 YLR451W
          Length = 809

 Score = 40.4 bits (93), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 27/49 (55%), Gaps = 6/49 (12%)

Query: 25 RRSYKACINCRLKKVKCDLGPLENPHSP-PCVRCKREARDCIFDEPLKK 72
          RR Y AC+ CR +K KCD     N  +P PC +C R+   CI  +  ++
Sbjct: 14 RRKY-ACVECRQQKSKCD----ANDKAPNPCSKCARKGVPCILKKDFRR 57

>YLR228C Chr12 complement(600019..602463) [2445 bp, 814 aa] {ON}
          ECM22Sterol regulatory element binding protein,
          regulates transcription of sterol biosynthetic genes;
          contains Zn[2]-Cys[6] binuclear cluster; homologous to
          Upc2p; relocates from intracellular membranes to
          perinuclear foci on sterol depletion
          Length = 814

 Score = 40.4 bits (93), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 25/52 (48%), Gaps = 6/52 (11%)

Query: 15 KKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIF 66
          K S GK     +S   C NC+ ++VKCD G       P C +C     DC++
Sbjct: 28 KTSTGKRKFHNKSKTGCDNCKRRRVKCDEG------KPFCKKCTNMKLDCVY 73

>AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YJL089W (SIP4)
          Length = 852

 Score = 40.0 bits (92), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 6/50 (12%)

Query: 25 RRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLG 74
          +RS +AC  CRLKK+KCD         P C  CK+    C   + L + G
Sbjct: 23 KRSSQACDRCRLKKIKCD------GLRPSCTSCKKIGYQCKTSDKLTRRG 66

>Suva_10.323 Chr10 complement(566314..568755) [2442 bp, 813 aa]
          {ON} YLR228C (REAL)
          Length = 813

 Score = 40.0 bits (92), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 7/58 (12%)

Query: 9  SKRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIF 66
           KR+S K S GK     +S   C NC+ ++VKCD G       P C +C     +C++
Sbjct: 22 GKRVS-KTSTGKRKFHNKSKTGCDNCKRRRVKCDEG------KPFCKKCTNMKLECVY 72

>CAGL0C01199g Chr3 complement(121944..124712) [2769 bp, 922 aa]
          {ON} similar to uniprot|Q12151 Saccharomyces cerevisiae
          YDR213w UPC2
          Length = 922

 Score = 40.0 bits (92), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 11/67 (16%)

Query: 4  KELRL----SKRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKR 59
          KE+ L     KR+S K S GK    ++S   C NC+ ++VKCD G       P C +C  
Sbjct: 18 KEIELIEVNGKRVS-KTSTGKRKFHKKSKTGCDNCKRRRVKCDEG------KPGCKKCSN 70

Query: 60 EARDCIF 66
              C++
Sbjct: 71 LNLVCVY 77

>NDAI0A03420 Chr1 complement(782010..785336) [3327 bp, 1108 aa]
          {ON} 
          Length = 1108

 Score = 40.0 bits (92), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 7/44 (15%)

Query: 25 RRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDE 68
          ++  KAC+NCR +K+KC         + PC  C     +C+FDE
Sbjct: 11 KKVVKACLNCRRRKIKCT-------GTFPCSNCAAYQCECVFDE 47

>NCAS0H03420 Chr8 complement(648059..650767) [2709 bp, 902 aa]
          {ON} Anc_2.654
          Length = 902

 Score = 40.0 bits (92), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 34/69 (49%), Gaps = 9/69 (13%)

Query: 7  RLSKRMS--DKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDC 64
          ++S+ +S  DK +   S + R    ACI CR + +KC  G        PC RC +    C
Sbjct: 3  KVSQNLSNNDKNNTEPSSKRRPKSLACILCRKRHIKCSGG-------NPCARCIKHDLKC 55

Query: 65 IFDEPLKKL 73
           + EP KK+
Sbjct: 56 EYIEPSKKI 64

>ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some
          similarities with uniprot|P39529 Saccharomyces
          cerevisiae YJL206C
          Length = 571

 Score = 39.7 bits (91), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 36/93 (38%), Positives = 42/93 (45%), Gaps = 14/93 (15%)

Query: 4  KELRLSKRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARD 63
          K L LS   S KK + K  R R S+ AC NCRLKK KCD          PC  CK    +
Sbjct: 4  KVLVLSMDNSTKKLRPK--RLRVSH-ACDNCRLKKKKCD-------GQQPCKLCKNSENE 53

Query: 64 CIF-DEPLKKLGTVENENDSIDDNQRVPNSPED 95
          CI+ D      GTV    +S    +  P  P D
Sbjct: 54 CIYSDRRRLTTGTVLAAGES---EELAPLPPRD 83

>Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa]
          {ON} YKL038W (RGT1) - 1:1 [contig 55] FULL
          Length = 970

 Score = 40.0 bits (92), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 30/54 (55%), Gaps = 5/54 (9%)

Query: 23 RWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDE-PLKKLGT 75
          R  ++ +AC  CR KK +CD    ENP    C  C+R ++ C F+  P+K+  T
Sbjct: 31 RRSKTSRACDQCRGKKTRCDFSD-ENPV---CTSCQRMSKTCTFERVPMKRGPT 80

>KLLA0C10923g Chr3 complement(939148..941475) [2328 bp, 775 aa]
          {ON} weakly similar to uniprot|P07272 Saccharomyces
          cerevisiae YLR014C PPR1 Zinc finger transcription
          factor containing a Zn(2)-Cys(6) binuclear cluster
          domain positively regulates transcription of genes
          involved in uracil biosynthesis activity may be
          modulated by interaction with Tup1p
          Length = 775

 Score = 39.7 bits (91), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 6/58 (10%)

Query: 12 MSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEP 69
          M++K +K  S    RS  AC  CR++K+KCD         P C +C +    CI  +P
Sbjct: 1  MANKVTKESSGNIYRSVAACKRCRIRKIKCD------NKFPSCTKCIQAQEPCITIDP 52

>SAKL0G17622g Chr7 complement(1525163..1527193) [2031 bp, 676 aa]
          {ON} conserved hypothetical protein
          Length = 676

 Score = 39.7 bits (91), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 5/44 (11%)

Query: 25 RRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDE 68
          RR  K C+NC+  KV+C     +   + PCVRC++    C + E
Sbjct: 7  RRRTKPCMNCKRNKVRC-----QYIETLPCVRCQKHNLRCFYPE 45

>KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly
          similar to uniprot|P39961 Saccharomyces cerevisiae
          YER184C Hypothetical ORF
          Length = 817

 Score = 39.7 bits (91), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 7/63 (11%)

Query: 7  RLSKRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIF 66
          R  + M+  +   ++   R++ +ACI+CR +KVKC+          PC  CK    +C +
Sbjct: 27 RPPQVMATPRVTKRAYTIRKTPQACISCRRRKVKCN-------GCRPCSSCKTNGLECAY 79

Query: 67 DEP 69
          D P
Sbjct: 80 DTP 82

>TPHA0N01100 Chr14 (231308..232501) [1194 bp, 397 aa] {ON} Anc_6.154
           YBR240C
          Length = 397

 Score = 39.3 bits (90), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 44/91 (48%), Gaps = 12/91 (13%)

Query: 26  RSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLGTVENENDSIDD 85
           R +  C  CR KK KC      N   P C  C +    C +D    KL  +EN    +D 
Sbjct: 9   RKFTGCWACRFKKKKC------NEQRPQCTLCIQHGNHCSYDV---KLIWLENNMYKLDT 59

Query: 86  NQRVPNSPEDEIQQNTDIIQERISSIVATNE 116
           N ++ +S  D I++ TD +++  +S + +N+
Sbjct: 60  NSQMEHS--DNIKE-TDTVEQYYNSNIISND 87

>TDEL0G04920 Chr7 complement(912754..914844) [2091 bp, 696 aa]
          {ON} 
          Length = 696

 Score = 39.7 bits (91), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 7/57 (12%)

Query: 19 GKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLGT 75
          G+ V+  R+ KAC NCR +K+KC        +  PC+ C   A  C+  +  K+L T
Sbjct: 16 GRIVKAPRTPKACDNCRRRKIKCS-------NISPCLNCVASALKCVHSQEPKRLNT 65

>ZYRO0G19338g Chr7 complement(1601895..1603856) [1962 bp, 653 aa]
          {ON} similar to uniprot|Q754A1 Ashbya gossypii AFR171W
          AFR171Wp and some similarites with YDR034C
          uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
          Transcriptional activator involved in regulation of
          genes of the lysine biosynthesis pathway requires
          2-aminoadipate semialdehyde as co-inducer
          Length = 653

 Score = 39.7 bits (91), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 10/60 (16%)

Query: 12 MSDKKSKGKSVRWRRSYK--ACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEP 69
          + DKK+   ++R +R Y    C  C+ +KVKCD         P C +C    + C++D+P
Sbjct: 2  VEDKKTV--TIRKKRKYSKLGCNECKKRKVKCD------EQKPECWQCSHLGKKCVYDQP 53

>Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}
          similar to Ashbya gossypii AFR096W
          Length = 952

 Score = 39.7 bits (91), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 6/50 (12%)

Query: 25 RRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLG 74
          +RS +AC  CRLKK+KCD         P C  CK+    C   + L + G
Sbjct: 24 KRSSQACDRCRLKKIKCD------GVRPSCTSCKKIGYQCRTSDKLTRRG 67

>Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}
           YJL206C (REAL)
          Length = 772

 Score = 39.7 bits (91), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 40/81 (49%), Gaps = 9/81 (11%)

Query: 26  RSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLGTVENE--NDSI 83
           R+++AC+ CR +KV+C           PC  C+  + +C +D P +     + E  +DS 
Sbjct: 53  RAHRACVACRKRKVRCS-------GQTPCRLCQNNSFECKYDRPPRNSSVFDREVSDDSS 105

Query: 84  DDNQRVPNSPEDEIQQNTDII 104
              Q +P+   ++ + +T  I
Sbjct: 106 SYPQSIPHQEGEDKRSSTCTI 126

>TPHA0B01585 Chr2 complement(352396..354834) [2439 bp, 812 aa]
          {ON}
          Length = 812

 Score = 39.7 bits (91), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 24/51 (47%)

Query: 30 ACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLGTVENEN 80
          AC+ C   K KC    L + +  PC +CKR    C+FD   +K     N N
Sbjct: 48 ACVRCHRLKQKCLPSDLADIYRKPCSKCKRMRLKCVFDLTKRKRNRKRNSN 98

>TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.109
           YOL089C
          Length = 996

 Score = 39.7 bits (91), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 66/152 (43%), Gaps = 31/152 (20%)

Query: 25  RRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIF---DEPLKKLGTVENEND 81
           +R  +AC +CR +K+KCD  P+ NP +  C  C +   +C F   D+  K+    +  N+
Sbjct: 112 KRVARACDHCRRRKIKCD--PV-NPQTNKCSNCTKYDANCTFRVRDDVEKR----KRANE 164

