Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0D016605.526ON86686638810.0
NCAS0H025505.526ON7432203974e-39
NDAI0C010705.526ON7572183814e-37
SAKL0G04906g5.526ON6081403687e-36
TDEL0A039005.526ON6712053672e-35
Suva_13.1565.526ON7723373612e-34
Smik_13.1455.526ON7743473602e-34
KNAG0B037105.526ON7111313565e-34
Skud_13.1485.526ON7793213559e-34
YML006C (GIS4)5.526ON7743283461e-32
KLTH0G03740g5.526ON6311273368e-32
CAGL0K07271g5.526ON7761313309e-31
Kwal_47.186465.526ON6351173182e-29
KLLA0A01782g5.526ON5281333035e-28
ZYRO0D12540g5.526ON5481313036e-28
KAFR0C053905.526ON4551322989e-28
Kpol_1023.995.526ON5512102797e-25
Ecym_40615.526ON663962414e-20
TPHA0K005405.526ON675792112e-16
NCAS0F010805.526ON379791859e-14
NDAI0H015905.526ON371791859e-14
ADR198C5.526ON549801806e-13
KNAG0C032405.526ON32435790.73
TBLA0G009405.526ON78273790.87
Skud_13.3242.349ON165384752.7
KNAG0B052201.294ON90779734.6
AAL146W5.190ON1900110719.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0D01660
         (866 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0D01660 Chr4 complement(409692..412292) [2601 bp, 866 aa] {O...  1499   0.0  
NCAS0H02550 Chr8 (506755..508986) [2232 bp, 743 aa] {ON} Anc_5.5...   157   4e-39
NDAI0C01070 Chr3 complement(209024..211297) [2274 bp, 757 aa] {O...   151   4e-37
SAKL0G04906g Chr7 (403654..405480) [1827 bp, 608 aa] {ON} some s...   146   7e-36
TDEL0A03900 Chr1 (698940..700955) [2016 bp, 671 aa] {ON} Anc_5.5...   145   2e-35
Suva_13.156 Chr13 complement(246662..248980) [2319 bp, 772 aa] {...   143   2e-34
Smik_13.145 Chr13 complement(244766..247090) [2325 bp, 774 aa] {...   143   2e-34
KNAG0B03710 Chr2 complement(710003..712138) [2136 bp, 711 aa] {O...   141   5e-34
Skud_13.148 Chr13 complement(242351..244690) [2340 bp, 779 aa] {...   141   9e-34
YML006C Chr13 complement(256092..258416) [2325 bp, 774 aa] {ON} ...   137   1e-32
KLTH0G03740g Chr7 (295985..297880) [1896 bp, 631 aa] {ON} simila...   134   8e-32
CAGL0K07271g Chr11 complement(712294..714624) [2331 bp, 776 aa] ...   131   9e-31
Kwal_47.18646 s47 complement(909622..911529) [1908 bp, 635 aa] {...   127   2e-29
KLLA0A01782g Chr1 complement(157216..158802) [1587 bp, 528 aa] {...   121   5e-28
ZYRO0D12540g Chr4 (1059795..1061441) [1647 bp, 548 aa] {ON} some...   121   6e-28
KAFR0C05390 Chr3 (1080797..1082164) [1368 bp, 455 aa] {ON} Anc_5...   119   9e-28
Kpol_1023.99 s1023 complement(232194..233849) [1656 bp, 551 aa] ...   112   7e-25
Ecym_4061 Chr4 (133342..135333) [1992 bp, 663 aa] {ON} similar t...    97   4e-20
TPHA0K00540 Chr11 complement(107389..109416) [2028 bp, 675 aa] {...    86   2e-16
NCAS0F01080 Chr6 (214243..215382) [1140 bp, 379 aa] {ON} Anc_5.5...    76   9e-14
NDAI0H01590 Chr8 (385963..387078) [1116 bp, 371 aa] {ON}               76   9e-14
ADR198C Chr4 complement(1046482..1048131) [1650 bp, 549 aa] {ON}...    74   6e-13
KNAG0C03240 Chr3 complement(634593..635567) [975 bp, 324 aa] {ON}      35   0.73 
TBLA0G00940 Chr7 complement(228909..231257) [2349 bp, 782 aa] {O...    35   0.87 
Skud_13.324 Chr13 complement(551961..556922) [4962 bp, 1653 aa] ...    33   2.7  
KNAG0B05220 Chr2 (1002065..1004788) [2724 bp, 907 aa] {ON} Anc_1...    33   4.6  
AAL146W Chr1 (92509..98211) [5703 bp, 1900 aa] {ON} Syntenic hom...    32   9.9  

>TBLA0D01660 Chr4 complement(409692..412292) [2601 bp, 866 aa] {ON}
           Anc_5.526 YML006C
          Length = 866

 Score = 1499 bits (3881), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 756/866 (87%), Positives = 756/866 (87%)

Query: 1   MPVTKPKPVQVXXXXXXXXXGLWSWYLSNIRNGMFEELTENILKITLLKRFLKENFQQDI 60
           MPVTKPKPVQV         GLWSWYLSNIRNGMFEELTENILKITLLKRFLKENFQQDI
Sbjct: 1   MPVTKPKPVQVNDYYDNDNNGLWSWYLSNIRNGMFEELTENILKITLLKRFLKENFQQDI 60

Query: 61  NSTSQHSTNCTKILFTSIPDNIHQDLPILENLLKDYFDLDNLDNIQILKLTQNRCYNHEN 120
           NSTSQHSTNCTKILFTSIPDNIHQDLPILENLLKDYFDLDNLDNIQILKLTQNRCYNHEN
Sbjct: 61  NSTSQHSTNCTKILFTSIPDNIHQDLPILENLLKDYFDLDNLDNIQILKLTQNRCYNHEN 120

Query: 121 HYILKDILDNFGNTSFFIHDGTKQKIPPLKHKPDSXXXXXXXXXXXXYRDEDNSIINSDD 180
           HYILKDILDNFGNTSFFIHDGTKQKIPPLKHKPDS            YRDEDNSIINSDD
Sbjct: 121 HYILKDILDNFGNTSFFIHDGTKQKIPPLKHKPDSNNNINNLDNLDIYRDEDNSIINSDD 180

Query: 181 QQSECPSLTPLNSIRSSHAYSAKKSNSITQENSKTNFLKLSQPAIDPLSLSYGPSNPSSF 240
           QQSECPSLTPLNSIRSSHAYSAKKSNSITQENSKTNFLKLSQPAIDPLSLSYGPSNPSSF
Sbjct: 181 QQSECPSLTPLNSIRSSHAYSAKKSNSITQENSKTNFLKLSQPAIDPLSLSYGPSNPSSF 240

Query: 241 QGNSLLSLRDEAKNCCNNDEQQNGIVVAESFLNKDPNIETVDDFDGSINSHPPLIEHFLD 300
           QGNSLLSLRDEAKNCCNNDEQQNGIVVAESFLNKDPNIETVDDFDGSINSHPPLIEHFLD
Sbjct: 241 QGNSLLSLRDEAKNCCNNDEQQNGIVVAESFLNKDPNIETVDDFDGSINSHPPLIEHFLD 300

Query: 301 TNKIDEDNTEINILDSNYSKEFEAKIKXXXXXXXXXXXRSLFFTFKHKTLPESEKALSSQ 360
           TNKIDEDNTEINILDSNYSKEFEAKIK           RSLFFTFKHKTLPESEKALSSQ
Sbjct: 301 TNKIDEDNTEINILDSNYSKEFEAKIKDDGGTDDEETDRSLFFTFKHKTLPESEKALSSQ 360

Query: 361 ENKCDTTLIKTDTNLPTSEDISFDSFNTSNNVLERNETSYIGHPLSLTITHEEDQNQKIE 420
           ENKCDTTLIKTDTNLPTSEDISFDSFNTSNNVLERNETSYIGHPLSLTITHEEDQNQKIE
Sbjct: 361 ENKCDTTLIKTDTNLPTSEDISFDSFNTSNNVLERNETSYIGHPLSLTITHEEDQNQKIE 420

Query: 421 QQLLYRGDNSQNFRTDNIENRNMHNKDGLSNSSDKVXXXXXXXXXXXXXXXXVTEXXXXX 480
           QQLLYRGDNSQNFRTDNIENRNMHNKDGLSNSSDKV                VTE     
Sbjct: 421 QQLLYRGDNSQNFRTDNIENRNMHNKDGLSNSSDKVSELSKLSDSLNSLNYSVTESNSSN 480

Query: 481 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXGHFRLVLQCILIYHPHAEKTYTAIRQSDSNR 540
                                        GHFRLVLQCILIYHPHAEKTYTAIRQSDSNR
Sbjct: 481 LLSASSSNDSSSSYSAMSILPSISISDSLGHFRLVLQCILIYHPHAEKTYTAIRQSDSNR 540

Query: 541 DVADIQDDWLLYDLKFSMDNLEILTLQELLDFNRDYPKILFYTLVAINDNSSYIRTNKNI 600
           DVADIQDDWLLYDLKFSMDNLEILTLQELLDFNRDYPKILFYTLVAINDNSSYIRTNKNI
Sbjct: 541 DVADIQDDWLLYDLKFSMDNLEILTLQELLDFNRDYPKILFYTLVAINDNSSYIRTNKNI 600

