Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0D016505.527ON1016101640530.0
NCAS0F010905.527ON7873587172e-80
NDAI0H016005.527ON8423587174e-80
ZYRO0D12562g5.527ON8183877006e-78
Skud_4.6965.527ON8113196821e-75
SAKL0G04928g5.527ON8923756791e-74
Suva_2.5995.527ON8273676691e-73
TDEL0A039105.527ON7493756642e-73
CAGL0F03047g5.527ON7444026623e-73
Smik_4.6975.527ON8173256557e-72
ADR194C5.527ON6373586449e-72
Kwal_47.186425.527ON3093176161e-71
YDR422C (SIP1)5.527ON8153676504e-71
KLTH0G03762g5.527ON7093596191e-67
Ecym_40655.527ON7213265732e-61
KNAG0C032305.527ON5613705234e-56
Kpol_1004.215.527ON7553835273e-55
KAFR0E033005.527ON4663474901e-52
Kpol_1023.985.527ON6673584453e-45
TPHA0K005305.527ON6463142995e-27
TBLA0I032703.517ON433581414e-08
Kwal_47.190403.517ON429581396e-08
Ecym_12103.517ON450421361e-07
KLLA0B00583g3.517ON486411362e-07
CAGL0A03696g3.517ON415471352e-07
KAFR0I023803.517ON409421333e-07
KNAG0E015903.517ON423421333e-07
Smik_5.1503.517ON417461333e-07
Kpol_195.23.517ON435421334e-07
Suva_5.1233.517ON423461324e-07
Skud_5.1363.517ON418461325e-07
TPHA0A058103.517ON424411315e-07
YER027C (GAL83)3.517ON417461316e-07
SAKL0F02002g3.517ON503411317e-07
NCAS0E006203.517ON500561309e-07
NDAI0B060103.517ON503401291e-06
NCAS0F037303.517ON432401281e-06
AER361C3.517ON475421281e-06
TDEL0D058503.517ON404421262e-06
ZYRO0E08404g3.517ON348571252e-06
Suva_7.533.517ON414561262e-06
YGL208W (SIP2)3.517ON415401235e-06
Smik_7.553.517ON415401235e-06
KLTH0G01848g3.517ON416541235e-06
Skud_7.603.517ON441401236e-06
KNAG0B006003.517ON389401226e-06
NDAI0I028903.517ON582401228e-06
KNAG0B036905.527ON326671181e-05
KAFR0F041403.517ON348451182e-05
CAGL0K09350g3.517ON432401182e-05
CAGL0L03652g1.264ON80738726.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0D01650
         (1016 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0D01650 Chr4 (406397..409447) [3051 bp, 1016 aa] {ON} Anc_5....  1565   0.0  
NCAS0F01090 Chr6 complement(215542..217905) [2364 bp, 787 aa] {O...   280   2e-80
NDAI0H01600 Chr8 complement(387297..389825) [2529 bp, 842 aa] {O...   280   4e-80
ZYRO0D12562g Chr4 complement(1061702..1064158) [2457 bp, 818 aa]...   274   6e-78
Skud_4.696 Chr4 complement(1236293..1238728) [2436 bp, 811 aa] {...   267   1e-75
SAKL0G04928g Chr7 complement(405798..408476) [2679 bp, 892 aa] {...   266   1e-74
Suva_2.599 Chr2 complement(1068063..1070546) [2484 bp, 827 aa] {...   262   1e-73
TDEL0A03910 Chr1 complement(701073..703322) [2250 bp, 749 aa] {O...   260   2e-73
CAGL0F03047g Chr6 complement(298906..301140) [2235 bp, 744 aa] {...   259   3e-73
Smik_4.697 Chr4 complement(1236081..1238534) [2454 bp, 817 aa] {...   256   7e-72
ADR194C Chr4 complement(1039625..1041538) [1914 bp, 637 aa] {ON}...   252   9e-72
Kwal_47.18642 s47 (908641..909570) [930 bp, 309 aa] {ON} YDR422C...   241   1e-71
YDR422C Chr4 complement(1315326..1317773) [2448 bp, 815 aa] {ON}...   254   4e-71
KLTH0G03762g Chr7 complement(297935..300064) [2130 bp, 709 aa] {...   243   1e-67