Query: 82  SIDDNQRVPN-------SPEDEIQQNTDIIQERISSIVATNESRFNNDISNSQKHERK-- 132
           +ID +  V         +P   + QN D          A N  RF +     + +ERK  
Sbjct: 165 AIDGSGGVSEDLNILGFAPTPGMGQNGDEYH-------AGNMERFESMPFVPKCNERKAD 217

Query: 133 -----DKPSERKSNLKVNFTNMRNALEFLANA 159
                +K  ++ S +  N T MR  LE L   
Sbjct: 218 LSGKVEKLDKKVSVIADNLTKMRWMLERLVQG 249

>SAKL0G17908g Chr7 (1552344..1554773) [2430 bp, 809 aa] {ON} similar
           to uniprot|Q03631 Saccharomyces cerevisiae YML076C WAR1
           zinc finger transcription factor
          Length = 809

 Score = 39.7 bits (91), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 25/51 (49%)

Query: 17  SKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFD 67
           SK    + +R+  AC NC   K KC    + N +  PC RC +  R C FD
Sbjct: 50  SKNDGGKPKRNTFACTNCHSLKQKCVPSDINNIYGRPCQRCMKCNRTCKFD 100

>NCAS0H00780 Chr8 complement(140472..143201) [2730 bp, 909 aa]
          {ON} 
          Length = 909

 Score = 39.7 bits (91), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 6/48 (12%)

Query: 20 KSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFD 67
          K+ R  R    C+ CR KKVKCD         P C RC++  + C+++
Sbjct: 4  KNYRKARPSFVCLVCRSKKVKCDKA------RPSCGRCRKTNKLCVYE 45

>Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W
          (REAL)
          Length = 469

 Score = 39.3 bits (90), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 7/45 (15%)

Query: 30 ACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLG 74
          AC  CR+++VKCD          PC RC +   +C + +PL+K G
Sbjct: 7  ACDFCRVRRVKCD-------GKKPCSRCIQHDFECTYQQPLRKRG 44

>SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly
           similar to uniprot|P46954 Saccharomyces cerevisiae
           YJL089W SIP4 Possibly involved in Snf1p regulated
           transcriptional activation shows homology to DNA binding
           domain of Gal4p has a leucine zipper motif and acidic
           region lexA-Sip4p activates transcription
          Length = 919

 Score = 39.7 bits (91), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 46/103 (44%), Gaps = 13/103 (12%)

Query: 23  RWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLGTVENENDS 82
           R  RS +AC  CRLKK+KCD         P C  CK+    C   + L + G      + 
Sbjct: 21  RQERSSQACDRCRLKKIKCD------GLKPNCTSCKKVGFHCQTSDKLTRRGFPRGYTEM 74

Query: 83  IDDNQRVPNSPEDEIQQNTDIIQERISSIVATNESRFNNDISN 125
           ++           ++Q+  +++ E+  +++ T     +ND S+
Sbjct: 75  LEKEVV-------KLQRRLNLVDEQGVTVIDTAPVSASNDGSD 110

>Kpol_1049.19 s1049 (38439..41270) [2832 bp, 943 aa] {ON}
          (38439..41270) [2832 nt, 944 aa]
          Length = 943

 Score = 39.7 bits (91), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 6/49 (12%)

Query: 19 GKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFD 67
           + V+  R  + C+ C+ +K++CD         P C RCKR +  C +D
Sbjct: 3  SRVVKKPRPSRVCVQCKKRKLRCD------RQRPTCTRCKRSSTICTYD 45

>KAFR0L02130 Chr12 (403953..406601) [2649 bp, 882 aa] {ON} Anc_8.879
           YML099C
          Length = 882

 Score = 39.7 bits (91), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 54/130 (41%), Gaps = 25/130 (19%)

Query: 12  MSDKKSKGKSVRWRRS--YKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDC----- 64
           MS   S  K  R +R+  +  C  CR +KVKCDL        P C RC+R    C     
Sbjct: 1   MSSTYSINKRSRIQRAKTFTGCWTCRARKVKCDLT------RPSCTRCERSGLKCGGYDI 54

Query: 65  --------IFDEPLKKLGTVENENDSIDDNQRVPNSPEDEIQQNTDIIQER-ISSIVATN 115
                    F+E   ++ T  N   ++  N+  P SP   I +  +  Q R IS +    
Sbjct: 55  KLRWSKPVWFNEYGIQISTASNNRKNV--NEMSP-SPVSGINEENNQYQRRNISFVKYKE 111

Query: 116 ESRFNNDISN 125
           E  F+ D+ +
Sbjct: 112 EYVFHEDMDD 121

>KLTH0D16456g Chr4 complement(1360294..1362279) [1986 bp, 661 aa]
          {ON} conserved hypothetical protein
          Length = 661

 Score = 39.3 bits (90), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 32/70 (45%), Gaps = 10/70 (14%)

Query: 25 RRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLGTVENENDSID 84
          RR  K C NC+  KVKC         S PC RC R    C F E      ++ NE  S+ 
Sbjct: 7  RRRTKPCTNCKKNKVKCLYQ-----DSLPCERCARHQLQCHFAEN----NSLRNETLSVH 57

Query: 85 D-NQRVPNSP 93
          + N  +P +P
Sbjct: 58 EINTGLPQAP 67

>YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON}
           Putative protein of unknown function; similar to
           transcriptional regulators from the Zn[2]-Cys[6]
           binuclear cluster protein family; mRNA is weakly cell
           cycle regulated, peaking in S phase; induced rapidly
           upon MMS treatment
          Length = 758

 Score = 39.3 bits (90), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 36/72 (50%), Gaps = 9/72 (12%)

Query: 26  RSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLGTVENE--NDSI 83
           R+++ACI CR +KV+C         + PC  C+  + +C +D P +     + E  +DS 
Sbjct: 42  RAHRACIACRKRKVRCS-------GNIPCRLCQTNSYECKYDRPPRNSSVFDREVSDDSS 94

Query: 84  DDNQRVPNSPED 95
              QR  +  ED
Sbjct: 95  LYAQRASHERED 106

>SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON}
          weakly similar to uniprot|P39720 Saccharomyces
          cerevisiae YAL051W OAF1 Oleate-activated transcription
          factor acts alone and as a heterodimer with Pip2p
          activates genes involved in beta-oxidation of fatty
          acids and peroxisome organization and biogenesis
          Length = 922

 Score = 39.3 bits (90), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 6/51 (11%)

Query: 17 SKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFD 67
          S GK  +  R    C+ CR +K+KCD         P C++C  +   C++D
Sbjct: 11 SVGKVQKRNRLSFVCLECRRRKIKCD------KQRPCCIQCAEQGLTCVYD 55

>NDAI0J00440 Chr10 complement(78052..80523) [2472 bp, 823 aa] {ON}
           Anc_7.512 YLR451W
          Length = 823

 Score = 39.3 bits (90), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 56/126 (44%), Gaps = 17/126 (13%)

Query: 9   SKRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDE 68
           SK  S+ KS G     RR Y AC+ CR +K KCD          PC +C ++   C+  +
Sbjct: 12  SKTKSETKSSG-----RRKY-ACVECRQQKSKCD---AHETMPNPCSKCAKKRVPCVLKK 62

Query: 69  PLKKL------GTVENENDSIDDNQRVPNSPE--DEIQQNTDIIQERISSIVATNESRFN 120
             ++         +E     + D+    +S +    +++  DI+ E+  S   +NE + N
Sbjct: 63  DFRRTYKRARNEAIEKRFRELTDSLSSLSSKDILKRLEEERDILLEQNGSSFGSNERKTN 122

Query: 121 NDISNS 126
              +NS
Sbjct: 123 TRFTNS 128

>Skud_11.214 Chr11 (389377..389855,389895..392361) [2946 bp, 981
          aa] {ON} YKL015W (REAL)
          Length = 981

 Score = 39.3 bits (90), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 28/57 (49%), Gaps = 7/57 (12%)

Query: 17 SKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKL 73
          +K +  R  RS  AC++CR + +KC       P   PC +C      C + EP KK+
Sbjct: 20 NKQRQRRQPRSAVACLSCRKRHIKC-------PGGSPCQKCITSNAICEYLEPSKKI 69

>Kpol_1001.3 s1001 complement(9551..12121) [2571 bp, 856 aa] {ON}
           complement(9551..12121) [2571 nt, 857 aa]
          Length = 856

 Score = 39.3 bits (90), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 23/43 (53%)

Query: 25  RRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFD 67
           +R+  ACI+C   K KC    L++    PC RC R  + C FD
Sbjct: 61  KRNTFACISCHASKQKCVPSDLDDIFLKPCQRCFRSKKICAFD 103

>Kpol_538.52 s538 (126243..128966) [2724 bp, 907 aa] {ON}
          (126243..128966) [2724 nt, 908 aa]
          Length = 907

 Score = 39.3 bits (90), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 6/40 (15%)

Query: 25 RRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDC 64
          R+S+  C  CR +KVKCDL      + P C RC R    C
Sbjct: 11 RKSFNGCWTCRSRKVKCDL------NRPKCQRCDRLGIIC 44

>TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879
          YML099C
          Length = 835

 Score = 39.3 bits (90), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 9/47 (19%)

Query: 18 KGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDC 64
          KGK  +   ++  C  CR +KVKCDL        P C RC++   DC
Sbjct: 18 KGKRAK---TFTGCWTCRSRKVKCDL------QRPNCGRCEKSGLDC 55

>TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3.109
           YOL089C
          Length = 1086

 Score = 39.3 bits (90), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 55/109 (50%), Gaps = 9/109 (8%)

Query: 25  RRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLGTVENENDSID 84
           +R+ +AC +CR +K+KCD  P++ P +  C  C +    C+FD   K+  T  N N +  
Sbjct: 135 KRATRACESCRKRKIKCD--PVD-PITNKCSNCTKFHMICVFDN-RKRKATNANTNSNKL 190

Query: 85  DNQRVPNSPEDEIQQNTDIIQERI---SSIVATNESRFNNDISNSQKHE 130
                P S E E  Q  D I++ +      + TN+S  N ++ +  K+E
Sbjct: 191 LKTMNPKSHESEDDQ--DDIEDHLHGNCQPLNTNDSSININLLHETKNE 237

>YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}
          PUT3Transcriptional activator of proline utilization
          genes, constitutively binds PUT1 and PUT2 promoter
          sequences as a dimer and undergoes a conformational
          change to form the active state; differentially
          phosphorylated in the presence of different nitrogen
          sources; has a Zn(2)-Cys(6) binuclear cluster domain
          Length = 979

 Score = 39.3 bits (90), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 7/51 (13%)

Query: 23 RWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKL 73
          R +RS  AC++CR + +KC       P   PC +C      C + EP KK+
Sbjct: 26 RQQRSSVACLSCRKRHIKC-------PGGNPCQKCVTSNAICEYLEPSKKI 69

>SAKL0H13024g Chr8 complement(1119585..1121849) [2265 bp, 754 aa]
          {ON} similar to gnl|GLV|KLLA0A04169g Kluyveromyces
          lactis KLLA0A04169g and some similarites with YDR213W
          uniprot|Q12151 Saccharomyces cerevisiae YDR213W UPC2
          involved in sterol uptake zinc finger transcription
          factor of the Zn(2)-Cys(6) binuclear cluster domain
          type
          Length = 754