Query: 601 SEINELTNNLKNLNCKPSGDDRNKKDNQKINTEFNTTRIHSNHLIDHSSSEDIPRQLYTT 660
           SEINELTNNLKNLNCKPSGDDRNKKDNQKINTEFNTTRIHSNHLIDHSSSEDIPRQLYTT
Sbjct: 601 SEINELTNNLKNLNCKPSGDDRNKKDNQKINTEFNTTRIHSNHLIDHSSSEDIPRQLYTT 660

Query: 661 LSSDEEYGEIEYPEGLEMYEPSKIKSNTTTIAHRSIRTVNSIGEWAFHRTDTRGTKDTKN 720
           LSSDEEYGEIEYPEGLEMYEPSKIKSNTTTIAHRSIRTVNSIGEWAFHRTDTRGTKDTKN
Sbjct: 661 LSSDEEYGEIEYPEGLEMYEPSKIKSNTTTIAHRSIRTVNSIGEWAFHRTDTRGTKDTKN 720

Query: 721 ISINSYVEPFSRSPSPFEYIISSHIKDSXXXXXXXXXXXXXXXDYNTKYATQKSEISKLV 780
           ISINSYVEPFSRSPSPFEYIISSHIKDS               DYNTKYATQKSEISKLV
Sbjct: 721 ISINSYVEPFSRSPSPFEYIISSHIKDSTTNETENITTTAFITDYNTKYATQKSEISKLV 780

Query: 781 LQPDNNQAGSNTLILDKIKNRKRQMHPVERSKSTPVPYNVSSKDQKNTKSKSWREKMDII 840
           LQPDNNQAGSNTLILDKIKNRKRQMHPVERSKSTPVPYNVSSKDQKNTKSKSWREKMDII
Sbjct: 781 LQPDNNQAGSNTLILDKIKNRKRQMHPVERSKSTPVPYNVSSKDQKNTKSKSWREKMDII 840

Query: 841 XXXXXXXXXXXXXDSLSDRNTLCNIM 866
                        DSLSDRNTLCNIM
Sbjct: 841 KRRREESRQRKSKDSLSDRNTLCNIM 866

>NCAS0H02550 Chr8 (506755..508986) [2232 bp, 743 aa] {ON} Anc_5.526
           YML006C
          Length = 743

 Score =  157 bits (397), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 93/220 (42%), Positives = 131/220 (59%), Gaps = 20/220 (9%)

Query: 510 GHFRLVLQCILIYHPHAEKTYTAIRQSDSNRDVADIQDDWLLYDLKFSMDNLEILTLQEL 569
           GHFRLVLQ ILI HP  ++ YTAIRQS++   +ADI DDWLLYD +FSMDNL+ILTLQ+L
Sbjct: 434 GHFRLVLQSILIQHPVTKEIYTAIRQSNNEPTIADIMDDWLLYDSQFSMDNLQILTLQDL 493

Query: 570 LDFNRDYPKILFYTLVAIND-NSSYIRTNKNISEINELTNNLKNLNCKPSGDDRNKKDNQ 628
           LD NR +PKILFY++V + D +   I+   + +  +  T+ L N     +GD+ N++   
Sbjct: 494 LDTNRSFPKILFYSMVIVTDAHHQPIQGPTSTAGPDLTTSYLSNKLESIAGDETNQRFEN 553

Query: 629 KINTEFNTTRIHSNHLIDHSSSEDIPRQLY------TTLSSDEEYGEIEYPEGLEMYEPS 682
           +             + +     ED P+Q +         +  +    +    G EMY P+
Sbjct: 554 RY------------YPMADDQVEDQPQQFFPQEDDHDDDNMYDTDDSLMEEAGPEMYLPT 601

Query: 683 KIKSNTTTIAHRSIRTVNSIGEWAFHRTDTRGTKDTKNIS 722
           ++++N TT AHRSIRTVNSIGEWAF+R +T G+     I 
Sbjct: 602 RMETNNTT-AHRSIRTVNSIGEWAFNRNNTNGSSSKSAIG 640

 Score =  135 bits (340), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 94/155 (60%), Gaps = 19/155 (12%)

Query: 7   KPVQVXXXXXXXXXGLWSWYLSNIRNGMFEELTENILKITLLKRFLKENF--QQDINST- 63
           K V+V         GLWSWYL+NIR G FEE+T N LK TLLKRFL  +F    D+ +T 
Sbjct: 3   KSVRVTDYFDNDDNGLWSWYLTNIRLGDFEEVTGNQLKYTLLKRFLNSHFYSNSDVTATE 62

Query: 64  --SQHST--------------NCTKILFTSIPDNIHQDLPILENLLKDYFDLDNLDNIQI 107
              QH+               N  KIL  SIPD +H+DL ILE  L+DYF L++L+ IQI
Sbjct: 63  SPQQHNNNNNTNNNNTQQLKPNFRKILLVSIPDKVHRDLSILETFLRDYFHLEHLEGIQI 122

Query: 108 LKLTQNRCYNHENHYILKDILDNFGNTSFFIHDGT 142
            +LTQ++CYNHENHY+L D ++NF +  F    G+
Sbjct: 123 QRLTQSKCYNHENHYLLTDTINNFDDPVFLEFAGS 157

 Score = 33.1 bits (74), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 9/62 (14%)

Query: 805 MHPVERSKSTPVPYNVSSKDQKNTKSKSWREKMDIIXXXXXXXXXXXXXDSLSDRNTLCN 864
           M  VER+KSTP+P  + S     T  K W++++  +              S  + ++LCN
Sbjct: 691 MKAVERTKSTPLPTLLKSISGTGTDKKRWKDRLKEMKKKNK---------SSQEDHSLCN 741

Query: 865 IM 866
           IM
Sbjct: 742 IM 743

>NDAI0C01070 Chr3 complement(209024..211297) [2274 bp, 757 aa] {ON}
           Anc_5.526 YML006C
          Length = 757

 Score =  151 bits (381), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 93/218 (42%), Positives = 132/218 (60%), Gaps = 23/218 (10%)

Query: 510 GHFRLVLQCILIYHPHAEKTYTAIRQSDSNRDVADIQDDWLLYDLKFSMDNLEILTLQEL 569
           GHFRLVLQ  LI +P  ++ +TAIRQS++   +A I DDWLLYD KF+MDNL+ILTLQ+L
Sbjct: 473 GHFRLVLQSTLIQNPITKEIFTAIRQSNNEPTIAHITDDWLLYDSKFAMDNLQILTLQDL 532

Query: 570 LDFNRDYPKILFYTLVAINDNSSYIRTNK----NISEINE--LTNNLKNLNCKPSGDDRN 623
           LD NR +PKILFY++V +N++S  I  ++     ++ +N   L+N L++L  K S ++  
Sbjct: 533 LDSNRTFPKILFYSMVIVNESSPPINDDQHNYNGMTALNSEYLSNKLESLE-KTSSEEGK 591

Query: 624 KKDNQKINTEFNTTRIHSNHLIDHSSSEDIPRQLYTTLSSDEEYGEIEY----------- 672
             +  K         I +    +     D+P Q +    SD+E G+ E            
Sbjct: 592 SINRYKYYPTLPKAGITAK---NGEMIADVPEQFFPGPPSDDENGKGEDYDDDYDDESLM 648

Query: 673 -PEGLEMYEPSKIKSNTTTIAHRSIRTVNSIGEWAFHR 709
              G EMY P+++++N TT AHRSIRT NSIGEWAF+R
Sbjct: 649 EQHGPEMYLPTRMQTNVTT-AHRSIRTANSIGEWAFNR 685

 Score =  132 bits (333), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 90/156 (57%), Gaps = 13/156 (8%)

Query: 9   VQVXXXXXXXXXGLWSWYLSNIRNGMFEELTENILKITLLKRFLKENF------------ 56
           V+V         GLWSWYL NIR G FEELT N LK TLLKRFL  +F            
Sbjct: 5   VRVRDYYNNDDNGLWSWYLRNIRLGDFEELTGNQLKYTLLKRFLNSHFYSNATTTDTAID 64

Query: 57  -QQDINSTSQHSTNCTKILFTSIPDNIHQDLPILENLLKDYFDLDNLDNIQILKLTQNRC 115
              + NS +       KIL  SIPD +H D+ +LE  L+DYF L++L+NIQI KLTQ+ C
Sbjct: 65  DNNNTNSVNDIKPTVKKILLVSIPDKVHSDISLLELFLRDYFHLEDLENIQITKLTQSEC 124

Query: 116 YNHENHYILKDILDNFGNTSFFIHDGTKQKIPPLKH 151
           YNHENHY+L D ++NF +  F    G+  +  P  H
Sbjct: 125 YNHENHYLLTDKVNNFDDPMFLEFAGSTWQGRPNLH 160

>SAKL0G04906g Chr7 (403654..405480) [1827 bp, 608 aa] {ON} some
           similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 608