Ecym_4065 Chr4 (144003..146168) [2166 bp, 721 aa] {ON} similar t...   225   2e-61
KNAG0C03230 Chr3 (632659..634344) [1686 bp, 561 aa] {ON} Anc_5.5...   206   4e-56
Kpol_1004.21 s1004 complement(41725..43992) [2268 bp, 755 aa] {O...   207   3e-55
KAFR0E03300 Chr5 (654349..655749) [1401 bp, 466 aa] {ON} Anc_5.5...   193   1e-52
Kpol_1023.98 s1023 (229891..231894) [2004 bp, 667 aa] {ON} (2298...   176   3e-45
TPHA0K00530 Chr11 (105141..107081) [1941 bp, 646 aa] {ON} Anc_5....   119   5e-27
TBLA0I03270 Chr9 complement(793849..795150) [1302 bp, 433 aa] {O...    59   4e-08
Kwal_47.19040 s47 complement(1073036..1074325) [1290 bp, 429 aa]...    58   6e-08
Ecym_1210 Chr1 (423627..424979) [1353 bp, 450 aa] {ON} similar t...    57   1e-07
KLLA0B00583g Chr2 complement(44819..46279) [1461 bp, 486 aa] {ON...    57   2e-07
CAGL0A03696g Chr1 (377255..378502) [1248 bp, 415 aa] {ON} simila...    57   2e-07
KAFR0I02380 Chr9 (482219..483448) [1230 bp, 409 aa] {ON} Anc_3.5...    56   3e-07
KNAG0E01590 Chr5 complement(317054..318325) [1272 bp, 423 aa] {O...    56   3e-07
Smik_5.150 Chr5 complement(213879..215132) [1254 bp, 417 aa] {ON...    56   3e-07
Kpol_195.2 s195 complement(4330..5637) [1308 bp, 435 aa] {ON} co...    56   4e-07
Suva_5.123 Chr5 complement(184865..186136) [1272 bp, 423 aa] {ON...    55   4e-07
Skud_5.136 Chr5 complement(206871..208127) [1257 bp, 418 aa] {ON...    55   5e-07
TPHA0A05810 Chr1 complement(1317530..1318804) [1275 bp, 424 aa] ...    55   5e-07
YER027C Chr5 complement(208979..210232) [1254 bp, 417 aa] {ON}  ...    55   6e-07
SAKL0F02002g Chr6 (167591..169102) [1512 bp, 503 aa] {ON} simila...    55   7e-07
NCAS0E00620 Chr5 (106661..108163) [1503 bp, 500 aa] {ON} Anc_3.517     55   9e-07
NDAI0B06010 Chr2 complement(1460221..1461732) [1512 bp, 503 aa] ...    54   1e-06
NCAS0F03730 Chr6 complement(750798..752096) [1299 bp, 432 aa] {O...    54   1e-06
AER361C Chr5 complement(1307677..1309104) [1428 bp, 475 aa] {ON}...    54   1e-06
TDEL0D05850 Chr4 complement(1062927..1064141) [1215 bp, 404 aa] ...    53   2e-06
ZYRO0E08404g Chr5 complement(672301..673347) [1047 bp, 348 aa] {...    53   2e-06
Suva_7.53 Chr7 (93895..95139) [1245 bp, 414 aa] {ON} YGL208W (REAL)    53   2e-06
YGL208W Chr7 (97338..98585) [1248 bp, 415 aa] {ON}  SIP2One of t...    52   5e-06
Smik_7.55 Chr7 (92235..93482) [1248 bp, 415 aa] {ON} YGL208W (REAL)    52   5e-06
KLTH0G01848g Chr7 (136780..138030) [1251 bp, 416 aa] {ON} simila...    52   5e-06
Skud_7.60 Chr7 (102699..104024) [1326 bp, 441 aa] {ON} YGL208W (...    52   6e-06
KNAG0B00600 Chr2 (97910..99079) [1170 bp, 389 aa] {ON} Anc_3.517...    52   6e-06
NDAI0I02890 Chr9 complement(682274..684022) [1749 bp, 582 aa] {O...    52   8e-06
KNAG0B03690 Chr2 (708946..709926) [981 bp, 326 aa] {ON} Anc_5.52...    50   1e-05
KAFR0F04140 Chr6 complement(814903..815949) [1047 bp, 348 aa] {O...    50   2e-05
CAGL0K09350g Chr11 complement(922651..923949) [1299 bp, 432 aa] ...    50   2e-05
CAGL0L03652g Chr12 complement(419874..422297) [2424 bp, 807 aa] ...    32   6.8  