 Score = 39.3 bits (90), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 7/57 (12%)

Query: 10 KRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIF 66
          KR+S K S GK     +S   C NC+ ++VKCD G       P C +C     +C++
Sbjct: 34 KRVS-KTSTGKRKFHNKSKNGCDNCKRRRVKCDEG------KPCCQKCINMKLECVY 83

>ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} similar
          to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
          Zinc finger transcription factor containing a
          Zn(2)-Cys(6) binuclear cluster domain positively
          regulates transcription of genes involved in uracil
          biosynthesis activity may be modulated by interaction
          with Tup1p
          Length = 855

 Score = 39.3 bits (90), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 8/68 (11%)

Query: 3  LKELRLSKRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHS-PPCVRCKREA 61
          +K++   + +S K+     V   +S  AC  CR KK+KCD       H  P C +C R  
Sbjct: 5  IKQVEGEEEVSRKRPSSVVVGITKSISACKRCRTKKIKCD-------HEFPSCKKCARAN 57

Query: 62 RDCIFDEP 69
          + C+  +P
Sbjct: 58 KPCVSLDP 65

>CAGL0H04367g Chr8 complement(410256..413093) [2838 bp, 945 aa]
          {ON} weakly similar to uniprot|Q03631 Saccharomyces
          cerevisiae YML076c
          Length = 945

 Score = 39.3 bits (90), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 23/43 (53%)

Query: 25 RRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFD 67
          +R+  AC+ C   K KC    + + +  PCVRC R    CIFD
Sbjct: 56 KRNTFACVKCHDLKQKCRPSDVGDIYRNPCVRCLRSRDPCIFD 98

>TDEL0B07490 Chr2 complement(1314447..1317044) [2598 bp, 865 aa]
           {ON} Anc_2.654 YKL015W
          Length = 865

 Score = 39.3 bits (90), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 47/109 (43%), Gaps = 21/109 (19%)

Query: 30  ACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLGTVENENDSIDDNQRV 89
           AC+ CR + VKC       P   PC +C      C + EP KKL        S+   Q +
Sbjct: 75  ACVRCRRRHVKC-------PGGQPCAKCASANIACEYLEPNKKLIV------SMKYLQDL 121

Query: 90  PNSPEDEIQQNTDIIQERISSIVATNESRFNNDISNSQKHERKDKPSER 138
             S  +  ++N      R+ S+V + +S + +D+   +  E    PS R
Sbjct: 122 QESLANMKRENV-----RLQSLVTSLQSNYESDV---EAKEADSGPSSR 162

>KNAG0H01260 Chr8 (220201..222426) [2226 bp, 741 aa] {ON} Anc_3.264
           YDR034C
          Length = 741

 Score = 39.3 bits (90), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 6/48 (12%)

Query: 19  GKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIF 66
           G  V+ + S   C+ C+ +++KCD         P C +C R  RDC++
Sbjct: 127 GHIVKRKYSRNGCVECKRRRMKCD------ETKPKCWQCDRLNRDCVY 168

>TPHA0C04980 Chr3 (1072547..1075105) [2559 bp, 852 aa] {ON}
          Anc_8.879 YML099C
          Length = 852

 Score = 39.3 bits (90), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 7/57 (12%)

Query: 8  LSKRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDC 64
          + KR+S       + R  ++++ C  CRL+K+KCDL        P C +C+  A  C
Sbjct: 1  MVKRISTSSRDADNKR-AKTFEGCWTCRLRKIKCDL------KKPKCDKCRSSAISC 50

>Kwal_55.21884 s55 (1020057..1022705) [2649 bp, 882 aa] {ON}
          YLR451W (LEU3) - zinc-finger transcription factor of
          the Zn(2)-Cys(6) binuclear cluster domain type [contig
          124] FULL
          Length = 882

 Score = 39.3 bits (90), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 5/53 (9%)

Query: 21 SVRWRRSYKACINCRLKKVKCDLGPLENPHSP-PCVRCKREARDCIFDEPLKK 72
          S R RR   AC+ CR +K KCD     +  +P PC RC ++   C+  +  ++
Sbjct: 21 SRRGRRKKLACVECRQQKSKCD----AHEKAPEPCTRCAKKNVACVLQKDFRR 69

>KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}
          
          Length = 881

 Score = 39.3 bits (90), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 25/46 (54%), Gaps = 6/46 (13%)

Query: 19 GKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDC 64
          GKS + +R+   CI C+ +K++C      N   P C RC+R  + C
Sbjct: 23 GKSQKSKRTVSVCIPCKSQKLRC------NKARPICSRCQRLGKHC 62

>KLLA0C16489g Chr3 (1444456..1446642) [2187 bp, 728 aa] {ON}
          conserved hypothetical protein
          Length = 728

 Score = 38.9 bits (89), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 21/41 (51%), Gaps = 6/41 (14%)

Query: 26 RSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIF 66
          RS   C  CRLK++KCD         P C RCKR    CI+
Sbjct: 38 RSKSGCFTCRLKRMKCD------EQHPICGRCKRNLLTCIW 72

>KAFR0C01320 Chr3 (273213..276233) [3021 bp, 1006 aa] {ON} Anc_3.109
           YOL089C
          Length = 1006

 Score = 39.3 bits (90), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 3/46 (6%)

Query: 21  SVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIF 66
           ++  RR  KAC +CR +K+KC  GP+ NP    C  C + +  C F
Sbjct: 93  AIAKRRVSKACDHCRKRKIKC--GPI-NPAKNKCDNCIKYSSACTF 135

>KNAG0J00210 Chr10 (26132..28717) [2586 bp, 861 aa] {ON} Anc_8.879
          YML099C
          Length = 861

 Score = 38.9 bits (89), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 6/42 (14%)

Query: 23 RWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDC 64
          R  +++  C  CR +KVKCDL        P C+RC++ + +C
Sbjct: 15 RRAKTFTGCWTCRSRKVKCDL------RRPGCLRCEKSSLEC 50

>KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.17
           YOR363C
          Length = 951

 Score = 39.3 bits (90), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 7/66 (10%)

Query: 19  GKSVRWR-RSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLGTVE 77
           GK V+ R R    C  CR  K KCD         P C RC+++  +C++D  L++     
Sbjct: 52  GKVVKKRNRISFVCQACRKAKTKCD------KEKPMCSRCRKQDLECVYDIELQRPPKNP 105

Query: 78  NENDSI 83
           N++ +I
Sbjct: 106 NKDSAI 111

>Smik_12.77 Chr12 complement(159125..161836) [2712 bp, 903 aa]
          {ON} YLR014C (REAL)
          Length = 903

 Score = 38.9 bits (89), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 28/61 (45%), Gaps = 6/61 (9%)

Query: 9  SKRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDE 68
          S R   +K    ++   +S  AC  CRLKK+KCD         P C RC +    C+  +
Sbjct: 11 SNRSHLRKGDSPNIAISKSRTACKRCRLKKIKCD------QEFPSCKRCAKLQVPCVSLD 64

Query: 69 P 69
          P
Sbjct: 65 P 65

>CAGL0M02651g Chr13 complement(304583..305971) [1389 bp, 462 aa]
           {ON} similar to uniprot|P19541 Saccharomyces cerevisiae
           YPL133c
          Length = 462

 Score = 38.5 bits (88), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 45/96 (46%), Gaps = 12/96 (12%)

Query: 23  RWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRC-KRE-ARDCIFDEPLKKLGTVENEN 80
           + ++ YK+CI CR   V CD       H  PC RC KRE    C+ DE +  + +     
Sbjct: 8   KQKKLYKSCIFCRRSHVNCD-------HQRPCSRCIKREIGHLCVADENVSNIQSQYQYK 60

Query: 81  DSID--DNQRVPNSPEDEIQQNTDIIQERISSIVAT 114
           +S+    +  +PN+ E  I   T  IQ   SS+  T
Sbjct: 61  NSMSPIGSTEIPNA-EINIGDETRAIQGSNSSVYGT 95

>Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}
           YJL206C (REAL)
          Length = 833

 Score = 38.9 bits (89), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 47/95 (49%), Gaps = 10/95 (10%)

Query: 26  RSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLGTVENE--NDSI 83
           R+++AC+ CR +KV+C           PC  C+  + +C +D P +     + E  +DS 
Sbjct: 29  RAHRACVACRKRKVRCS-------GQTPCRLCQNNSFECKYDRPPRNSSAFDKELSDDSP 81

Query: 84  DDNQRVPNSPEDEIQQNTDIIQ-ERISSIVATNES 117
             +QR  +   ++ +    +I  ++I+  + T E+
Sbjct: 82  LYSQRASHQDHNDNKGRQSVIDYKKITETIFTPEA 116

>NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON}
          Anc_6.279
          Length = 890

 Score = 38.9 bits (89), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 11/57 (19%)

Query: 29 KACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFD-----EPLKKLGTVENEN 80
          +AC NCRLKK+KC      +  +P C +C +    C++       PL ++   + EN
Sbjct: 18 QACDNCRLKKLKC------SKETPKCSKCLKNGMKCLYSPKVKRSPLTRVHLTQTEN 68

>TDEL0E03910 Chr5 (732533..735121) [2589 bp, 862 aa] {ON}
          Anc_5.235 YLR014C
          Length = 862

 Score = 38.9 bits (89), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 6/44 (13%)

Query: 26 RSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEP 69
          +S  AC  CRLKK+KCD         P C++C R    C+  +P
Sbjct: 25 KSISACKRCRLKKIKCDQ------EFPSCLKCARVKVPCVSLDP 62

>Skud_2.427 Chr2 (769889..771295) [1407 bp, 468 aa] {ON} YGR288W
          (REAL)
          Length = 468

 Score = 38.5 bits (88), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 7/45 (15%)

Query: 30 ACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLG 74
          AC  CR+++VKCD          PC RC +   +C   +PLKK G
Sbjct: 7  ACDYCRVRRVKCD-------GKKPCRRCLQHNFECTHQQPLKKRG 44

>Smik_16.15 Chr16 complement(14421..15812) [1392 bp, 463 aa] {ON}
          YBR297W (REAL)
          Length = 463

 Score = 38.5 bits (88), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 7/46 (15%)

Query: 29 KACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLG 74
          +AC  CR+++VKCD          PC RC +    C + +PLKK G
Sbjct: 6  QACDCCRVRRVKCD-------GDKPCNRCLQHDLKCTYLQPLKKRG 44

>KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]
          {ON} some similarities with uniprot|Q12180
          Saccharomyces cerevisiae YOL089C HAL9 Putative
          transcription factor containing a zinc finger;
          overexpression increases salt tolerance through
          increased expression of the ENA1(Na+/Li+ extrusion
          pump) gene while gene disruption decreases both salt
          tolerance and ENA1 expression
          Length = 902

 Score = 38.5 bits (88), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 7/48 (14%)

Query: 25 RRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKK 72
          +R  KAC  CR KK+KCD          PC  CK+ +++C +   +KK
Sbjct: 8  KRVSKACDACRAKKIKCD-------GCDPCSNCKKVSQECGYTYVVKK 48