 Score =  146 bits (368), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 93/140 (66%), Gaps = 9/140 (6%)

Query: 6   PKPVQVXXXXXXXXXGLWSWYLSNIRNGMFEELTENILKITLLKRFLKENFQQDINSTSQ 65
           P  V+V         GLWSWYLSN+R+G FEELT N+LK TLLKRFL E+  QDI   ++
Sbjct: 2   PSVVKVKDYFENDYNGLWSWYLSNLRDGHFEELTNNVLKFTLLKRFLNEHLMQDIVQFNK 61

Query: 66  HSTNCTKILFTSIPDNIHQDLPILENLLKDYFDLDNLDNIQILKLTQNRCYNHENHYILK 125
                 K+L  SIPDNIHQD+ ILEN L+ YF LD+L  IQI KLT ++ YNHENHY++ 
Sbjct: 62  ------KMLLVSIPDNIHQDITILENFLRSYFHLDDLQYIQIKKLTDSQIYNHENHYLIS 115

Query: 126 DILDNFGNTSFFIHDGTKQK 145
           D L+NF + SF    G  QK
Sbjct: 116 DNLNNFHDRSFL---GFGQK 132

 Score =  131 bits (330), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 104/343 (30%), Positives = 160/343 (46%), Gaps = 80/343 (23%)

Query: 510 GHFRLVLQCILIYHPHAEKTYTAIRQSDSNRDVADIQDDWLLYDLKFSMDNLEILTLQEL 569
           G FRLVLQ ILI +P   + +TA+RQS+++ +VA I DDWLLYD KFSM NL++L+L ++
Sbjct: 310 GTFRLVLQSILIQNPDTREIFTAVRQSNNDPNVAHINDDWLLYDEKFSMHNLQMLSLHDV 369

Query: 570 LDFNRDYPKILFYTLVAI------NDNSSYIRTN-------KNISEINELTNNLKNLNCK 616
           L+ NR +PKILFYT+V +      ++  +YI  +       + I+  + L+ N   L   
Sbjct: 370 LEINRFFPKILFYTMVMLDTEEIADEAHAYIPNDPHLPPPSQGIASTSTLSQNTLRLLPT 429

Query: 617 PSGDDRNKKDNQKINTEFNTTRIHSNHLI-DHSSSEDIPRQLYTTLSSDEEYGEIEYPEG 675
            + +    + N+ +N    + +   N+   D+   ED           D+E   +     
Sbjct: 430 ATSNVTYTRHNELLNAAATSAQDAENYFPEDNHDDED-----------DQEVNGV----- 473

Query: 676 LEMYEPSKIKSNTTTIAHRSIRTVNSIGEWAFHRTDTRGTKDTKNISINSYVEPFSRSPS 735
           + +Y P++  SN+TT AHRSI TVNSIGEWAFH  +     +  NIS             
Sbjct: 474 MPLYAPTRTNSNSTT-AHRSILTVNSIGEWAFHHNEPYPQNNHSNISF------------ 520

Query: 736 PFEYIISSHIKDSXXXXXXXXXXXXXXXDYNTKYATQKSEISKLVLQPDNNQAGSNTLIL 795
                                       D NT  A +   +S           GS+   L
Sbjct: 521 ---------------------------ADQNTSTAGKMKRVSS---------KGSSKNTL 544

Query: 796 DKIKNRKRQMHPVERSKSTPVPYNVSSKDQKNTKSKSWREKMD 838
            K       +  VERSKSTP+P  + +    + ++  W+ K++
Sbjct: 545 QKTTTVG-SLSAVERSKSTPLPTLLRTLSGLDDETMMWKRKVE 586

>TDEL0A03900 Chr1 (698940..700955) [2016 bp, 671 aa] {ON} Anc_5.526
           YML006C
          Length = 671

 Score =  145 bits (367), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 82/205 (40%), Positives = 123/205 (60%), Gaps = 31/205 (15%)

Query: 510 GHFRLVLQCILIYHPHAEKTYTAIRQSDSNRDVADIQDDWLLYDLKFSMDNLEILTLQEL 569
           GH+RLV+Q  L+  P  ++ YTAIRQS++   VAD+ DDWLLYD +FSM+NL++LTLQEL
Sbjct: 397 GHYRLVMQSSLLQDPETKEIYTAIRQSNNQPTVADVDDDWLLYDSQFSMNNLQMLTLQEL 456

Query: 570 LDFNRDYPKILFYTLVAINDNSSYIRTNKNISEINELTNNLKNLNCKPSGDDRNKKDNQK 629
           LD NR +PKI+FY+++ ++D            E+ + +N +                 QK
Sbjct: 457 LDMNRSFPKIIFYSMIVVSDEQ---------QELLQWSNGM----------------TQK 491

Query: 630 INTEFNTTRIHSNHLIDHSSSEDIPRQLYTTLSSDEEYGEIEYPEGLEMYEPSKIKSNTT 689
            +T   ++ I       ++S    P+Q Y  +  D+    +    G  MY P++++SNT+
Sbjct: 492 EDTADASSSI--PRADSYASMSRDPQQFYANMDDDDT--SLSEQSGPMMYAPTRLQSNTS 547

Query: 690 TIAHRSIRTVNSIGEWAF-HRTDTR 713
           T AHRSIRTVNSIG+WAF H+ +T+
Sbjct: 548 T-AHRSIRTVNSIGDWAFVHKNETK 571

 Score =  142 bits (358), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 93/137 (67%), Gaps = 4/137 (2%)

Query: 7   KPVQVXXXXXXXXXGLWSWYLSNIRNGMFEELTENILKITLLKRFLKENFQQDINSTSQH 66
           K ++V         GLWSWYLS+IR+G FEE + N LK+TLL+RFL  +F    +S   H
Sbjct: 3   KSIKVDDYFDNDDNGLWSWYLSHIRSGDFEEFSRNKLKVTLLRRFLNSHF----DSNRSH 58

Query: 67  STNCTKILFTSIPDNIHQDLPILENLLKDYFDLDNLDNIQILKLTQNRCYNHENHYILKD 126
               TKILF SIPD +H+DL +LEN L+DYF L++L++I+I KLTQ+  YNHENHYIL D
Sbjct: 59  YGQNTKILFVSIPDKVHRDLSLLENFLRDYFHLEHLEHIEITKLTQSPVYNHENHYILID 118

Query: 127 ILDNFGNTSFFIHDGTK 143
            L+NF + +F     T+
Sbjct: 119 KLNNFDDPTFLQFASTR 135

 Score = 33.9 bits (76), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 24/33 (72%)

Query: 805 MHPVERSKSTPVPYNVSSKDQKNTKSKSWREKM 837
           ++PVERSKSTP+P  + S    + +SK W++K+
Sbjct: 620 LNPVERSKSTPLPVILISFSNLDGESKHWKDKI 652

>Suva_13.156 Chr13 complement(246662..248980) [2319 bp, 772 aa] {ON}
           YML006C (REAL)
          Length = 772

 Score =  143 bits (361), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 121/337 (35%), Positives = 159/337 (47%), Gaps = 42/337 (12%)

Query: 510 GHFRLVLQCILIYHPHAEKTYTAIRQSDSNRDVADIQDDWLLYDLKFSMDNLEILTLQEL 569
           G+FRLVLQ ILI +P  ++ +TAIRQS++   VA + DDWLLYD  FSM+NL+ILTLQ+L
Sbjct: 446 GYFRLVLQSILIQNPDTKEIFTAIRQSNNEPTVASVTDDWLLYDSNFSMNNLQILTLQDL 505

Query: 570 LDFNRDYPKILFYTLVAINDNSSYIRTNKNISEINELTNNLKNLNCKPSGDDRNKKDNQK 629
           LD  R +PKIL YT+V        I TN    +I E   NL N   +       K  N +
Sbjct: 506 LDIKRSFPKILLYTMV--------IVTNSGQQQIEEENTNL-NQQHREVDLTEEKPPNSE 556

Query: 630 INTEFNTTRIHSNHLIDHSSSEDIPRQLYTTLSSDEEYGEIEYPEGLEMYEPSKIKSNTT 689
           ++   +  R   +   D               S  E+ G        +MY P+++ SN T
Sbjct: 557 LSLSNDPQRYFPSTFDDDYDEYIDDDDGGDDASLSEQSGP-------QMYLPTRMASNVT 609

Query: 690 TIAHRSIRTVNSIGEWAF--HRTDTRGTKDTKNISINSYVEPFSRSPSPFEYIISSHIKD 747
           T AHRSIRTVNSIGEWAF  H + T+  K + N S N  ++      SP E    + + +
Sbjct: 610 T-AHRSIRTVNSIGEWAFNRHNSVTKINKSSSNESDN--LKECGDRISPVEPYPMTQLSN 666

Query: 748 SXXXXXXXXXXXXXXXDYNTKYATQKSEISKLVLQPDNNQAGSNTLILDKIKNRKRQMHP 807
           S                Y     T K           NN++ S    L KIK     M  
Sbjct: 667 SNTVTSNFSHLLKNKNSYK---RTSKG----------NNESNSKNE-LKKIKTSINAMSA 712