>TBLA0D01650 Chr4 (406397..409447) [3051 bp, 1016 aa] {ON} Anc_5.527
            YDR422C
          Length = 1016

 Score = 1565 bits (4053), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 811/1016 (79%), Positives = 811/1016 (79%)

Query: 1    MGNNPSILDXXXXXXXXXXXXXXXXXXXXXXXXXXXRNDSITSTLFPXXXXXXXQKYLTK 60
            MGNNPSILD                           RNDSITSTLFP       QKYLTK
Sbjct: 1    MGNNPSILDSETNESTNRNINNNSNNNNNSSTLIIERNDSITSTLFPSRSSSSRQKYLTK 60

Query: 61   NQGENPNNVSLFKQNYSLTQNNETYEPILKPLSSPENDTNITYNNSTFNNSRASKNSXXX 120
            NQGENPNNVSLFKQNYSLTQNNETYEPILKPLSSPENDTNITYNNSTFNNSRASKNS   
Sbjct: 61   NQGENPNNVSLFKQNYSLTQNNETYEPILKPLSSPENDTNITYNNSTFNNSRASKNSDQD 120

Query: 121  XXXXXXXXXXXXXXXLLILSPGPSHPTVEQSKQQANYNEDQEMFKNGITQTKNSSSYRXX 180
                           LLILSPGPSHPTVEQSKQQANYNEDQEMFKNGITQTKNSSSYR  
Sbjct: 121  IIRNDNDPINNQQQPLLILSPGPSHPTVEQSKQQANYNEDQEMFKNGITQTKNSSSYRNT 180

Query: 181  XXXXXXXXXXXXXXXXXXYASSHRPSVVALKKSLEETLDFTTNDPRQIYXXXXXXXXXXX 240
                              YASSHRPSVVALKKSLEETLDFTTNDPRQIY           
Sbjct: 181  SPNIPSNTNNIINMNSHNYASSHRPSVVALKKSLEETLDFTTNDPRQIYSSRSSQSSFST 240

Query: 241  XXXXXXXXIDIPTRNSASRVGSQYFDADFNVPRFENDFLHPDEPALNQKLIQNMLTQERR 300
                    IDIPTRNSASRVGSQYFDADFNVPRFENDFLHPDEPALNQKLIQNMLTQERR
Sbjct: 241  MSNTRSASIDIPTRNSASRVGSQYFDADFNVPRFENDFLHPDEPALNQKLIQNMLTQERR 300

Query: 301  KDQHNNQSFFTTDTTNGIPNGLTNSSKHFRDEPSASSNKIQNTKRNNSLNLSSQFDIDMN 360
            KDQHNNQSFFTTDTTNGIPNGLTNSSKHFRDEPSASSNKIQNTKRNNSLNLSSQFDIDMN
Sbjct: 301  KDQHNNQSFFTTDTTNGIPNGLTNSSKHFRDEPSASSNKIQNTKRNNSLNLSSQFDIDMN 360

Query: 361  DNTRTNFIRAGADFKNSKDDANRTISKLLRDDTDVTSSTLIQXXXXXXXILLSRKSVAFD 420
            DNTRTNFIRAGADFKNSKDDANRTISKLLRDDTDVTSSTLIQ       ILLSRKSVAFD
Sbjct: 361  DNTRTNFIRAGADFKNSKDDANRTISKLLRDDTDVTSSTLIQDDGDDDDILLSRKSVAFD 420