>ZYRO0A03058g Chr1 (247954..250164) [2211 bp, 736 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 736

 Score = 38.5 bits (88), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 6/50 (12%)

Query: 17  SKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIF 66
            +GK V+ + S   C  C+ +++KCD         P C +C R  R+C++
Sbjct: 106 GEGKVVKRKYSRNGCTECKRRRMKCD------ETKPTCWQCARLNRECVY 149

>NCAS0B02930 Chr2 (504501..506606) [2106 bp, 701 aa] {ON} Anc_8.416
          Length = 701

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 6/45 (13%)

Query: 23  RWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFD 67
           + RRS   C  CRL+K KC          P C  C+R   DC FD
Sbjct: 560 KARRSRSGCWICRLRKKKCTE------EKPACFNCQRLNLDCFFD 598

>YMR280C Chr13 complement(827028..831329) [4302 bp, 1433 aa] {ON}
           CAT8Zinc cluster transcriptional activator necessary for
           derepression of a variety of genes under
           non-fermentative growth conditions, active after diauxic
           shift, binds carbon source responsive elements
          Length = 1433

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 51/111 (45%), Gaps = 7/111 (6%)

Query: 26  RSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLGTVENENDSIDD 85
           R  +AC  CR KK +CD         P C +C     +C   + L +    +   +S+++
Sbjct: 65  RIAQACDRCRSKKTRCD------GKRPQCSQCAAVGFECRISDKLLRKAYPKGYTESLEE 118

Query: 86  NQRVPNSPEDEIQQNTDIIQERISSIVATN-ESRFNNDISNSQKHERKDKP 135
             R   +    +    DI +++IS +  +  ++  +N I+ + KH+ KD P
Sbjct: 119 RVRELEAENKRLLALCDIKEQQISLVSQSRPQTSTDNTINGNFKHDLKDAP 169

>NCAS0A09410 Chr1 complement(1865924..1868722) [2799 bp, 932 aa]
          {ON} Anc_1.277
          Length = 932

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 23/46 (50%), Gaps = 6/46 (13%)

Query: 29 KACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLG 74
          +AC  CRLKK+KCD        +P C  C +    C   E LK+ G
Sbjct: 43 QACDRCRLKKIKCD------DRTPDCTPCMKAGIPCRTTERLKRRG 82

>ZYRO0B14718g Chr2 (1196539..1199646) [3108 bp, 1035 aa] {ON}
           similar to uniprot|Q03631 Saccharomyces cerevisiae
           YML076C WAR1 zinc finger transcription factor
          Length = 1035

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 24/45 (53%)

Query: 23  RWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFD 67
           + +R+  ACI+C   K KC      + +  PC+RC +  + C FD
Sbjct: 100 KLKRNSFACISCHSLKQKCVPSDFNDIYRKPCIRCLKNGKLCRFD 144

>KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]
          {ON} similar to uniprot|P43634 Saccharomyces cerevisiae
          YLR098C CHA4 Zinc-finger protein with Zn[2]-Cys[6]
          fungal- type binuclear cluster domain DNA-binding
          transcriptional activator or CHA1 and some similarities
          to YOR337W uniprot|P47988 Saccharomyces cerevisiae
          YOR337W TEA1 Mutants are defective in Ty1
          Enhancer-mediated Activation Ty1 enhancer activator
          Length = 603

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 7/43 (16%)

Query: 23 RWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCI 65
          R R+++ AC NCR+K+ KCD+         PC  C +   +CI
Sbjct: 9  RKRKAHLACQNCRIKRRKCDM-------ERPCSNCLKYGIECI 44

>CAGL0L01903g Chr12 (220700..224563) [3864 bp, 1287 aa] {ON}
          similar to uniprot|P32862 Saccharomyces cerevisiae
          YKL038w RGT1
          Length = 1287

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 5/45 (11%)

Query: 29 KACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDE-PLKK 72
          +AC  CR KK+KCD     N     C  C+R    C F+  PLK+
Sbjct: 14 RACDQCRRKKIKCD----RNQERNICTSCQRNGERCKFERVPLKR 54

>Ecym_1146 Chr1 (302989..304986) [1998 bp, 665 aa] {ON} similar to
          Ashbya gossypii AER141C
          Length = 665

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 20/42 (47%), Gaps = 5/42 (11%)

Query: 25 RRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIF 66
          +R  K C NC+  KVKC     E     PC RC R   +C F
Sbjct: 8  KRRTKPCSNCKQNKVKC-----EYNEGLPCSRCTRNGLECYF 44

>NDAI0G05530 Chr7 (1360413..1363973) [3561 bp, 1186 aa] {ON} 
          Length = 1186

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 6/65 (9%)

Query: 10  KRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEP 69
           +R   K+ +  S+   R  +AC  CRLKK+KCD         P C +C +    C   + 
Sbjct: 101 ERPKKKRKQIASIDKPRKIQACDRCRLKKIKCD------DLKPSCSQCLKADFQCKTTDK 154

Query: 70  LKKLG 74
           L + G
Sbjct: 155 LARRG 159

>SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]
           {ON} similar to gnl|GLV|KLLA0A03421g Kluyveromyces
           lactis KLLA0A03421g and weakly similar to YAL051W
           uniprot|P39720 Saccharomyces cerevisiae YAL051W OAF1
           Oleate- activated transcription factor acts alone and as
           a heterodimer with Pip2p activates genes involved in
           beta- oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 946

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 50/125 (40%), Gaps = 28/125 (22%)

Query: 30  ACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLGTVENENDSIDDNQRV 89
            C +CR  K KCD         P C RC R    CI+D  L                Q  
Sbjct: 28  VCQSCRKSKTKCD------KQKPSCSRCLRLGHQCIYDLEL----------------QPT 65

Query: 90  PNSPEDE-----IQQNTDIIQERISSIVATNESRFNNDISNSQKHERKDKPSERKSNLKV 144
           P +P  +     +Q+  +  + ++ + + +N     + +S  QK ++     +   N+ +
Sbjct: 66  PKNPSKDATITRLQKELEYWKSQVMAEIGSNRETTGSPVSKRQKLDQYFTAPD-PHNVII 124

Query: 145 NFTNM 149
           NF+NM
Sbjct: 125 NFSNM 129

>Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C
          (PIP2) - activator of peroxisome proliferation [contig
          46] FULL
          Length = 838

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 7/55 (12%)

Query: 13 SDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFD 67
          S +  + K  R R+S+  C NC+ +K+KCD         P C RC +   +C++D
Sbjct: 13 SSEPPEFKKSRMRQSF-VCRNCKKRKIKCDKA------RPSCGRCSKLELECVYD 60

>SAKL0A01386g Chr1 (132287..134599) [2313 bp, 770 aa] {ON}
          conserved hypothetical protein
          Length = 770

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query: 14 DKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKL 73
          DK  +    + +R+ +AC +CR  K +C   PL  P+   C+RC      C F + L+  
Sbjct: 13 DKPKRQLRAKGKRALRACDSCRRLKTRCIPSPL--PNEIQCLRCDSLKLRCSFQDLLENS 70

Query: 74 GT 75
          G+
Sbjct: 71 GS 72

>Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON}
          YKL038W (REAL)
          Length = 1169

 Score = 38.1 bits (87), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 6/63 (9%)

Query: 12 MSDKKSKGKSVRWR-RSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDE-P 69
          M+   + G +++ R ++ +AC  CR KK+KCD           C  C+R    C F+  P
Sbjct: 27 MNPAAASGHAMKKRTKASRACDQCRKKKIKCDY----KDERGVCTNCQRNGDRCSFERVP 82

Query: 70 LKK 72
          LK+
Sbjct: 83 LKR 85

>KAFR0A03060 Chr1 complement(626316..628898) [2583 bp, 860 aa]
          {ON} 
          Length = 860

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 6/48 (12%)

Query: 20 KSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFD 67
          K  R +R    C+ CR +K+KCD         P C RCK++ + C ++
Sbjct: 4  KRQRKQRPSYVCLECRSRKLKCD------KARPYCNRCKKDGKVCAYE 45

>SAKL0D03586g Chr4 (290224..292629) [2406 bp, 801 aa] {ON} similar
           to uniprot|P40971 Saccharomyces cerevisiae YDR034C LYS14
           Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 801

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 6/48 (12%)

Query: 19  GKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIF 66
           GK  + + S   C  C+ +++KCD G       P C +C R  R+C++
Sbjct: 152 GKISKRKYSRNGCTECKKRRMKCDEG------KPSCWQCTRLNRECVY 193

>NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2.547
          Length = 1141

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 5/48 (10%)

Query: 26  RSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDE-PLKK 72
           ++ +AC  CR KK+KCD    +      C  C+R    C F+  PLK+
Sbjct: 70  KASRACDQCRKKKIKCDFSEEKT----LCSNCQRNGEKCTFERVPLKR 113

>KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa]
          {ON} some similarities with uniprot|P32862
          Saccharomyces cerevisiae YKL038W RGT1
          Glucose-responsive transcription factor that regulates
          expression of several glucose transporter (HXT) genes
          in response to glucose binds to promoters and acts both
          as a transcriptional activator and repressor
          Length = 979

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 5/51 (9%)

Query: 23 RWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDE-PLKK 72
          R  ++ +AC  CR KK +CD     +   P C  C+R  + C F+  P+K+
Sbjct: 27 RRSKTSRACDQCREKKTRCDF----SDERPICSACQRMGKTCTFERVPMKR 73

>Suva_2.187 Chr2 complement(320833..323187) [2355 bp, 784 aa] {ON}
           YDR034C (REAL)
          Length = 784

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 27/52 (51%), Gaps = 6/52 (11%)

Query: 15  KKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIF 66
           +  KG +V+ + S   C  C+ +++KCD         P C +C R  R+C++
Sbjct: 137 RDKKGNTVKRKYSRNGCSECKRRRMKCD------ETKPTCWQCARLNRECVY 182

>KLLA0B04620g Chr2 complement(413129..415888) [2760 bp, 919 aa] {ON}
           similar to uniprot|Q03631 Saccharomyces cerevisiae
           YML076C WAR1 zinc finger transcription factor
          Length = 919

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 25/45 (55%)

Query: 23  RWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFD 67
           + +RS  ACI+C   K KC+     + +  PC+RC +  + C FD
Sbjct: 56  KVKRSTFACISCHSMKQKCNPTDPTDIYRHPCIRCAKLNKICQFD 100

>CAGL0H00396g Chr8 complement(37005..39827) [2823 bp, 940 aa] {ON}
          similar to uniprot|P08638 Saccharomyces cerevisiae
          YLR451w LEU3 transcription factor
          Length = 940

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 23/43 (53%), Gaps = 3/43 (6%)

Query: 30 ACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKK 72
          AC+ CR +K KCD     +    PC RC+++   C+  +  ++
Sbjct: 57 ACVECRQQKSKCD---AHDKAPEPCTRCQKKGVPCVLKKDFRR 96

>KAFR0G02540 Chr7 complement(524919..527486) [2568 bp, 855 aa] {ON}
           Anc_6.60 YLR266C possible pseudogene; N added to avoid
           frameshift
          Length = 855