Query: 808 VERSKSTPVPYNVSS-------KDQKNTKSKSWREKM 837
           VERSKS P+P  + S        D  N   K W+ KM
Sbjct: 713 VERSKSLPLPTLLKSLSGMDNHTDSNNKDRKRWKFKM 749

 Score =  137 bits (345), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 71/140 (50%), Positives = 92/140 (65%), Gaps = 3/140 (2%)

Query: 7   KPVQVXXXXXXXXXGLWSWYLSNIRNGMFEELTENILKITLLKRFLKENFQQDINSTSQH 66
           K V+V         GLWSWYL+N+R G FEEL  N LK TLLKRFL  +F  D N++ + 
Sbjct: 3   KSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNTSIRP 62

Query: 67  STNCTKILFTSIPDNIHQDLPILENLLKDYFDLDNLDNIQILKLTQNRCYNHENHYILKD 126
           +    KIL  SIP+N+H+D+ ILE  LKDYF L+ L++IQI KLT + CYNHENHY+L D
Sbjct: 63  NK---KILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTD 119

Query: 127 ILDNFGNTSFFIHDGTKQKI 146
            L+NF + SF     T  ++
Sbjct: 120 YLNNFQDPSFLEFASTSWQV 139

>Smik_13.145 Chr13 complement(244766..247090) [2325 bp, 774 aa] {ON}
           YML006C (REAL)
          Length = 774

 Score =  143 bits (360), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 120/347 (34%), Positives = 171/347 (49%), Gaps = 62/347 (17%)

Query: 510 GHFRLVLQCILIYHPHAEKTYTAIRQSDSNRDVADIQDDWLLYDLKFSMDNLEILTLQEL 569
           G+FRLVLQ ILI  P  ++ +TAIRQS++   +A + DDWLLYD  FSM+NL+ILTLQ+L
Sbjct: 450 GYFRLVLQSILIQDPDTKEIFTAIRQSNNRPTIASVTDDWLLYDSNFSMNNLQILTLQDL 509

Query: 570 LDFNRDYPKILFYTLVAINDNSSYIRTNKNISEINELTNNLKNLNCKPSGDDRNKKDNQK 629
           LD  R +PKILFYT+V + ++   I                KN N    G   +    Q 
Sbjct: 510 LDIKRSFPKILFYTMVIVTESGQQIEEEP------------KNPNY---GTREDMLKEQP 554

Query: 630 INTEFNTTRIHSNHLIDHSSSEDIPRQL------YTTLSSDEEYGEIEYPEGLEMYEPSK 683
           +N++          L+ H   +  P         Y     D++   +    G +MY P++
Sbjct: 555 LNSDL---------LLSHDPKQYFPNAYNNDYDEYIDDEDDDDDASLSEQSGPQMYIPTR 605

Query: 684 IKSNTTTIAHRSIRTVNSIGEWAFHRTDT-----RGTKDTKNISINSYVEPFSRSPSPFE 738
           ++SN TT AHRSIRTVNSIGEWAF+R ++     +   +  + S N+     S  P P  
Sbjct: 606 MESNVTT-AHRSIRTVNSIGEWAFNRHNSVTKINKSNSNESDDSENNDDRLSSDEPYPMT 664

Query: 739 YIISSHIKDSXXXXXXXXXXXXXXXDYNTKYATQKSEISKLVLQPDNNQAGSNTLILDKI 798
            I + +   S                 N  ++ +K   SK V    NN++ S +  L KI
Sbjct: 665 QISNFNTSSS-----------------NFSHSLKKKNTSK-VNSKINNESNSKSE-LKKI 705

Query: 799 KNRKRQMHPVERSKSTPVPY---NVSSKDQ----KNTKSKSWREKMD 838
           KN    M  VERSKS P+P    ++SS D      N   K W+ +M+
Sbjct: 706 KNSINAMSAVERSKSLPLPTLLKSLSSIDNNTHGTNKDRKRWKFQMN 752

 Score =  136 bits (343), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 91/140 (65%), Gaps = 3/140 (2%)

Query: 7   KPVQVXXXXXXXXXGLWSWYLSNIRNGMFEELTENILKITLLKRFLKENFQQDINSTSQH 66
           K V+V         GLWSWYL+N+R G FEEL  N LK TLLKRFL  +F  D NS S  
Sbjct: 3   KSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGD-NSISVR 61

Query: 67  STNCTKILFTSIPDNIHQDLPILENLLKDYFDLDNLDNIQILKLTQNRCYNHENHYILKD 126
           S    KIL  SIP+N+H+D+ ILE  LKDYF L+ L++IQI KLT + CYNHENHY+L D
Sbjct: 62  SNK--KILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTD 119

Query: 127 ILDNFGNTSFFIHDGTKQKI 146
            L+NF + +F     T  ++
Sbjct: 120 NLNNFQDPTFLEFASTSWQV 139

>KNAG0B03710 Chr2 complement(710003..712138) [2136 bp, 711 aa] {ON}
           Anc_5.526 YML006C
          Length = 711

 Score =  141 bits (356), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 72/131 (54%), Positives = 87/131 (66%), Gaps = 7/131 (5%)

Query: 7   KPVQVXXXXXXXXXGLWSWYLSNIRNGMFEELTENILKITLLKRFLKENFQQDINSTSQH 66
           K ++V         GLWSWYL NIR+G FEELT N LK TLLKRFLK +F      TS  
Sbjct: 3   KSIRVNDYYDNDDNGLWSWYLQNIRSGDFEELTHNELKYTLLKRFLKNHF------TSLE 56

Query: 67  STNCTKILFTSIPDNIHQDLPILENLLKDYFDLDNLDNIQILKLTQNRCYNHENHYILKD 126
             N +KILF SIPD +H D+ +LE  LKDYF L++L NI+I KLT + CYNHENHY+L D
Sbjct: 57  GIN-SKILFISIPDKVHSDISVLETFLKDYFHLEDLQNIKIQKLTTSNCYNHENHYLLTD 115

Query: 127 ILDNFGNTSFF 137
            L+NF +  F 
Sbjct: 116 TLNNFNDRKFL 126

 Score =  110 bits (275), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 76/232 (32%), Positives = 116/232 (50%), Gaps = 53/232 (22%)

Query: 510 GHFRLVLQCILIYHPHAEKTYTAIRQSDSNRDVADIQDDWLLYDLKFSMDNLEILTLQEL 569
           GHFRLVLQ +L+     +  +TAIRQS++  D A +QDDW+LYD  FSM+NL ++TL+ L
Sbjct: 472 GHFRLVLQSVLLQR-EDKAIFTAIRQSNNKVDRATVQDDWILYDSDFSMNNLMMMTLRGL 530

Query: 570 LDFNRDYPKILFYTLVAINDNSSYIRTNKNISEINELTNNLKNLNCKPSGDDRNKKDNQK 629
            +F+ +  KILFY+++ ++D               E  +++ +     SGD         
Sbjct: 531 FNFSENMSKILFYSMIIVDD--------------AETADDMLDEEATHSGD--------- 567

Query: 630 INTEFNTTRIHSNHLIDHSSSEDIPRQLYTTLSSDEEYGEIEYPEGLEMYEPSKIKSNTT 689
                               S+  P+ ++    SD     ++ P   +MY P K  S+ T
Sbjct: 568 -------------------VSDTQPQLMFDEEDSD---SGVQEP---QMYLPQKTASHAT 602

Query: 690 TIAHRSIRTVNSIGEWAF-HRTDTRGTKDTKNISI--NSYVEPFSRSPSPFE 738
           T AHRSIRTVNSIGEWA+  +++     D  ++    NS ++P    P   E
Sbjct: 603 T-AHRSIRTVNSIGEWAYKKKSNATSNHDAASVGSQGNSTLQPIISKPEHIE 653

>Skud_13.148 Chr13 complement(242351..244690) [2340 bp, 779 aa] {ON}
           YML006C (REAL)
          Length = 779

 Score =  141 bits (355), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 112/321 (34%), Positives = 160/321 (49%), Gaps = 58/321 (18%)

Query: 510 GHFRLVLQCILIYHPHAEKTYTAIRQSDSNRDVADIQDDWLLYDLKFSMDNLEILTLQEL 569
           G+FRLVLQ ILI  P  ++ +TAIRQS++   +A + DDWLLYD  FSM+NL+ILTLQ+L
Sbjct: 454 GYFRLVLQSILIQDPDTKEIFTAIRQSNNKPTMASVTDDWLLYDSNFSMNNLQILTLQDL 513

Query: 570 LDFNRDYPKILFYTLVAINDNSSYIRTNKNISEINELTNNLKNLNCKPSGDDRNKKDNQK 629
           LD  R +PKILFYT+V + D+      ++ I E ++            S   R   D  K
Sbjct: 514 LDIKRSFPKILFYTMVIVTDSG-----HQQIEEEHK------------SSSHRGTVDTSK 556

Query: 630 ---INTEFNTTRIHSNHLIDHSSSEDIPRQLYTTLSSDEEYGEIEYPEGLEMYEPSKIKS 686
              +N+E + +     +     ++ +I    YT    + +   +    G +MY P+++ S
Sbjct: 557 EEPLNSELSLSHDPQQYF---PTAYNIDYDEYTDDEDEGDDASLSEQSGPQMYLPTRMAS 613