Query: 421  QETSGDQTLTFKPSTVSQTEMDVLLDPIGISTRKSKRGNVKSNKKPKAFIRDGQKIYPGX 480
            QETSGDQTLTFKPSTVSQTEMDVLLDPIGISTRKSKRGNVKSNKKPKAFIRDGQKIYPG 
Sbjct: 421  QETSGDQTLTFKPSTVSQTEMDVLLDPIGISTRKSKRGNVKSNKKPKAFIRDGQKIYPGE 480

Query: 481  XXXXXIVEXXXXXXXXXXXXXXXKPLSRIDDGPNNNGFVTTTRSSSNSSQKNLANLSRLT 540
                 IVE               KPLSRIDDGPNNNGFVTTTRSSSNSSQKNLANLSRLT
Sbjct: 481  DEDDEIVETITSNRRNNISSTISKPLSRIDDGPNNNGFVTTTRSSSNSSQKNLANLSRLT 540

Query: 541  SIYGNSEEFKPQSERKYKPLQTVDNKPYKHLQRTDSNNHDTRSYKPLQRVTXXXXXXXXX 600
            SIYGNSEEFKPQSERKYKPLQTVDNKPYKHLQRTDSNNHDTRSYKPLQRVT         
Sbjct: 541  SIYGNSEEFKPQSERKYKPLQTVDNKPYKHLQRTDSNNHDTRSYKPLQRVTSNNSSSGKL 600

Query: 601  XXXXXXXXEAPSKIYXXXXXXXXXXXXXXXXXXXKDQLDSPSDLSKVTSYFSTDTESAAE 660
                    EAPSKIY                   KDQLDSPSDLSKVTSYFSTDTESAAE
Sbjct: 601  NLKRLSSLEAPSKIYSSRELLRQLSSRSSRIGSLKDQLDSPSDLSKVTSYFSTDTESAAE 660

Query: 661  LQNVIIKYRDPMEESEIPETKIQLISKDINXXXXXXXXXXXXENNKMELVYNKDEKAWIL 720
            LQNVIIKYRDPMEESEIPETKIQLISKDIN            ENNKMELVYNKDEKAWIL
Sbjct: 661  LQNVIIKYRDPMEESEIPETKIQLISKDINTTLHYDTTDLLTENNKMELVYNKDEKAWIL 720

Query: 721  PNLMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLSGYDFIEPFRDENISSA 780
            PNLMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLSGYDFIEPFRDENISSA
Sbjct: 721  PNLMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLSGYDFIEPFRDENISSA 780

Query: 781  DNSDGTLMQNIIPEKLKTISMTKMAGNGSKGSTPRSNYTGXXXXXXXXXXXXXXXXXXXX 840
            DNSDGTLMQNIIPEKLKTISMTKMAGNGSKGSTPRSNYTG                    
Sbjct: 781  DNSDGTLMQNIIPEKLKTISMTKMAGNGSKGSTPRSNYTGVSRSNSLSASSSSSVWKSVN 840

Query: 841  XXLFTPLEPNKVEYSTEIPEIFKNTTENNTSNAPMQYHPERKRPGLLHNVVDCSQEELFG 900
              LFTPLEPNKVEYSTEIPEIFKNTTENNTSNAPMQYHPERKRPGLLHNVVDCSQEELFG
Sbjct: 841  VNLFTPLEPNKVEYSTEIPEIFKNTTENNTSNAPMQYHPERKRPGLLHNVVDCSQEELFG 900

Query: 901  DLLADGLMDTETAEQMFLDKYPVPELPIYLNSKYMTQIVGEINQXXXXXXXXXXXXXXXX 960
            DLLADGLMDTETAEQMFLDKYPVPELPIYLNSKYMTQIVGEINQ                
Sbjct: 901  DLLADGLMDTETAEQMFLDKYPVPELPIYLNSKYMTQIVGEINQPSGSGPPSSLNNNDLN 960

Query: 961  HIIPHVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTPCFYENLKSGENNELK 1016
            HIIPHVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTPCFYENLKSGENNELK
Sbjct: 961  HIIPHVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTPCFYENLKSGENNELK 1016

>NCAS0F01090 Chr6 complement(215542..217905) [2364 bp, 787 aa] {ON}
            Anc_5.527 YDR422C
          Length = 787

 Score =  280 bits (717), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 156/358 (43%), Positives = 210/358 (58%), Gaps = 21/358 (5%)