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 47/98 (47%), Gaps = 13/98 (13%)

Query: 9   SKRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCK-REARDCIF- 66
           + +++ K+ K    + R+  K+C  CR +K+KCD         P C  CK R  + C++ 
Sbjct: 23  AAKITKKRRKASVNKKRKPIKSCAFCRRRKLKCD------QRKPICSSCKSRNFQVCMYT 76

Query: 67  DEPLKKLGTVENENDSIDDNQRVPNSPEDEIQQNTDII 104
           DE L       N+ND+++ +    ++P       T ++
Sbjct: 77  DESLN-----SNDNDAVEFSSPYGSAPSYSTNVRTSVL 109

>TBLA0D05420 Chr4 complement(1334955..1337228) [2274 bp, 757 aa]
           {ON} Anc_1.277 YJL089W
          Length = 757

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 27/50 (54%), Gaps = 6/50 (12%)

Query: 25  RRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLG 74
           RR  +AC  CRLKK+KCD G +  PH   C  C++   +C     L + G
Sbjct: 95  RRHSQACDRCRLKKIKCD-GLI--PH---CTNCRKINFNCQTTHKLSRRG 138

>Kwal_14.915 s14 (110216..112684) [2469 bp, 822 aa] {ON} YKL015W
          (PUT3) - zinc-finger transcription factor of the
          Zn(2)-Cys(6) binuclear cluster domain type [contig 245]
          FULL
          Length = 822

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 27/62 (43%), Gaps = 7/62 (11%)

Query: 12 MSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLK 71
          M +  SKG     +RS  AC+ CR +  KC           PC  C+     C + EP K
Sbjct: 30 MEEIGSKGVKRSIKRSGLACVRCRRRHAKCS-------GDNPCTTCRAANIACEYLEPNK 82

Query: 72 KL 73
          KL
Sbjct: 83 KL 84

>Skud_15.502 Chr15 (894741..897020) [2280 bp, 759 aa] {ON} YOR337W
           (REAL)
          Length = 759

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 31/65 (47%), Gaps = 11/65 (16%)

Query: 9   SKRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDC-IFD 67
           S+ + D    G S R R    AC NCR ++ KCDLG        PC  C R    C + D
Sbjct: 51  SEAVVDTPVHGSSTRKRL---ACTNCRNRRKKCDLG-------FPCGNCSRLELVCNVND 100

Query: 68  EPLKK 72
           E L+K
Sbjct: 101 EDLRK 105

>ACL096W Chr3 (169508..172015) [2508 bp, 835 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YKL015W (PUT3)
          Length = 835

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 7/49 (14%)

Query: 25 RRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKL 73
          +R+  AC+ CR + V+C       P   PC +C      C + EP KKL
Sbjct: 55 KRAPLACLRCRRRHVRC-------PGGTPCAKCAVANIACEYLEPSKKL 96

>Smik_4.460 Chr4 (833609..836365) [2757 bp, 918 aa] {ON} YDR213W
          (REAL)
          Length = 918

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 6/50 (12%)

Query: 17 SKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIF 66
          S GK     +S   C NC+ ++VKCD G       P C +C     +C++
Sbjct: 37 STGKRKFHNKSKNGCDNCKRRRVKCDEG------KPACKKCTNMKLECVY 80

>NDAI0E03460 Chr5 (742144..744993) [2850 bp, 949 aa] {ON}
          Anc_8.423
          Length = 949

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 25/55 (45%), Gaps = 6/55 (10%)

Query: 15 KKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEP 69
          K S GK     +S   C NC+ ++VKCD      PH   C +C      C++  P
Sbjct: 48 KTSTGKRKFHNKSKNGCDNCKRRRVKCD---ESKPH---CQKCVNMQLHCVYTPP 96

>TBLA0B06240 Chr2 complement(1469510..1473817) [4308 bp, 1435 aa]
           {ON} Anc_4.344 YML076C
          Length = 1435

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 25/56 (44%)

Query: 12  MSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFD 67
           M  K    +   ++RS  AC+ C   K KC      + +  PC RC +  R C FD
Sbjct: 324 MPTKMETTEKGSFKRSTFACVRCHSLKQKCLPSDFNDIYRKPCKRCLKTNRLCKFD 379

>KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON}
           uniprot|Q7Z8R2 Kluyveromyces lactis Sip4 protein
          Length = 717

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 6/54 (11%)

Query: 21  SVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLG 74
           S + +R  +AC  CRLKK+KCD         P C  CK+    C   + L + G
Sbjct: 53  STKVKRFSQACDRCRLKKIKCD------GIKPSCSNCKKIGYHCSTSDKLTRRG 100

>Suva_11.213 Chr11 (392506..392993,393045..395514) [2958 bp, 985
          aa] {ON} YKL015W (REAL)
          Length = 985

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 7/56 (12%)

Query: 18 KGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKL 73
          K +  +  RS  AC++CR + +KC       P   PC +C      C + EP KK+
Sbjct: 21 KQRQRKQPRSAVACLSCRKRHIKC-------PGGNPCQKCITSNAICEYLEPSKKI 69

>KNAG0D05240 Chr4 (953893..956502) [2610 bp, 869 aa] {ON}
          Anc_7.512 YLR451W
          Length = 869

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 28/50 (56%), Gaps = 5/50 (10%)

Query: 24 WRRSYKACINCRLKKVKCDLGPLENPHSP-PCVRCKREARDCIFDEPLKK 72
          +RR   AC+ CR +K +CD     +  +P PC +CK++   C+  +  ++
Sbjct: 41 YRRKKFACVECRQQKSRCD----ASEKAPGPCTKCKQKGVTCVLKKDFRR 86

>NDAI0K00150 Chr11 complement(20792..23653) [2862 bp, 953 aa] {ON}
          Anc_8.879 YML099C
          Length = 953

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 6/42 (14%)

Query: 23 RWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDC 64
          R  +++  C  CR +KVKCDL        P C RC+R    C
Sbjct: 4  RRAKTFTGCWTCRSRKVKCDL------RRPNCSRCERSELQC 39

>KNAG0F03720 Chr6 (695079..697379) [2301 bp, 766 aa] {ON}
          Anc_7.512 YLR451W
          Length = 766

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 4/48 (8%)

Query: 25 RRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKK 72
          RR Y AC+ CR +K KCD          PC RCK++   C   +  K+
Sbjct: 13 RRKY-ACVECRQQKSKCD---YTTKFPEPCSRCKKKGIICAVKQGFKR 56

>KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa]
          {ON} Anc_1.128 YJL206C
          Length = 658

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 25/52 (48%), Gaps = 7/52 (13%)

Query: 13 SDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDC 64
          +D K+K  +    R +KACI CR KK +CD          PC  C R +  C
Sbjct: 14 TDSKTKKLTPTRLRVFKACIACRKKKRRCD-------GKSPCSHCARTSIIC 58

>KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON}
          Anc_1.277 YJL089W
          Length = 725

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 23/49 (46%), Gaps = 6/49 (12%)

Query: 26 RSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLG 74
          R  +AC  CRLKK+KCD         P C  CK+   +C     L + G
Sbjct: 11 RVSQACDRCRLKKIKCD------GQKPRCSNCKKINFNCAISTKLSRRG 53

>SAKL0G11902g Chr7 (1016915..1019635) [2721 bp, 906 aa] {ON}
          similar to uniprot|P07272 Saccharomyces cerevisiae
          YLR014C PPR1 Zinc finger transcription factor
          containing a Zn(2)-Cys(6) binuclear cluster domain
          positively regulates transcription of genes involved in
          uracil biosynthesis activity may be modulated by
          interaction with Tup1p
          Length = 906

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 6/44 (13%)

Query: 26 RSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEP 69
          RS  AC  CRLKKVKCD         P C +C      C+  +P
Sbjct: 38 RSIAACKRCRLKKVKCD------QKFPSCSKCASANEPCVSLDP 75

>YDR034C Chr4 complement(509737..512109) [2373 bp, 790 aa] {ON}
           LYS14Transcriptional activator involved in regulation of
           genes of the lysine biosynthesis pathway; requires
           2-aminoadipate semialdehyde as co-inducer
          Length = 790

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 6/49 (12%)

Query: 18  KGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIF 66
           KG +V+ + S   C  C+ +++KCD         P C +C R  R C++
Sbjct: 146 KGNTVKRKYSRNGCSECKRRRMKCD------ETKPTCWQCARLNRQCVY 188

>TPHA0A01650 Chr1 (335768..337366) [1599 bp, 532 aa] {ON} Anc_8.298
           YDR131C
          Length = 532

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 60/139 (43%), Gaps = 14/139 (10%)

Query: 190 IDSPATQSTTST-------DSVKHLDLSDESI--ASLFLSENETNRKKVTSLIEAVIAAR 240
            D+P +++   T       D +K++D+  E +  A LF+ ++E +  K+  + +      
Sbjct: 315 FDAPMSKTFLDTMGMSACKDKIKYIDIKFEPLDTALLFIEQDEISEFKINVVCKCDDCNE 374

Query: 241 PISNRKLTDYDYIGKSKMISEFEAIQLINAFFLTMHPFYPYLPDQLQDPHELARYPILLC 300
            + N  L  Y     S  IS+F  ++  N F L M   YP +P      H L  YP +  
Sbjct: 375 TLHNVILKKYFPSQDSFTISDFSDVEDKN-FLLQMFKLYPIIPYC----HILGEYPPIAF 429

Query: 301 TILTISSRHHKFNELGTYN 319
              ++S    K N L  YN
Sbjct: 430 NAASLSEHAKKVNSLLKYN 448

>CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some
          similarities with uniprot|Q12180 Saccharomyces
          cerevisiae YOL089c HAL9 or uniprot|P38114 Saccharomyces
          cerevisiae YBR150c TBS1
          Length = 1049

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 25 RRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIF 66
          RRS KAC +CR +K++CD     NP +  C  C +   +C F
Sbjct: 35 RRSTKACDHCRKRKIRCDEV---NPVTNKCSNCVKFKVECTF 73

>Kpol_1009.5 s1009 complement(10170..13706) [3537 bp, 1178 aa] {ON}
           complement(10170..13706) [3537 nt, 1179 aa]
          Length = 1178

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 59/133 (44%), Gaps = 25/133 (18%)

Query: 2   FLKELRLSKRMSD---KKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHS-PPCVRC 57
           F KEL L+    D   K  KG+S       K+C+ CR +K +CD       H  P C  C
Sbjct: 16  FQKELELAGNQVDILLKDKKGRS-------KSCLFCRRRKQRCD-------HKLPSCTAC 61

Query: 58  KREARDCIFDEPLKKLGTVENENDSIDDNQRVPNSPEDEIQQNTDIIQERISSIVATNES 117
            +    CI  +P +   T  N+++ I +   + + P      N+  + E  + +V+T+ S
Sbjct: 62  LKAGVRCI--QPARY--THVNKSEPIQEEPELSSKPSPTTSTNS--VPETTADVVSTSPS 115

Query: 118 R-FNNDISNSQKH 129
                D+ N+ K 
Sbjct: 116 SVLGTDVDNANKQ 128