Query: 687 NTTTIAHRSIRTVNSIGEWAFHR---------TDTRGTKDTK-NISINSYVEPFSRSPSP 736
           N TT AHRSIRTVNSIGEWAF+R         +D+    ++K  ++ NS  EP+     P
Sbjct: 614 NVTT-AHRSIRTVNSIGEWAFNRHNSVTKINKSDSNELDNSKEGVNRNSLGEPY-----P 667

Query: 737 FEYIISSHIKDSXXXXXXXXXXXXXXXDYNTKYATQKSEISKLVLQPDNNQAGSNTLILD 796
              + +S    S                 N  +  +K    KL  +  N     N   L 
Sbjct: 668 MAQLSNSSTTTS-----------------NFNHLLKKKNSYKLGSRDKNGSNSKNE--LK 708

Query: 797 KIKNRKRQMHPVERSKSTPVP 817
           KIK     M  VERSKS P+P
Sbjct: 709 KIKTSINAMSAVERSKSLPLP 729

 Score =  137 bits (346), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 93/140 (66%), Gaps = 3/140 (2%)

Query: 7   KPVQVXXXXXXXXXGLWSWYLSNIRNGMFEELTENILKITLLKRFLKENFQQDINSTSQH 66
           K V+V         GLWSWYL+N+R G FEEL  N LK TLLKRFL  +F  D N++++ 
Sbjct: 3   KSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDYNTSARP 62

Query: 67  STNCTKILFTSIPDNIHQDLPILENLLKDYFDLDNLDNIQILKLTQNRCYNHENHYILKD 126
           +    KIL  SIP+N+H+D+ ILE  LKDYF L+ L++IQI KLT + CYNHENHY+L D
Sbjct: 63  NK---KILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTD 119

Query: 127 ILDNFGNTSFFIHDGTKQKI 146
            L+NF + +F     T  ++
Sbjct: 120 NLNNFQDPTFLEFASTSWQV 139

>YML006C Chr13 complement(256092..258416) [2325 bp, 774 aa] {ON}
           GIS4CAAX box containing protein of unknown function,
           proposed to be involved in the RAS/cAMP signaling
           pathway
          Length = 774

 Score =  137 bits (346), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 112/328 (34%), Positives = 159/328 (48%), Gaps = 70/328 (21%)

Query: 510 GHFRLVLQCILIYHPHAEKTYTAIRQSDSNRDVADIQDDWLLYDLKFSMDNLEILTLQEL 569
           G+FRLVLQ ILI  P  ++ +TAIRQS++   +A + DDWLLYD  FSM+NL+ILTLQ+L
Sbjct: 447 GYFRLVLQSILIQDPDTKEIFTAIRQSNNKPTMASVTDDWLLYDSNFSMNNLQILTLQDL 506

Query: 570 LDFNRDYPKILFYTLVAINDNSSYIRTNKNISEINELTNNLKNLNCKPSGDDRNK-KDNQ 628
           LD  R +PKILFYT+V + +      + K + E  E  N        P+ D+R      Q
Sbjct: 507 LDIKRSFPKILFYTMVIVTN------SGKQVEE--EFKN--------PNYDNREGISKEQ 550

Query: 629 KINTEFNTTRIHSNHLIDHSSSEDIPRQLYTTL--------------SSDEEYGEIEYPE 674
            +++E + T              + P+Q + T                 D +   +    
Sbjct: 551 PLDSELSLT--------------NDPQQYFPTAYNNGYNDYIDDEDDEDDGDDASLSEQS 596

Query: 675 GLEMYEPSKIKSNTTTIAHRSIRTVNSIGEWAFHRTDTRGTKDTKNI-----SINSYVEP 729
           G +MY P++++SN TT AHRSIRTVNSIGEWAF+R ++    D  N      S       
Sbjct: 597 GPQMYIPTRMESNVTT-AHRSIRTVNSIGEWAFNRHNSVTKIDKSNSNELDNSKTGESTV 655

Query: 730 FSRSPSPFEYIISSHIKDSXXXXXXXXXXXXXXXDYNTKYATQKSEISKLVLQPDNNQAG 789
            S  P P   + +S+   S               +++    T+ S          NN++ 
Sbjct: 656 LSSEPHPMTQLSNSNTTSS---------------NFSHSLKTKNSHKPN---SKGNNESN 697

Query: 790 SNTLILDKIKNRKRQMHPVERSKSTPVP 817
           S    L KIK+    M  VERSKS P+P
Sbjct: 698 SKNE-LKKIKSSINAMSAVERSKSLPLP 724

 Score =  135 bits (341), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 92/140 (65%), Gaps = 3/140 (2%)

Query: 7   KPVQVXXXXXXXXXGLWSWYLSNIRNGMFEELTENILKITLLKRFLKENFQQDINSTSQH 66
           K V+V         GLWSWYL+N+R G FEEL  N LK TLLKRFL  +F  D N +++ 
Sbjct: 3   KSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNISARP 62

Query: 67  STNCTKILFTSIPDNIHQDLPILENLLKDYFDLDNLDNIQILKLTQNRCYNHENHYILKD 126
           +    KIL  SIP+N+H+D+ ILE  LKDYF L+ L++IQI KLT + CYNHENHY+L D
Sbjct: 63  NK---KILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTD 119

Query: 127 ILDNFGNTSFFIHDGTKQKI 146
            L+NF + +F     T  ++
Sbjct: 120 NLNNFQDPTFLEFASTSWQV 139

>KLTH0G03740g Chr7 (295985..297880) [1896 bp, 631 aa] {ON} similar
           to uniprot|Q04233 Saccharomyces cerevisiae YML006C GIS4
           CAAX box containing protein of unknown function proposed
           to be involved in the RAS/cAMP signaling pathway
          Length = 631

 Score =  134 bits (336), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 67/127 (52%), Positives = 85/127 (66%), Gaps = 7/127 (5%)

Query: 21  GLWSWYLSNIRNGMFEELTENILKITLLKRFLKENFQQDINSTSQHSTNCTKILFTSIPD 80
           GLWSWYL N+R+G FEEL  N LK  LL+RFL E    D    ++      K+L  SIPD
Sbjct: 18  GLWSWYLCNLRHGNFEELNNNQLKFALLRRFLNEQLLSDSVLFNK------KLLLVSIPD 71

Query: 81  NIHQDLPILENLLKDYFDLDNLDNIQILKLTQNRCYNHENHYILKDILDNFGNTSFFIHD 140
            IH++  +LEN L+DYF+LD+L  IQI KLTQ+RCYNHENHY++ D L NF + S F+  
Sbjct: 72  AIHENTNLLENFLRDYFNLDDLQFIQIQKLTQDRCYNHENHYLISDSLSNFNDKS-FLEF 130

Query: 141 GTKQKIP 147
           G K + P
Sbjct: 131 GAKSRRP 137

 Score =  121 bits (304), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 72/209 (34%), Positives = 120/209 (57%), Gaps = 19/209 (9%)

Query: 510 GHFRLVLQCILIYHPHAEKTYTAIRQSDSNRDVADIQDDWLLYDLKFSMDNLEILTLQEL 569
           G FRLVLQ IL++ P   + +TA+RQS+++  VA + DDWLLYD KFSM+NL+IL L ++
Sbjct: 331 GRFRLVLQSILVHQPDTRQLFTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILALHDV 390

Query: 570 LDFNRDYPKILFYTLVAINDNSSYIRTNKNISEINELTNNLKNLNCKPSGDDRNKKDNQ- 628
           L+ N+ +PKILFY+LV I++  +        ++  +   +  + + +P+  +    +N  
Sbjct: 391 LEMNKFFPKILFYSLVMISEEVA--------ADAQDYYPSKPSKSPQPTASNSTISENTL 442

Query: 629 KINTEFNTTRIHSNHLIDHSSSEDIPRQLYTTLSSDEEYGEIEY-------PEG--LEMY 679
           K+      +  ++N  +   +        Y+++  + E GE +         EG  + +Y
Sbjct: 443 KVQPTLTHSLTNTNSYLSTGAYNSSLSPFYSSVQHNHEQGEEDDYYDDDKNSEGVVVPLY 502

Query: 680 EPSKIKSNTTTIAHRSIRTVNSIGEWAFH 708
             ++  SN +T AHRSIRT+ SIG+WAFH
Sbjct: 503 SATRTNSNKST-AHRSIRTIKSIGDWAFH 530

>CAGL0K07271g Chr11 complement(712294..714624) [2331 bp, 776 aa]
           {ON} similar to uniprot|Q04233 Saccharomyces cerevisiae
           YML006c
          Length = 776

 Score =  131 bits (330), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 86/131 (65%)

Query: 7   KPVQVXXXXXXXXXGLWSWYLSNIRNGMFEELTENILKITLLKRFLKENFQQDINSTSQH 66
           K V+V         G+WSWYLSN+R+G FEE+ EN LK TLLKRFL  N   + +  S  
Sbjct: 3   KSVRVGDYYGNDENGVWSWYLSNLRSGDFEEIIENKLKYTLLKRFLNSNLLGNFSPESPT 62