Query: 664  VIIKYRDPMEESEIPETKIQLISKDINXXXXXXXXXXXXENNKMELVYNKDEKAWILPNL 723
            V++K+RD ++  +    KI ++S DI+               K+ +++N   K W +PNL
Sbjct: 430  VVLKWRDQIDNPK--HCKISIVSDDISSAIPAKATKA----GKLPMLFNPMIKEWYVPNL 483

Query: 724  MLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLSGYDFIEPFRDENISS---A 780
            +LPPGIY+++F +N DL HS+FLPTATD  GNIVNWFEVL GYD +EP+RDE I +    
Sbjct: 484  LLPPGIYRLKFSINGDLTHSNFLPTATDSMGNIVNWFEVLPGYDTVEPYRDEIIETTFHT 543

Query: 781  DNSDGTLMQNIIPEKLKTISMTKMAGNGSKGS-TPRSNYTGXXXXXXXXXXXXXXXXX-- 837
            + S GTL  N         S + ++ NG   S TP S+YTG                   
Sbjct: 544  NGSQGTLRDNNPTTIRSRRSSSFVSANGDLASMTPYSDYTGISRSNSALNSKRTSLVSLR 603

Query: 838  -XXXXXLFTPLEPNKVEYSTEIPEIFK--NTTENNTSNAPMQYHPER----KRPGLLHNV 890
                  LFTP+EP K+EYS EIPE+FK  N+ E+   +     H E     + P   + V
Sbjct: 604  GVGKLDLFTPMEPKKIEYSNEIPELFKISNSIEDEDDDEGDYGHNETLSPFEEPSFTNRV 663

Query: 891  VDCSQEELFGDLLADGLMDTETAEQMFLDKYPVPELPIYLNSKYMTQIVGEINQXXX--X 948
            VDC+Q++LF DL  +G +D ETAE +FL+KY VP+LPIYLNS Y+ +I  +  +      
Sbjct: 664  VDCNQDKLFSDLQKNGNIDAETAEMLFLNKYQVPDLPIYLNSSYLNKIFLQFQKQHNDPT 723

Query: 949  XXXXXXXXXXXXHIIPHVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTPCFYEN 1006
                        HIIPHVNL HLLTSSIR+E+ISVACTTRY+GKF+TQ++Y PC Y N
Sbjct: 724  PSANTASTIGITHIIPHVNLNHLLTSSIRDEIISVACTTRYQGKFITQVMYAPCNYGN 781

>NDAI0H01600 Chr8 complement(387297..389825) [2529 bp, 842 aa] {ON}
            Anc_5.527 YDR422C
          Length = 842

 Score =  280 bits (717), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 151/358 (42%), Positives = 209/358 (58%), Gaps = 18/358 (5%)

Query: 663  NVIIKYRDPMEESEIPETKIQLISKDI-----NXXXXXXXXXXXXENNKMELVYNKDEKA 717
            +V++K+RD ++  +  + KI +IS DI     +            +NN + +V+N   K 
Sbjct: 478  HVVLKWRDQIDNPK--KCKIAIISDDIVNALESSSSKRKSNTNNNDNNTLPMVFNPMIKE 535

Query: 718  WILPNLMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLSGYDFIEPFRDENI 777
            W +PNL LPPGIY+++F +N+D+ HS+FLPTATD  GNIVNWFEVL GYD +EP+RDE I
Sbjct: 536  WYMPNLTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVLPGYDAVEPYRDEII 595

Query: 778  SSADN---SDGTLMQNIIPEKLKTISMTKMAGNGSKGS-TPRSNYTGXXXXXXXXXXXXX 833
             +  +   S GTL  + +       S + ++      S TP S+Y G             
Sbjct: 596  ETTFHTAPSQGTLSVHDLTMIRSRRSSSFVSAKSDLSSFTPYSDYAGISRSSSSVGTATK 655

Query: 834  XXXXXX-----XXXLFTPLEPNKVEYSTEIPEIFK--NTTENNTSNAPMQYHPERKRPGL 886
                          LFTP+EP K+ YS EIPE+FK  N+ + N            +RP  
Sbjct: 656  KASLVSLRGTNKLDLFTPIEPKKIAYSKEIPELFKIANSEDTNKMEIDDDGSSPFERPSF 715