>Skud_20.3 Chr20 (4504..5916) [1413 bp, 470 aa] {ON} YBR297W
          (REAL)
          Length = 470

 Score = 37.4 bits (85), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 7/46 (15%)

Query: 29 KACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLG 74
          ++C  CR+++VKCD        + PC RC +    C + +PLKK G
Sbjct: 6  QSCDCCRVRRVKCD-------RNKPCNRCLQRHLKCTYLQPLKKRG 44

>Kpol_1031.47 s1031 (125242..127926) [2685 bp, 894 aa] {ON}
           (125242..127926) [2685 nt, 895 aa]
          Length = 894

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 22/99 (22%), Positives = 43/99 (43%), Gaps = 11/99 (11%)

Query: 6   LRLSKRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCI 65
           + +  ++  K S GK     +S   C NC+ ++VKCD         P C +C     DC 
Sbjct: 26  IEVGGKIVSKTSTGKRKFHNKSKNGCENCKRRRVKCD------EAKPACKKCSNMKLDCN 79

Query: 66  FDEPLKKLGTV-----ENENDSIDDNQRVPNSPEDEIQQ 99
           + +      T+     ++   S     ++PN  ++++Q+
Sbjct: 80  YPKVTHIQSTITTTVYKDGTKSKSGGIKLPNQKKNQLQK 118

>KLLA0E20307g Chr5 (1806005..1809364) [3360 bp, 1119 aa] {ON}
           uniprot|P87164 Kluyveromyces lactis SEF1 Suppressor
           protein SEF1
          Length = 1119

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 5/53 (9%)

Query: 17  SKGKSV--RWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFD 67
           SKGK+V     R   +C +CR  K+KC+          PC RC+R    C  D
Sbjct: 102 SKGKAVVNAGHRPVTSCTHCRQHKIKCNAS---EKFPAPCSRCERMGLHCEID 151

>Smik_4.269 Chr4 complement(491110..493446) [2337 bp, 778 aa] {ON}
           YDR034C (REAL)
          Length = 778

 Score = 37.7 bits (86), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 6/49 (12%)

Query: 18  KGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIF 66
           KG +V+ + S   C  C+ +++KCD         P C +C R  R CI+
Sbjct: 134 KGNTVKRKYSRNGCSECKRRRMKCD------ETKPTCWQCARLNRHCIY 176

>YPR196W Chr16 (931376..932788) [1413 bp, 470 aa] {ON} Putative
          maltose-responsive transcription factor
          Length = 470

 Score = 37.4 bits (85), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 7/46 (15%)

Query: 29 KACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLG 74
          ++C  CR+++VKCD        + PC RC++    C + +PL+K G
Sbjct: 6  QSCDCCRVRRVKCD-------RNRPCDRCRQRNLRCTYLQPLRKRG 44

>ZYRO0D14432g Chr4 complement(1222977..1226489) [3513 bp, 1170 aa]
           {ON} similar to uniprot|Q05854 Saccharomyces cerevisiae
           YLR278C Protein of unknown function localizes to the
           nucleus potential Cdc28p substrate
          Length = 1170

 Score = 37.7 bits (86), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 41/152 (26%), Positives = 66/152 (43%), Gaps = 31/152 (20%)

Query: 2   FLKELRLSKRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREA 61
           F KEL L+   ++   + K  R R    +C+ CR +K KCD         P C  C R +
Sbjct: 16  FHKELELAGARTELLLQDKKGRSR----SCLLCRRRKQKCDH------KQPSCTTCLRAS 65

Query: 62  RDCIFDEPLKKLGTVENENDSIDDNQRVPNSPEDEIQQNTDIIQERISSIVATNESRFNN 121
             CI  +P+ + G V +E  + D     P +                +S  +T +S+ N+
Sbjct: 66  VKCI--QPV-RYGVVTDE--ATDGLSSPPVT---------------STSGYSTGDSKINS 105

Query: 122 DISNSQKHERKDKPSERKS-NLKVNFTNMRNA 152
            +   +K ER + PSE  S  + V   ++RN 
Sbjct: 106 PVDQPRKLERSNNPSEMGSVPIVVGSPDLRNP 137

>NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa]
          {ON} 
          Length = 1113

 Score = 37.7 bits (86), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 7/44 (15%)

Query: 25 RRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDE 68
          ++  KAC NCR +K+KC         + PC  C     +CIFD+
Sbjct: 31 KKVSKACANCRRRKIKCT-------GTYPCSNCAAYQCECIFDD 67

>YLR014C Chr12 complement(172268..174982) [2715 bp, 904 aa] {ON}
          PPR1Zinc finger transcription factor containing a
          Zn(2)-Cys(6) binuclear cluster domain, positively
          regulates transcription of URA1, URA3, URA4, and URA10,
          which are involved in de novo pyrimidine biosynthesis,
          in response to pyrimidine starvation; activity may be
          modulated by interaction with Tup1p
          Length = 904

 Score = 37.7 bits (86), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 6/55 (10%)

Query: 15 KKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEP 69
          K+    ++   +S  AC  CRLKK+KCD         P C RC +    C+  +P
Sbjct: 18 KRGDSPNIGISKSRTACKRCRLKKIKCD------QEFPSCKRCAKLEVPCVSLDP 66

>AGL083W Chr7 (550291..552861) [2571 bp, 856 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YKL038W (RGT1) and
          Non-syntenic homolog of Saccharomyces cerevisiae
          YBR033W (EDS1)
          Length = 856

 Score = 37.7 bits (86), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 34/65 (52%), Gaps = 5/65 (7%)

Query: 9  SKRMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDE 68
          S+R    +S G   R  +  +AC  CR KK+KC+    E+  S  C  C++ +  C F+ 
Sbjct: 24 SRRRDSVESAGDGRRRTKVSRACDQCRRKKIKCEYQ--EDAQS--CSGCRKNSERCAFER 79

Query: 69 -PLKK 72
           PLK+
Sbjct: 80 VPLKR 84

>KAFR0I00280 Chr9 complement(57061..59871) [2811 bp, 936 aa] {ON}
           Anc_4.344 YML076C
          Length = 936

 Score = 37.7 bits (86), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 32/123 (26%), Positives = 51/123 (41%), Gaps = 14/123 (11%)

Query: 16  KSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFD-----EPL 70
           K  GK+   +R   AC+ C   K KC      + +  PC RC R+   C FD        
Sbjct: 42  KKDGKT---KRHAFACVRCHSLKQKCVPSDSNDIYRKPCQRCLRQKIVCKFDLSKRIRKK 98

Query: 71  KKLGTVENENDSIDDNQRVPNSPEDEIQQNTDIIQERISSIVATNESRFNNDISNSQKHE 130
           +K+G    +N +      + NSP +       ++ + +S+   T  S  N+D S   K  
Sbjct: 99  RKMGMASIDNSAKTSPAVIDNSPSNS------VVNDILSNSSQTPPSVQNSDFSVENKRT 152

Query: 131 RKD 133
           + D
Sbjct: 153 KID 155

>TBLA0B04800 Chr2 complement(1127000..1129333) [2334 bp, 777 aa]
          {ON} 
          Length = 777

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 30/61 (49%), Gaps = 8/61 (13%)

Query: 18 KGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFD--EPLKKLGT 75
          K K+    R  + C +CR++K+KCD         P C RC +  R C +D   P+  L +
Sbjct: 2  KYKNSNKSRISRVCNSCRIQKLKCD------RERPSCKRCLKNKRPCYYDTSSPVLILNS 55

Query: 76 V 76
          V
Sbjct: 56 V 56

>Kpol_1042.6 s1042 (9848..11548,11550..11612,11615..12193) [2343 bp,
           780 aa] {ON} (9848..11548,11550..11612,11615..12193)
           [2343 nt, 781 aa]
          Length = 780

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 39/87 (44%), Gaps = 16/87 (18%)

Query: 23  RWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRC-KREARDCIFDEPLKKLGTVENEND 81
           R R+  K+C  CR +K+KCD G       P C +C  RE  +CI+ E           N 
Sbjct: 28  RRRKVIKSCTFCRKRKLKCDHG------RPMCNQCSSRELPECIYTEGF---------NF 72

Query: 82  SIDDNQRVPNSPEDEIQQNTDIIQERI 108
            I   +   NSP  E+ Q    ++ ++
Sbjct: 73  QITTKELFDNSPNIELIQKIKELESKV 99

>Skud_7.638 Chr7 (1060062..1061483) [1422 bp, 473 aa] {ON} YFL052W
          (REAL)
          Length = 473

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 7/46 (15%)

Query: 29 KACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLG 74
          +AC  CR+++VKCD          PC RC +    C + +PL+K G
Sbjct: 11 QACDCCRVRRVKCD-------GKKPCNRCLQHDLKCTYLQPLRKRG 49

>Kpol_529.15 s529 complement(38664..41510) [2847 bp, 948 aa] {ON}
           complement(38664..41510) [2847 nt, 949 aa]
          Length = 948

 Score = 37.7 bits (86), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 8/60 (13%)

Query: 15  KKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFD--EPLKK 72
           K S GK    ++S   C NC+ ++VKCD         P C +C     +C++   +P KK
Sbjct: 95  KTSTGKRKFHKKSKNGCDNCKRRRVKCD------ESKPICQKCINMKLNCVYTPVQPRKK 148

>NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]
          {ON} Anc_7.17
          Length = 1059

 Score = 37.7 bits (86), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 28/60 (46%), Gaps = 11/60 (18%)

Query: 17 SKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFD----EPLKK 72
          ++ K  R+R S+  C  CR  K KCD         P C RC +    CI+D    EP K+
Sbjct: 40 AQRKKKRYRLSF-VCQECRKSKTKCD------KEKPSCSRCLKIGITCIYDVAKQEPPKR 92

>Suva_15.415 Chr15 (726296..728899) [2604 bp, 867 aa] {ON} YCR106W
          (REAL)
          Length = 867

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 7/51 (13%)

Query: 20 KSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFD-EP 69
          KS R  R    CI C+ +K+KCD         P C RC++ ++ C ++ EP
Sbjct: 5  KSARRPRPSFVCIPCKSRKLKCD------RLRPVCTRCRKTSKQCTYENEP 49

>ZYRO0A09350g Chr1 (749695..752076) [2382 bp, 793 aa] {ON} similar
          to gnl|GLV|KLLA0A04169g Kluyveromyces lactis
          KLLA0A04169g and some similarites with YDR213W
          uniprot|Q12151 Saccharomyces cerevisiae YDR213W UPC2
          involved in sterol uptake zinc finger transcription
          factor of the Zn(2)-Cys(6) binuclear cluster domain
          type
          Length = 793

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 6/50 (12%)

Query: 17 SKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIF 66
          S GK     +S   C NC+ ++VKCD G       P C +C     DC++
Sbjct: 33 STGKRKFHNKSKNGCDNCKRRRVKCDEG------KPLCRKCVNMKLDCVY 76

>YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}
          RGT1Glucose-responsive transcription factor that
          regulates expression of several glucose transporter
          (HXT) genes in response to glucose; binds to promoters
          and acts both as a transcriptional activator and
          repressor
          Length = 1170