Query: 67  STNCTKILFTSIPDNIHQDLPILENLLKDYFDLDNLDNIQILKLTQNRCYNHENHYILKD 126
                K++F SIP+++HQD+ ILE  L+DYF L  LDN QI KLTQ++ Y+HENHY L D
Sbjct: 63  RFINKKLIFVSIPEDVHQDISILELFLRDYFHLKVLDNNQIHKLTQDKVYHHENHYFLMD 122

Query: 127 ILDNFGNTSFF 137
            L+NF + +F 
Sbjct: 123 ELNNFEDPTFL 133

 Score =  114 bits (285), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 50/82 (60%), Positives = 65/82 (79%)

Query: 510 GHFRLVLQCILIYHPHAEKTYTAIRQSDSNRDVADIQDDWLLYDLKFSMDNLEILTLQEL 569
           G+FRLVLQ ILI  P  ++ +TA+RQS++   +ADI DDWLLYD +FSM NL+ILTLQ++
Sbjct: 465 GYFRLVLQSILIQDPQTKEVFTAVRQSNNKPTIADITDDWLLYDAEFSMHNLQILTLQDI 524

Query: 570 LDFNRDYPKILFYTLVAINDNS 591
           +   +DYPKILFYT+V IND S
Sbjct: 525 MTIKKDYPKILFYTMVVINDRS 546

 Score = 41.2 bits (95), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/39 (53%), Positives = 27/39 (69%), Gaps = 2/39 (5%)

Query: 676 LEMYEPSKIKSNTTTIAHRSIRTVNSIGEWAFHRTDTRG 714
            ++ +  + KSN TT  HRSIRTVNSIG+W+  R DT G
Sbjct: 609 FDLCQAERTKSNMTT-THRSIRTVNSIGDWSISR-DTTG 645

>Kwal_47.18646 s47 complement(909622..911529) [1908 bp, 635 aa] {ON}
           YML006C (GIS4) - CAAX box containing protein [contig
           191] FULL
          Length = 635

 Score =  127 bits (318), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 62/117 (52%), Positives = 78/117 (66%), Gaps = 6/117 (5%)

Query: 21  GLWSWYLSNIRNGMFEELTENILKITLLKRFLKENFQQDINSTSQHSTNCTKILFTSIPD 80
           GLWSWYL N+R+G FEEL  N LK  LL+RFL E    +    ++      K+L  SIPD
Sbjct: 18  GLWSWYLCNLRHGNFEELNNNQLKSALLRRFLNEQLMSETVPFNK------KLLLVSIPD 71

Query: 81  NIHQDLPILENLLKDYFDLDNLDNIQILKLTQNRCYNHENHYILKDILDNFGNTSFF 137
            IH++  +LEN L+DYF LD+L  IQI KLTQ +CYNHENHY++ D L NF + SF 
Sbjct: 72  AIHENTNLLENFLRDYFHLDDLQYIQIRKLTQEKCYNHENHYLICDNLSNFNDKSFL 128

 Score =  122 bits (306), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 82/219 (37%), Positives = 118/219 (53%), Gaps = 27/219 (12%)

Query: 510 GHFRLVLQCILIYHPHAEKTYTAIRQSDSNRDVADIQDDWLLYDLKFSMDNLEILTLQEL 569
           G FRLVLQ ILI      + YTA+RQS+++  VA + DDWLLYD KFSM+NL+IL L ++
Sbjct: 331 GRFRLVLQSILIQQTDTRQLYTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILALHDV 390

Query: 570 LDFNRDYPKILFYTLVAIND-----------NSSYIRTNKNISEINELTNNLK-NLNCKP 617
           L+ N+ +PK+LFY+L+ + D           ++S+    + +S      N LK      P
Sbjct: 391 LEINKFFPKVLFYSLIVVTDEVAIDAQEYYPSASHQSPERTVSTSLLSENTLKLQTTLTP 450

Query: 618 SGDDRNKKDNQKIN----TEFNTTRIHSNHLIDHSSSEDIPRQLYTTLSSDEEYGEIEYP 673
           S  + N   +  +N    T F  T   S    D ++ ED           DE  G+ +  
Sbjct: 451 SLTNTNSFLSMGVNSSSLTPFYATAQGSP---DRANDED-------DYFDDERDGKTDDG 500

Query: 674 EGLEMYEPSKIKSNTTTIAHRSIRTVNSIGEWAFHRTDT 712
           E  ++Y  ++  SN +T AHRSIRT+ SIG+WAFH   T
Sbjct: 501 EVFQLYSATRTNSNKST-AHRSIRTIKSIGDWAFHHDST 538

>KLLA0A01782g Chr1 complement(157216..158802) [1587 bp, 528 aa] {ON}
           some similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 528

 Score =  121 bits (303), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 81/133 (60%), Gaps = 8/133 (6%)

Query: 6   PKPVQVXXXXXXXXXGLWSWYLSNIRNGMFEELTENILKITLLKRFLKENFQQDINSTSQ 65
           P  VQV         GLWSWYLSN+RNG FEELT N LK  LLKRFL++ FQ      + 
Sbjct: 2   PTSVQVKDYYENDYNGLWSWYLSNLRNGEFEELTGNELKHGLLKRFLRDQFQ------AT 55

Query: 66  HSTNCTKILFTSIPDNIHQDLPILENLLKDYFDL-DNLDNIQILKLTQNRCYNHENHYIL 124
              N  K+L  SIPD IHQD+ +LE  L +YF L D+  NI I KLT+   Y HENHY++
Sbjct: 56  GPLN-KKLLLVSIPDEIHQDIKVLEEFLSEYFHLKDDHTNIVIDKLTRGTVYKHENHYLI 114

Query: 125 KDILDNFGNTSFF 137
           +D L NF +  F 
Sbjct: 115 QDKLTNFNDEWFL 127

 Score =  118 bits (296), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 76/212 (35%), Positives = 115/212 (54%), Gaps = 36/212 (16%)

Query: 510 GHFRLVLQCILIYHPHAEKTYTAIRQSDSNRDVADIQDDWLLYDLKFSMDNLEILTLQEL 569
           G FRLVLQ ILI +   E+ +T IRQS+++R  ADI DDWLLYD  F++ NL++L+L ++
Sbjct: 287 GTFRLVLQSILITNKETEQIFTGIRQSENDRSNADINDDWLLYDTDFNLGNLQMLSLYDI 346

Query: 570 LDFNRDYPKILFYTLVAINDNSSYIRTNKNISEINELTNNLKNLNCKPSGDDRNKKDNQK 629
           LDF++  PKILFY+++ + D+   +  N  +S  + +T                      
Sbjct: 347 LDFSKFLPKILFYSMIHVKDS---VDDNTELSLQHLIT---------------------- 381

Query: 630 INTEFNTTRIHSNHLIDHSSSE---DIPRQLYTTLSSDEEYGEIEYPEGLEMYEPSKIKS 686
           +N       ++S H +D S SE   D   + YT  S+D     I     + +Y P    +
Sbjct: 382 VNNTLTNGNMYSPHEVDDSMSELSSDNSIECYTGNSND----SIADEPVIGLYSP----A 433

Query: 687 NTTTIAHRSIRTVNSIGEWAFHRTDTRGTKDT 718
              T  HRSIRTV SIG WA +R++T+ + +T
Sbjct: 434 TAATAGHRSIRTVESIGAWALNRSNTKKSMET 465

>ZYRO0D12540g Chr4 (1059795..1061441) [1647 bp, 548 aa] {ON} some
           similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 548

 Score =  121 bits (303), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 83/131 (63%), Gaps = 8/131 (6%)

Query: 7   KPVQVXXXXXXXXXGLWSWYLSNIRNGMFEELTENILKITLLKRFLKENFQQDINSTSQH 66
           K V+V         GLWSWYL+NIRNG FEELT N LK +L KRFL+   +  +N     
Sbjct: 3   KSVRVGDYFSNDDNGLWSWYLTNIRNGDFEELTRNQLKHSLFKRFLRTYLEPTLNERKD- 61

Query: 67  STNCTKILFTSIPDNIHQDLPILENLLKDYFDLDNLDNIQILKLTQNRCYNHENHYILKD 126
               TK+L  SIP+++ +D+ +LE  L DY    NLDN++I KLT +R YNHENHY++ D
Sbjct: 62  ----TKVLIVSIPEDVRRDITLLEYFLGDYL---NLDNMEITKLTTSRIYNHENHYVVMD 114

Query: 127 ILDNFGNTSFF 137
             +NF N++F 
Sbjct: 115 KENNFKNSNFL 125

 Score =  100 bits (250), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 99/196 (50%), Gaps = 40/196 (20%)

Query: 510 GHFRLVLQCILIYHPHAEKTYTAIRQSDSNRDVADIQDDWLLYDLKFSMDNLEILTLQEL 569
           GHFRLVLQ +L  +P + + +TAIRQS++    AD+ DDWLLYD +FSM NL++LTLQ+L
Sbjct: 309 GHFRLVLQSVLFINPTSNEIFTAIRQSNNKPTKADVDDDWLLYDSQFSMHNLQMLTLQDL 368