Query: 887  LHNVVDCSQEELFGDLLADGLMDTETAEQMFLDKYPVPELPIYLNSKYMTQIVGEINQXX 946
             H V+DC+Q++LF DL  DG +D ETAE +FL++YP+P+LPIYLNS Y+ +I  +  +  
Sbjct: 716  THKVIDCNQDKLFADLQRDGNIDAETAEALFLNRYPIPDLPIYLNSTYLNKIFTQFQKQH 775

Query: 947  XXXXXXXXXXXXXXHIIPHVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTPCFY 1004
                          HIIPHVNL HLLTSSIR+E+ISVACTTRY+GKF+TQ++Y PC Y
Sbjct: 776  NDPTLPASSSIGLTHIIPHVNLNHLLTSSIRDEIISVACTTRYQGKFITQVMYAPCNY 833

>ZYRO0D12562g Chr4 complement(1061702..1064158) [2457 bp, 818 aa] {ON}
            some similarities with uniprot|P32578 Saccharomyces
            cerevisiae YDR422C SIP1 Alternate beta-subunit of the
            Snf1p kinase complex may confer substrate specificity
            vacuolar protein containing KIS (Kinase-Interacting
            Sequence) and ASC (Association with Snf1 kinase Complex)
            domains involved in protein interactions
          Length = 818

 Score =  274 bits (700), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 155/387 (40%), Positives = 218/387 (56%), Gaps = 50/387 (12%)

Query: 663  NVIIKYRD--PMEESEIPETKIQLISKDINXXXXXXXXXXXXENNKMELVYNKDEKAWIL 720
            +V IK+RD  P++ +     ++ ++S+DI               N   + Y ++ K W++
Sbjct: 440  HVAIKWRDHLPVDGT----NRMSMVSEDI-ASTLSFERQKHGARNTFPMRYEEETKEWVV 494

Query: 721  PNLMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLSGYDFIEPFRDE----- 775
            P+L+LP G+Y++QFL+N +L HS++LPTATD  GN VNWFEV+ GY+ +EP+RDE     
Sbjct: 495  PDLVLPVGVYRLQFLINGELTHSNYLPTATDSVGNFVNWFEVIPGYEKVEPYRDEVELDS 554

Query: 776  -------------NISSADN--SDGTLMQNIIPEKLKT----ISMTKMAGNGSKGSTPRS 816
                         ++ S +N  S+GT++   +P K+       SM   +    + +TP S
Sbjct: 555  GQPLNAGNNGIAGSVLSLENQGSEGTVLMEPVPGKVNVRPPLASMHHSSNRVIRSNTPYS 614

Query: 817  NYTGXXXXXXXXXXXXXXXXXXXXXXLFTPLEPNKVEYSTEIPEIFKNT--TENNTSN-- 872
            +YTG                      L T L+P K +YS EIPE+FK    T+ N  N  
Sbjct: 615  DYTG-ISRSSSALRKSPINCTTSSLDLHTALQPKKYKYSNEIPELFKTAPITKANDENED 673

Query: 873  ------APMQYHPERKRP----GLLHNVVDCSQEELFGDLLADGLMDTETAEQMFLDKYP 922
                   P  Y   R  P    G  + VVDC+Q+ELF +L   GL+D ETAEQ+FL+KYP
Sbjct: 674  FTFGHMEPPTYDWARGHPSSNAGFGNQVVDCNQDELFTELQQGGLLDAETAEQLFLEKYP 733

Query: 923  VPELPIYLNSKYMTQIVGEINQXXXXXXXXXXXXXXXXHIIPHVNLQHLLTSSIREEMIS 982
            VP+LPIYLNS Y+ +I+ E  +                HIIPHVNL HLLTSSIR+EMIS
Sbjct: 734  VPDLPIYLNSYYLNRIISEFQK----NNYPGGGSGGINHIIPHVNLNHLLTSSIRDEMIS 789