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 30/63 (47%), Gaps = 6/63 (9%)

Query: 12 MSDKKSKGKSVRWR-RSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDE-P 69
          M    +   +++ R ++ +AC  CR KK+KCD           C  C+R    C FD  P
Sbjct: 27 MDSAAAASHAIKKRTKASRACDQCRKKKIKCDY----KDEKGVCSNCQRNGDRCSFDRVP 82

Query: 70 LKK 72
          LK+
Sbjct: 83 LKR 85

>KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly
          similar to uniprot|P52960 Saccharomyces cerevisiae
          YOR363C PIP2 peroxisome induction pathway 2 (PIP2)
          transcriptional activator of peroxisome proliferation
          may form heterodimer with Oaf1 to activate
          oleate-inducible gene expression activator of
          peroxisome proliferation
          Length = 847

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 7/50 (14%)

Query: 18 KGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFD 67
          + K  R R S+  C NCR +K+KCD         P C RC +   +C +D
Sbjct: 20 RSKKSRLRLSF-VCRNCRKRKIKCDKA------QPKCGRCAKLGLECNYD 62

>SAKL0D02596g Chr4 (204347..206599) [2253 bp, 750 aa] {ON}
          conserved hypothetical protein
          Length = 750

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 21/42 (50%), Gaps = 6/42 (14%)

Query: 25 RRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIF 66
          +RS   C+ CR +K KCD         P C  CKR   DC++
Sbjct: 30 KRSKSGCLTCRKRKKKCDEA------RPRCTGCKRNLLDCVW 65

>KAFR0H01800 Chr8 complement(333664..336048) [2385 bp, 794 aa]
          {ON} Anc_8.423 YLR228C
          Length = 794

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 24/55 (43%), Gaps = 6/55 (10%)

Query: 15 KKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEP 69
          K S GK     +S   C NC+ ++VKCD         P C +C      C++  P
Sbjct: 40 KTSTGKRKFHNKSKTGCDNCKRRRVKCD------ETKPMCAKCCNMKLTCVYSPP 88

>KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.845
           YMR280C
          Length = 1237

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 23/47 (48%), Gaps = 6/47 (12%)

Query: 26  RSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKK 72
           R+ +AC  CRLKK+KCDL        P C  C     +C   + L +
Sbjct: 171 RASQACDRCRLKKIKCDL------KRPQCSSCASVGFECKLSDKLTR 211

>ZYRO0D08316g Chr4 (719929..721971) [2043 bp, 680 aa] {ON}
          conserved hypothetical protein
          Length = 680

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 16 KSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDE 68
          K + K  + +R+ +AC  CR  K +C L P+ N     C+RC+     C F +
Sbjct: 18 KPRKKEFKGKRAVRACDTCRRLKTRCILSPIPNEFY--CLRCESLKIHCSFQD 68

>Kwal_55.20722 s55 (530982..533465) [2484 bp, 827 aa] {ON} YCR106W
           (RDS1) - transcriptional regulator [contig 139] FULL
          Length = 827

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 41/103 (39%), Gaps = 28/103 (27%)

Query: 20  KSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDC--------------- 64
           KS R  R    C+ CR +K+KCD         P C RCK+    C               
Sbjct: 4   KSPRVNRPRLVCLECRNRKLKCDKA------RPKCTRCKQNLLTCSYANDGNSPGGSKLY 57

Query: 65  ---IFDEPLKKLGTVENENDSIDDNQRVP---NSPEDEIQQNT 101
               F    + LGT  +E+ S ++  RVP   NSP + I   T
Sbjct: 58  VDKAFPHSSEFLGTQHSESSSTNET-RVPSYSNSPIENIGDCT 99

>Kpol_1008.13 s1008 (21147..23855) [2709 bp, 902 aa] {ON}
          (21147..23855) [2709 nt, 903 aa]
          Length = 902

 Score = 37.4 bits (85), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 5/49 (10%)

Query: 25 RRSYKACINCRLKKVKCDLGPLENPHSP-PCVRCKREARDCIFDEPLKK 72
          RR   AC+ CR +K KCD        +P PC +C ++   CI  +  ++
Sbjct: 52 RRKKFACVECRQQKSKCDAV----ERAPDPCTKCSKKGLQCILKKDYRR 96

>NDAI0E03850 Chr5 (846504..848810) [2307 bp, 768 aa] {ON} Anc_7.56
          Length = 768

 Score = 37.4 bits (85), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 26/49 (53%), Gaps = 8/49 (16%)

Query: 25 RRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDC-IFDEPLKK 72
          +R   AC NCR ++ KCDL       S PC  C R   DC + +E L+K
Sbjct: 53 KRKRLACTNCRKRRKKCDL-------SYPCASCVRLRIDCNVNEEDLRK 94

>CAGL0L09691g Chr12 complement(1041796..1044270) [2475 bp, 824 aa]
          {ON} some similarities with uniprot|P25502
          Saccharomyces cerevisiae YKL015w PUT3 positive
          activator of the proline utilisation pathway
          Length = 824

 Score = 37.4 bits (85), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 21/46 (45%), Gaps = 7/46 (15%)

Query: 30 ACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLGT 75
          AC+ CR K +KC       P   PC +C   +  C +  P KK+  
Sbjct: 27 ACLRCRQKHIKC-------PGGNPCAKCVISSATCEYLAPTKKIAV 65

>Suva_2.381 Chr2 (669136..671892) [2757 bp, 918 aa] {ON} YDR213W
          (REAL)
          Length = 918

 Score = 37.4 bits (85), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 6/50 (12%)

Query: 17 SKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIF 66
          S GK     +S   C NC+ ++VKCD G       P C +C     +C++
Sbjct: 37 STGKRKFHNKSKNGCDNCKRRRVKCDEG------KPACKKCTNMKLECLY 80

>AGL091W Chr7 (535317..537917) [2601 bp, 866 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR228C (ECM22) and
           YDR213W (UPC2)
          Length = 866

 Score = 37.0 bits (84), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 8/60 (13%)

Query: 15  KKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFD--EPLKK 72
           K + GK     +S   C NC+ ++VKCD G       P C +C +    C++   +P KK
Sbjct: 73  KTATGKRKFHNKSKNGCDNCKRRRVKCDEG------KPGCQKCLKMRLSCVYTPAKPRKK 126

>Skud_4.475 Chr4 (844018..846759) [2742 bp, 913 aa] {ON} YDR213W
           (REAL)
          Length = 913

 Score = 37.0 bits (84), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 63/149 (42%), Gaps = 42/149 (28%)

Query: 17  SKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPL------ 70
           S GK     +S   C NC+ ++VKCD G       P C +C     +C++  P+      
Sbjct: 37  STGKRKFHNKSKNGCDNCKRRRVKCDEG------KPACKKCTNMKLECLY-TPIHLRKGR 89

Query: 71  ----------KKLGTVENENDSIDDNQRVPNSPEDEIQQNTDIIQERISSIVATNESRFN 120
                     K  G+VE E+ SID    +P+  + E     D     +SS V  +ES  +
Sbjct: 90  GATVVKYVTRKADGSVEPES-SID----LPDVVKKEQTPFND-----VSSAVKASES--S 137

Query: 121 ND-------ISNSQKHERKDKPSERKSNL 142
           ND        + S+  E+   P E K+N+
Sbjct: 138 NDSFPSSASTTKSESEEKSSAPIEDKNNM 166

>KLLA0A03421g Chr1 (308414..311056) [2643 bp, 880 aa] {ON} weakly
          similar to uniprot|P39720 Saccharomyces cerevisiae
          YAL051W OAF1 Oleate-activated transcription factor acts
          alone and as a heterodimer with Pip2p activates genes
          involved in beta-oxidation of fatty acids and
          peroxisome organization and biogenesis
          Length = 880

 Score = 37.0 bits (84), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 10/53 (18%)

Query: 23 RWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFD---EPLKK 72
          R++ S+  C  CR  K KCD         P C RC+R  + CI+D   +PL +
Sbjct: 14 RYKLSF-VCQLCRKSKTKCD------RKKPSCARCQRLNKPCIYDLEYQPLPR 59

>Skud_12.544 Chr12 (969942..972608) [2667 bp, 888 aa] {ON} YLR451W
          (REAL)
          Length = 888

 Score = 37.0 bits (84), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 32/61 (52%), Gaps = 6/61 (9%)

Query: 13 SDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSP-PCVRCKREARDCIFDEPLK 71
          S+ K++   +  +R + AC+ CR +K KCD     +  +P PC +C ++   CI     +
Sbjct: 20 SENKNRAGMIARKRKF-ACVECRQQKSKCD----AHERAPGPCTKCAKKNVPCILKRDFR 74

Query: 72 K 72
          +
Sbjct: 75 R 75

>Skud_4.287 Chr4 complement(501344..503698) [2355 bp, 784 aa] {ON}
           YDR034C (REAL)
          Length = 784

 Score = 37.0 bits (84), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 6/49 (12%)

Query: 18  KGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIF 66
           KG +V+ + S   C  C+ +++KCD         P C +C R  R C++
Sbjct: 140 KGNTVKRKYSRNGCSECKRRRMKCD------ETKPTCWQCARLNRQCVY 182

>KLLA0F25630g Chr6 (2378464..2381487) [3024 bp, 1007 aa] {ON} some
           similarities with uniprot|P32862 Saccharomyces
           cerevisiae YKL038W RGT1 Glucose-responsive transcription
           factor that regulates expression of several glucose
           transporter (HXT) genes in response to glucose binds to
           promoters and acts both as a transcriptional activator
           and repressor
          Length = 1007

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 29/56 (51%), Gaps = 4/56 (7%)

Query: 20  KSVRWRRSYKACINCRLKKVKCDL--GPLENPHSPPCVRCKREARDCIFDE-PLKK 72
           +S R  +  +AC  CR KK+KCD   G   NP    C  C++    C F+  PLK+
Sbjct: 106 ESRRRSKVSRACDQCRKKKIKCDFIEGHDINPDQ-SCTGCRKIGEKCSFERIPLKR 160

>CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]
          {ON} some similarities with uniprot|P46954
          Saccharomyces cerevisiae YJL089w SIP4 interacts with
          SNF1 protein kinase
          Length = 1209

 Score = 37.0 bits (84), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 7/60 (11%)

Query: 25 RRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLGTVENENDSID 84
          +R  +AC  CR KK+KCD          PC  C +   +C+  + L + G  +   D ++
Sbjct: 23 KRHSQACDRCRSKKIKCD-------GLQPCSNCAKIGYNCVTSDKLSRRGLPKGYTDLLE 75

>Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C
           (REAL)
          Length = 786

 Score = 37.0 bits (84), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 7/47 (14%)

Query: 26  RSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKK 72
           R+++AC+ CR +KV+C  G +      PC  C     +C +D P +K
Sbjct: 62  RAHRACMACRKRKVRCS-GQI------PCRFCHTNKLECTYDRPPRK 101

>NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa] {ON}
           Anc_4.113
          Length = 1043

 Score = 37.0 bits (84), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 35/79 (44%), Gaps = 11/79 (13%)