Query: 570 LDFNRDYPKILFYTLVAINDNSSYIRTNKNISEINELTNNLKNLNCKPSGDDRNKKDNQK 629
            + N+  PK+LFY+LV + D                           PS +D + +    
Sbjct: 369 SELNKGCPKVLFYSLVEVVDT--------------------------PSLEDADTECATI 402

Query: 630 INTEFNTTRIHSNHLIDHSSSEDIPRQLYTTLSSDEEYGEIEYPEGLEMYEPSKIKSNTT 689
            NT   +T + S       S E  PR  + +  + +  G             +K  +N++
Sbjct: 403 SNTA--STSLSSAPTSTSVSCE--PRVFFPSNVNGDNSG----------CRLAKGNTNSS 448

Query: 690 TIAHRSIRTVNSIGEW 705
           T+ HRSI T NS  +W
Sbjct: 449 TLGHRSIVTTNSAADW 464

>KAFR0C05390 Chr3 (1080797..1082164) [1368 bp, 455 aa] {ON}
           Anc_5.526 YML006C
          Length = 455

 Score =  119 bits (298), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 85/132 (64%), Gaps = 8/132 (6%)

Query: 6   PKPVQVXXXXXXXXXGLWSWYLSNIRNGMFEELTENILKITLLKRFLKENFQQDINSTSQ 65
           P  VQ+         GLWSWYL+N+R+G FEEL  N LK +LLKRFL+   Q DIN   +
Sbjct: 2   PNSVQIHDYFDNDENGLWSWYLTNLRSGNFEELINNKLKDSLLKRFLRN--QVDINDQIK 59

Query: 66  HSTNCTKILFTSIPDNIHQDLPILENLLKDYFDLDNLDNIQILKLTQNRCYNHENHYILK 125
                 KIL  SIPD+I  D+ +LE  L DYF L++L NI+I+KLT+   YNHENHY+L 
Sbjct: 60  ------KILLISIPDHIFSDINVLEIFLSDYFHLNDLSNIKIIKLTKFNVYNHENHYLLI 113

Query: 126 DILDNFGNTSFF 137
           D ++NF + +F 
Sbjct: 114 DSVNNFKDETFL 125

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 40/84 (47%), Positives = 58/84 (69%), Gaps = 1/84 (1%)

Query: 510 GHFRLVLQCILIYHPHAEKTYTAIRQSDSNRDVADIQDDWLLYDLKFSMDNLEILTLQEL 569
           GH+RLVLQ +LI +       T +RQS++  + A+I DDW+LYD KFSM NL IL+L++L
Sbjct: 264 GHYRLVLQSMLICNKENLDLQTGVRQSNNLINYANINDDWMLYDEKFSMRNLNILSLKDL 323

Query: 570 -LDFNRDYPKILFYTLVAINDNSS 592
            +  N D  KILFY+++ +N+  S
Sbjct: 324 SIIGNVDSIKILFYSMIDVNNQRS 347

>Kpol_1023.99 s1023 complement(232194..233849) [1656 bp, 551 aa]
           {ON} complement(232194..233849) [1656 nt, 552 aa]
          Length = 551

 Score =  112 bits (279), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 81/210 (38%), Positives = 108/210 (51%), Gaps = 53/210 (25%)

Query: 510 GHFRLVLQCILIYHPHAEKTYTAIRQSDSNRDVADIQDDWLLYDLKFSMDNLEILTLQEL 569
            +F+LVLQ ILIY+  +++  TAIRQS++ +D ADI DDWLLYD KFSM NL+IL+L EL
Sbjct: 258 ANFQLVLQSILIYNSDSDELITAIRQSNNEQDSADIDDDWLLYDSKFSMTNLQILSLNEL 317

Query: 570 LDFNRDYPKILFYTLVAINDNSSYIRTNKNISEINELTNNLKNLNCKPSGDDRNKKDNQK 629
           L  N+DYPKILFY+LV+I +         NIS     +N        P  +D        
Sbjct: 318 LHINKDYPKILFYSLVSIPN------VTVNISNYENSSN--------PHLED-------- 355

Query: 630 INTEFNTTRIHSNHLIDHSSSEDIPRQLY-----------------TTLSSDEEYGEIEY 672
                     + NH  D  S  D P+Q Y                  T  S  +Y +   
Sbjct: 356 ----------YINHSDDSLSIHDTPQQFYPMIVNDNNNNININNHNNTRRSSVDYYDDSI 405

Query: 673 PEGL---EMYEPSKIKSNTTTIAHRSIRTV 699
           P+     +M  P+K+ +N TTIAHRS RT+
Sbjct: 406 PQQFYPDDMNIPTKVNTN-TTIAHRSYRTI 434

 Score = 35.8 bits (81), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 22 LWSWYLSNIRNGMFEELTENILKITLLKRFL 52
          +W+WYL ++RNG FEE+  N     LLK  L
Sbjct: 15 VWTWYLCHVRNGSFEEILGNEDYYKLLKNNL 45

>Ecym_4061 Chr4 (133342..135333) [1992 bp, 663 aa] {ON} similar to
           Ashbya gossypii ADR198C
          Length = 663

 Score = 97.4 bits (241), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 71/96 (73%)

Query: 510 GHFRLVLQCILIYHPHAEKTYTAIRQSDSNRDVADIQDDWLLYDLKFSMDNLEILTLQEL 569
           G FR+VLQ ILIY+   ++  TA+RQS+++  VADI DDWLLYD +FSM+N+++++L ++
Sbjct: 339 GDFRIVLQSILIYNTTLDQLLTAVRQSNNDTTVADINDDWLLYDERFSMNNIQMVSLIDI 398

Query: 570 LDFNRDYPKILFYTLVAINDNSSYIRTNKNISEINE 605
            + N  +PKILFY++VAI  N++  +   + +EI +
Sbjct: 399 FEMNGVFPKILFYSVVAIPCNNTASKEANSCAEIGK 434

 Score = 77.0 bits (188), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 63/108 (58%), Gaps = 9/108 (8%)

Query: 21  GLWSWYLSNIRNGMFEELTENILKITLLKRFLKENFQQDINSTSQHSTNCTKILFTSIPD 80
           GLWSWYL N+R G FEEL+ +I+K  L+KR +KE     +++++       ++L  S+PD
Sbjct: 14  GLWSWYLHNLRCGEFEELSSDIVKCRLMKRLVKEYSGGTMSASN-------RVLLVSVPD 66

Query: 81  NIHQDLPILENLLKDYF-DLDNLDNIQILKLTQNR-CYNHENHYILKD 126
           +I Q   ILE  L+     +  + +  I KLT  +   N E+HY++ D
Sbjct: 67  DIRQGASILEEFLRSSLPGMREVRDGNITKLTGRKDLLNGEDHYLIND 114

>TPHA0K00540 Chr11 complement(107389..109416) [2028 bp, 675 aa] {ON}
           Anc_5.526 YML006C
          Length = 675

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 40/79 (50%), Positives = 57/79 (72%)

Query: 510 GHFRLVLQCILIYHPHAEKTYTAIRQSDSNRDVADIQDDWLLYDLKFSMDNLEILTLQEL 569
           G F+LVLQ +++ +  + +++TA+RQS+S    A   D+WLLYD KFSMDNLEI+TL  L
Sbjct: 337 GEFKLVLQSMILINFESGESFTAVRQSNSLIHEATEDDEWLLYDSKFSMDNLEIVTLNYL 396

Query: 570 LDFNRDYPKILFYTLVAIN 588
           +D   D+ KI FY++V IN
Sbjct: 397 MDIYADFVKIFFYSMVIIN 415

 Score = 48.5 bits (114), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 59/126 (46%), Gaps = 10/126 (7%)

Query: 21  GLWSWYLSNIRNGMFEELTENILKITLLKRFLKENFQQDINSTSQHSTNC----TKILFT 76
            LW+WYL+ IRNG FEEL +   K   +   ++E  Q    +      +       ILF 
Sbjct: 14  SLWTWYLNCIRNGEFEELLKEEDKYRSILNKIRETLQTHARNIEMEEEDANISDGNILFL 73

Query: 77  SIPDNIHQDLPILENLLKDYFDLDNLDNIQILKLTQNRC------YNHENHYILKDILDN 130
           S+   + +D  I+++ L D F   +L NI I ++  N         +HE +Y++ D L+ 
Sbjct: 74  SLHYTLDKDKEIIDDFLVDNFPNVDLSNIVIREICNNNINSEHFKKDHETYYMVIDSLNK 133

Query: 131 FGNTSF 136
              TS 
Sbjct: 134 LLTTSI 139

>NCAS0F01080 Chr6 (214243..215382) [1140 bp, 379 aa] {ON} Anc_5.526
           YML006C
          Length = 379

 Score = 75.9 bits (185), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 36/79 (45%), Positives = 54/79 (68%)

Query: 510 GHFRLVLQCILIYHPHAEKTYTAIRQSDSNRDVADIQDDWLLYDLKFSMDNLEILTLQEL 569
           G  R VL  +LI +  +++T+TAIRQ  S+ + A+I D+WLLYD KFS+DNLE+ TLQ++
Sbjct: 300 GQLRFVLHSLLIQNAQSKETFTAIRQRSSDPNTANILDEWLLYDSKFSLDNLEMGTLQDI 359

Query: 570 LDFNRDYPKILFYTLVAIN 588
           L  N+    +L Y  + I+
Sbjct: 360 LLSNKGNSMLLLYKTILIS 378

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 55/115 (47%), Gaps = 8/115 (6%)

Query: 22  LWSWYLSNIRNGMFEELTENILKITLLKRFLKENFQQDINSTSQHSTNCTKILFTSIPDN 81
           +WSWYLSN+++G FE L    ++   L+ + K  F              +K +  S+P  
Sbjct: 16  MWSWYLSNLQSGNFEALVNGSVRQQHLEAYFKSQFTS--------GNEGSKKILLSVPSM 67

Query: 82  IHQDLPILENLLKDYFDLDNLDNIQILKLTQNRCYNHENHYILKDILDNFGNTSF 136
           + Q++ I    L   F+ + L  I +++ +++     + HY+L D L  F   +F
Sbjct: 68  LCQEVSIKRLFLGSIFNEERLQYINVMEFSKSPKQTEKKHYLLTDALSGFNEAAF 122

>NDAI0H01590 Chr8 (385963..387078) [1116 bp, 371 aa] {ON} 
          Length = 371

 Score = 75.9 bits (185), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 52/79 (65%)

Query: 510 GHFRLVLQCILIYHPHAEKTYTAIRQSDSNRDVADIQDDWLLYDLKFSMDNLEILTLQEL 569
           G  R VLQ I+       +  TAIRQS ++R VA   D+WLLYD  FS++NLEI TLQ++
Sbjct: 293 GQIRFVLQSIVFKSVRTAELLTAIRQSSADRIVATSSDEWLLYDSDFSLNNLEISTLQDI 352

Query: 570 LDFNRDYPKILFYTLVAIN 588
           L  N + P+ILFYT+  ++
Sbjct: 353 LYPNYENPRILFYTMSVVS 371

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 59/114 (51%), Gaps = 14/114 (12%)

Query: 22  LWSWYLSNIRNGMFEELTENILKI----TLLKRFLKENFQQDINSTSQHSTNCTKILFTS 77
           + SWYL N+R G FE + E+  K     T+L R L +N Q         +TN  KIL ++
Sbjct: 13  VLSWYLRNLREGRFENIIEDRAKNYHLNTILDRQLFDNKQYG-------ATN--KILVST 63

Query: 78  IPDNIHQDLPILENLLKDYFDLDNLDNIQILKLTQNRCYNHENHYILKDILDNF 131
           +  +I + + I +  L   FD + L  I++ +L   +  N E HY L D L++F
Sbjct: 64  LT-SIDEIVSIKDIFLGQLFDHERLQYIEVEELKSLKGDNKETHYFLTDHLNSF 116

>ADR198C Chr4 complement(1046482..1048131) [1650 bp, 549 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML006C
           (GIS4)
          Length = 549

 Score = 73.9 bits (180), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 56/80 (70%)

Query: 512 FRLVLQCILIYHPHAEKTYTAIRQSDSNRDVADIQDDWLLYDLKFSMDNLEILTLQELLD 571
           FR+VLQ IL+Y    ++  TA+RQ ++N ++A+  DD LLYD K S+    IL+L +L++
Sbjct: 249 FRVVLQSILVYDCEKDRINTAVRQYNNNPNIANCSDDCLLYDNKISLITFRILSLVDLME 308

Query: 572 FNRDYPKILFYTLVAINDNS 591
            NR +PK+LFY++  I ++S
Sbjct: 309 LNRAHPKMLFYSVAEIFNSS 328

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 41/74 (55%), Gaps = 7/74 (9%)

Query: 21 GLWSWYLSNIRNGMFEELTENILKITLLKRFLKENFQQDINSTSQHSTNCTKILFTSIPD 80
          GLWSWYL N+R G FE+L  +  + + LK FL++ F    +ST Q      ++   S P 
Sbjct: 7  GLWSWYLGNLRKGRFEQLVGDEARYSQLKAFLRDCFA---HSTGQER----RLQLLSFPA 59

Query: 81 NIHQDLPILENLLK 94
          ++  D  ILE  ++
Sbjct: 60 SVPCDYKILEEFIR 73

>KNAG0C03240 Chr3 complement(634593..635567) [975 bp, 324 aa] {ON}
          
          Length = 324

 Score = 35.0 bits (79), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 20/35 (57%)

Query: 22 LWSWYLSNIRNGMFEELTENILKITLLKRFLKENF 56
           W WY+ N+  G FEEL +N++K   L  FL   F
Sbjct: 20 FWFWYIDNLVAGNFEELNDNLIKRNQLCSFLAHYF 54

 Score = 31.6 bits (70), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 8/43 (18%)

Query: 528 KTYTAIRQSDSNRDVADIQDDWLLYDLKFSMDNLEILTLQELL 570
           K + A+RQ           DDW++YD  FS++NLE   L+++L
Sbjct: 273 KLWHAVRQLQD--------DDWVIYDADFSLNNLENCKLEDIL 307

>TBLA0G00940 Chr7 complement(228909..231257) [2349 bp, 782 aa] {ON} 
          Length = 782

 Score = 35.0 bits (79), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 17/73 (23%), Positives = 38/73 (52%), Gaps = 8/73 (10%)

Query: 513 RLVLQCILIYHPHAEKT--YTAIRQSDSNRDVADIQDDWLLYDLKFSMDNLEILTLQELL 570
           R+ L CI++          +TAI++ +      ++   WL++D  F  +  ++++  +LL
Sbjct: 564 RMNLNCIILKKIGNTNGDFFTAIKEYN------ELYSKWLIFDSTFQTEKSQLVSFDKLL 617

Query: 571 DFNRDYPKILFYT 583
           +  + + KI FY+
Sbjct: 618 EIAKSFSKIFFYS 630

>Skud_13.324 Chr13 complement(551961..556922) [4962 bp, 1653 aa] {ON}
            YMR162C (REAL)
          Length = 1653

 Score = 33.5 bits (75), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 40/84 (47%), Gaps = 2/84 (2%)

Query: 204  KSNSITQENSKTNFLKLSQPAIDPLSLSYGPSNPSSFQGNSLLSLRDEAKNCCNNDEQQN 263
            K N+++QE    N +      ID  +LS    NP+     + L  + ++  CC     Q 
Sbjct: 1149 KMNAVSQEVDSGN-IAHCVIVIDGATLSMFEGNPTYMSVFTELCTKTDSVLCCRASPSQK 1207

Query: 264  GIVVAESFLNKDPNIETVDDFDGS 287
             ++V+ +  N DPN+ T+   DG+
Sbjct: 1208 ALMVS-NIRNTDPNLVTLAVGDGA 1230

>KNAG0B05220 Chr2 (1002065..1004788) [2724 bp, 907 aa] {ON}
           Anc_1.294 YJL076W
          Length = 907

 Score = 32.7 bits (73), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 40/79 (50%), Gaps = 4/79 (5%)

Query: 52  LKENFQQDINSTSQHSTNCTKILFTSIPDNIHQDLP--ILENLLKDYFDLDNLDNIQILK 109
           L  N +  + + +Q      K L  + P+N   +L   I++ L K Y D+D  D+ QI  
Sbjct: 61  LNSNVRNLLYARTQFEKCVKKFLVLTSPNNTLYELSNIIMDKLDKMYRDMD--DDFQICT 118

Query: 110 LTQNRCYNHENHYILKDIL 128
           L  N+C + +  +I+KD+ 
Sbjct: 119 LQDNKCNDLDPDFIIKDVF 137

>AAL146W Chr1 (92509..98211) [5703 bp, 1900 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR184C (UBR1)
          Length = 1900

 Score = 32.0 bits (71), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 46/110 (41%), Gaps = 12/110 (10%)

Query: 639 IHSNHLIDHSSSEDIPRQLYTTLSSDEEYGEIEYPEGLEMYEPSKIKSNTTTIAHRSIRT 698
           IH N L     ++D+PR +Y  L   E  G   +  G E YE +  +   T I  + I  
Sbjct: 814 IHLNQLAFLKENDDLPRVIYNLLDRWELLG---WFTGAEQYETTVYEERITNIIQQFIAF 870

Query: 699 VNSI-GEWAFHR----TDTRGTKDTKNISINSYVEPFSRSPSPFEYIISS 743
           V  I  E  F R    +  R T   KNI I S +      P P+  ++ S
Sbjct: 871 VYHILSERHFFRYFGSSAERETHTMKNIIIYSLL----MKPLPYSELLKS 916

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.130    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 93,185,662
Number of extensions: 4536733
Number of successful extensions: 21172
Number of sequences better than 10.0: 204
Number of HSP's gapped: 21796
Number of HSP's successfully gapped: 246
Length of query: 866
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 748
Effective length of database: 39,950,811
Effective search space: 29883206628
Effective search space used: 29883206628
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 70 (31.6 bits)