Query: 17  SKGKSVR--WRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLG 74
           SK K VR    +  KAC NCR +K+KC           PC  C+     CI+    +K  
Sbjct: 32  SKDKRVRKPTNKVSKACDNCRKRKIKCT-------GKQPCATCEAYQCPCIYSTQKRK-- 82

Query: 75  TVENENDSIDDNQRVPNSP 93
           T +  N +  +   +PN P
Sbjct: 83  TSKRNNTAKMEQPEIPNGP 101

>SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa]
          {ON} some similarities with uniprot|P32862
          Saccharomyces cerevisiae YKL038W RGT1
          Glucose-responsive transcription factor that regulates
          expression of several glucose transporter (HXT) genes
          in response to glucose binds to promoters and acts both
          as a transcriptional activator and repressor
          Length = 1020

 Score = 37.0 bits (84), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 25/45 (55%), Gaps = 5/45 (11%)

Query: 29 KACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDE-PLKK 72
          +AC  CR KK+KCD+    +  +P C  C +    C F+  PLK+
Sbjct: 34 RACDQCRKKKIKCDV----SEDNPVCSGCFKVGDRCTFERVPLKR 74

>Kwal_23.3122 s23 complement(166388..168754) [2367 bp, 788 aa]
          {ON} YDR213W (UPC2) - zinc finger transcription factor
          of the Zn(2)-Cys(6) binuclear cluster domain type
          [contig 249] FULL
          Length = 788

 Score = 37.0 bits (84), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 6/52 (11%)

Query: 15 KKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIF 66
          K S GK    ++S   C NC+ ++VKCD         P C +C     +C++
Sbjct: 34 KTSTGKRKFHKKSKNGCDNCKRRRVKCD------EDKPSCQKCLNMKLECVY 79

>Kpol_1002.5 s1002 (11943..14819) [2877 bp, 958 aa] {ON}
           (11943..14819) [2877 nt, 959 aa]
          Length = 958

 Score = 37.0 bits (84), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 4/64 (6%)

Query: 11  RMSDKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPL 70
           R S   S   S+  +++ +AC  CR +K+KCD    +N     C  C R    C F+   
Sbjct: 55  RSSSTGSAKGSIGGKKATRACDQCRKRKIKCDYDNDKN----VCSSCNRNGDRCQFNRVQ 110

Query: 71  KKLG 74
            K G
Sbjct: 111 LKRG 114

>TPHA0G00380 Chr7 complement(65673..68294) [2622 bp, 873 aa] {ON} 
          Length = 873

 Score = 37.0 bits (84), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 25/48 (52%), Gaps = 3/48 (6%)

Query: 25 RRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKK 72
          +R   AC+ CR +K KCD   LE     PC +C ++   C+  +  ++
Sbjct: 26 KRKKFACVECRQQKSKCD--ALEKAPE-PCTKCSKKGVSCVLQKDYRR 70

>TDEL0B06360 Chr2 complement(1127150..1130095) [2946 bp, 981 aa]
          {ON} Anc_2.547 YKL038W
          Length = 981

 Score = 37.0 bits (84), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 5/48 (10%)

Query: 26 RSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDE-PLKK 72
          ++ +AC  CR +K+KCD    +      C  C + A  C FD  PLK+
Sbjct: 44 KASRACDQCRKRKIKCDFSEEKG----ICTSCSKNADRCAFDRVPLKR 87

>NCAS0C02730 Chr3 (513280..515607) [2328 bp, 775 aa] {ON}
          Anc_8.423
          Length = 775

 Score = 36.6 bits (83), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 6/55 (10%)

Query: 15 KKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEP 69
          K S GK     +S   C NC+ ++VKCD         P C +C     +C++  P
Sbjct: 42 KTSTGKRKFHNKSKNGCDNCKRRRVKCD------ELKPTCQKCINMNLECVYSMP 90

>KNAG0G02130 Chr7 complement(482333..484231) [1899 bp, 632 aa]
          {ON} 
          Length = 632

 Score = 36.6 bits (83), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 7/37 (18%)

Query: 30 ACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIF 66
          AC++CR K+ KC++         PC  C+R    CIF
Sbjct: 20 ACLHCRHKRKKCNM-------KSPCSNCQRAGMKCIF 49

>Kpol_1057.3 s1057 (3619..6702) [3084 bp, 1027 aa] {ON} (3619..6702)
           [3084 nt, 1028 aa]
          Length = 1027

 Score = 36.6 bits (83), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 33/67 (49%), Gaps = 6/67 (8%)

Query: 31  CINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPL--KKLGTVENENDSIDDNQR 88
           C+NCR  K KC +     P S  CVRC+ ++ DC   + L  KK       +  +   QR
Sbjct: 161 CLNCRDAKKKCTMM----PGSQNCVRCETKSLDCRMVDNLNDKKRRESFGTDSYLSKKQR 216

Query: 89  VPNSPED 95
           +P + E+
Sbjct: 217 LPENSEN 223

>ZYRO0G17512g Chr7 complement(1447970..1449541) [1572 bp, 523 aa]
          {ON} similar to uniprot|P43634 Saccharomyces cerevisiae
          YLR098C CHA4 Zinc-finger protein with Zn[2]-Cys[6]
          fungal- type binuclear cluster domain; DNA-binding
          transcriptional activator or CHA1 and to YOR337W
          uniprot|P47988 Saccharomyces cerevisiae YOR337W TEA1
          Mutants are defective in Ty1 Enhancer-mediated
          Activation Ty1 enhancer activator
          Length = 523

 Score = 36.6 bits (83), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 19/36 (52%), Gaps = 7/36 (19%)

Query: 30 ACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCI 65
          AC NCR K+ KCDL         PC RC R   +CI
Sbjct: 7  ACQNCRQKRKKCDL-------ELPCSRCTRLKVECI 35

>KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]
          {ON} some similarities with uniprot|P52960
          Saccharomyces cerevisiae YOR363C PIP2 peroxisome
          induction pathway 2 (PIP2) transcriptional activator of
          peroxisome proliferation may form heterodimer with Oaf1
          to activate oleate-inducible gene expression activator
          of peroxisome proliferation
          Length = 619

 Score = 36.6 bits (83), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 6/48 (12%)

Query: 20 KSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFD 67
          K  +  R    C  CR++K+KCD         P C RC +   +CI++
Sbjct: 4  KQTKRNRRLHVCDACRIRKLKCDKA------KPNCSRCAKHGLECIYN 45

>CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa]
          {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
          YAL051w OAF1 peroxisome proliferating transcription
          factor or uniprot|P52960 Saccharomyces cerevisiae
          YOR363c PIP2
          Length = 994

 Score = 36.6 bits (83), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 26/58 (44%), Gaps = 9/58 (15%)

Query: 13 SDKKSKGKSVRWRRSYK---ACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFD 67
          S    +G + R R+  +    C  CR  K +CD         P C RCK+   +C++D
Sbjct: 6  SGSSPEGNAARTRKRNRISFVCQACRRSKTRCD------KEKPICTRCKKLKLECVYD 57

>KLTH0F07854g Chr6 complement(677647..680013) [2367 bp, 788 aa]
          {ON} some similarities with uniprot|Q12151
          Saccharomyces cerevisiae YDR213W UPC2 involved in
          sterol uptake zinc finger transcription factor of the
          Zn(2)- Cys(6) binuclear cluster domain type
          Length = 788

 Score = 36.6 bits (83), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 25/52 (48%), Gaps = 6/52 (11%)

Query: 15 KKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIF 66
          K S GK    ++S   C NC+ ++VKCD         P C +C     +C++
Sbjct: 34 KTSTGKRKFHKKSKNGCDNCKRRRVKCD------EDKPSCQKCINMKLECVY 79

>Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {ON}
           YOL089C (REAL)
          Length = 1029

 Score = 36.6 bits (83), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 6/61 (9%)

Query: 25  RRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIF---DEPLKKLGTVENEND 81
           +R  KAC +CR +K++CD     +P +  C  C +    C F   DE L+K   +E + +
Sbjct: 127 KRVSKACDHCRKRKIRCDEV---DPQTNKCSNCVKFQSACTFKHRDEILRKKRKLETKQN 183

Query: 82  S 82
           S
Sbjct: 184 S 184

>KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly
          similar to uniprot|P36023 Saccharomyces cerevisiae
          YKR064W
          Length = 657

 Score = 36.6 bits (83), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 20/43 (46%), Gaps = 6/43 (13%)

Query: 26 RSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDE 68
          R    C+NCR +K KCD G       P C  C +    C++ E
Sbjct: 16 RPTLVCLNCRRRKTKCDRG------KPSCSNCLKLGETCVYSE 52

>NCAS0A12580 Chr1 complement(2481447..2483561) [2115 bp, 704 aa]
          {ON} 
          Length = 704

 Score = 36.6 bits (83), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 15/60 (25%), Positives = 33/60 (55%), Gaps = 5/60 (8%)

Query: 14 DKKSKGKSVRWRRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDE-PLKK 72
          +K  +  + + +++ +AC  C  +++KCD     NP +  C  C++    C+F+  P+K+
Sbjct: 27 NKPERSYNRKRKKASRACDQCHHRRIKCDF----NPETRNCSGCEKTEEKCLFNRIPMKR 82

>Skud_7.646 Chr7 (1073386..1074795) [1410 bp, 469 aa] {ON} YPR196W
          (REAL)
          Length = 469

 Score = 36.2 bits (82), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 24/46 (52%), Gaps = 7/46 (15%)

Query: 29 KACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLG 74
          ++C  CR+++VKCD          PC  C R    C + +PLKK G
Sbjct: 6  QSCDCCRVRRVKCD-------RHRPCSNCFRRHLKCTYLQPLKKRG 44

>KLLA0B04840g Chr2 (439864..442179) [2316 bp, 771 aa] {ON}
          conserved hypothetical protein
          Length = 771

 Score = 36.6 bits (83), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 5/49 (10%)

Query: 25 RRSYKACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKL 73
          ++  K CI+C+L KVKC     E   + PC RC +    C F   ++++
Sbjct: 6  KKRTKPCISCKLSKVKC-----EYTEALPCKRCLKLGIHCQFVRDVRRV 49

>Skud_7.627 Chr7 (1048240..1049664) [1425 bp, 474 aa] {ON} YBR297W
          (REAL)
          Length = 474

 Score = 36.2 bits (82), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 7/46 (15%)

Query: 29 KACINCRLKKVKCDLGPLENPHSPPCVRCKREARDCIFDEPLKKLG 74
          +AC  CR+++VKCD          PC  C +   DC + +P +K G
Sbjct: 11 QACDCCRVRRVKCD-------GKGPCSSCLQHNLDCTYLQPFRKRG 49

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.130    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 102,176,551
Number of extensions: 4345521
Number of successful extensions: 21430
Number of sequences better than 10.0: 582
Number of HSP's gapped: 21980
Number of HSP's successfully gapped: 608
Length of query: 1018
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 898
Effective length of database: 39,721,479
Effective search space: 35669888142
Effective search space used: 35669888142
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 71 (32.0 bits)