Query: 983  VACTTRYEGKFLTQILYTPCFYENLKS 1009
            V CTTRYEGKF+TQ++Y PC+YEN ++
Sbjct: 790  VGCTTRYEGKFITQVIYAPCYYENGRT 816

 Score = 34.3 bits (77), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 56/128 (43%), Gaps = 13/128 (10%)

Query: 37  RNDSITSTLFPXXXXXXXQKYLT----KNQGENPNNVSLFKQNYSLTQNNETYEPILKPL 92
           R  SITS LFP          L     K Q   P+  SLFK+NYSL + +   +    P 
Sbjct: 42  RQSSITSQLFPSRKTRHAPSGLGNLKRKTQNVVPHPPSLFKKNYSLEEASAGAQ---GPN 98

Query: 93  SSPENDTNITYNNST-----FNNSRASKNSXXXXXXXXXXXXXXXXXXLLILSPGPSHPT 147
           ++  ++ N+T   +      FN+++ S  S                  +   SPGP+ PT
Sbjct: 99  NNNNDNHNVTLMAADDDPRDFNDTKTSTESVRENMAGLSIKSSNETGPMF-FSPGPATPT 157

Query: 148 VEQSKQQA 155
           V+ +K++A
Sbjct: 158 VQPTKEEA 165

>Skud_4.696 Chr4 complement(1236293..1238728) [2436 bp, 811 aa] {ON}
            YDR422C (REAL)
          Length = 811

 Score =  267 bits (682), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 139/319 (43%), Positives = 186/319 (58%), Gaps = 15/319 (4%)

Query: 704  NNKMELVYNKDEKAWILPNLMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVL 763
            N+++ ++Y+   + W +P+L LP GIY++QF +N  L HS+FLPTATD  GN VNWFEVL
Sbjct: 499  NSRIRMIYDSVHREWFVPDLFLPAGIYRLQFSINGLLTHSNFLPTATDSEGNFVNWFEVL 558

Query: 764  SGYDFIEPFRDE-----NISSADNSDGTLMQNIIPEKLKTISMTKMAGNGSKGSTPRSNY 818
             GY  IEPFRDE      + S  + +  +            S    A +G +  TP S+Y
Sbjct: 559  PGYHTIEPFRDEADMDFQMRSTLDEEAPIRPEPKRLSSSRKSSYYSAKDGERPGTPFSDY 618

Query: 819  TGXXXXXXXXXXXXXXXXXXXXXXLFTPLEPNKVEYSTEIPEIFKNTTENNTSNAPMQYH 878
             G                      L   ++P K+EYS EIP +F N  E +T+ +  + H
Sbjct: 619  RGLSRSNSVFLRGSFVRLKASSLDLMAEIKPEKLEYSNEIPNLF-NIGEASTTTS--KDH 675

Query: 879  PER----KRPGLLHNVVDCSQEELFGDLLADGLMDTETAEQMFLDKYPVPELPIYLNSKY 934
             ER     RP   H VVDC+Q++LF  L   G +D ETAE +FL +YP+P+LPIYLNS Y
Sbjct: 676  FERLSPQDRPSFTHKVVDCNQDDLFATLQQGGNIDAETAEAVFLSRYPIPDLPIYLNSSY 735

Query: 935  MTQIVGEINQXXXXXXXXXXXXXXXXHIIPHVNLQHLLTSSIREEMISVACTTRYEGKFL 994
            + +I   +NQ                HIIPHVNL HLLTSSIR+E+ISVACTTRYEGKF+
Sbjct: 736  LNRI---LNQSNPNSEFHDGDEGGINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFI 792

Query: 995  TQILYTPCFYENLKSGENN 1013
            TQ++Y PC+Y+  K+G NN
Sbjct: 793  TQVIYAPCYYKTQKAGGNN 811

>SAKL0G04928g Chr7 complement(405798..408476) [2679 bp, 892 aa] {ON}
            some similarities with uniprot|P32578 Saccharomyces
            cerevisiae YDR422C SIP1 Alternate beta-subunit of the
            Snf1p kinase complex may confer substrate specificity
            vacuolar protein containing KIS (Kinase-Interacting
            Sequence) and ASC (Association with Snf1 kinase Complex)
            domains involved in protein interactions
          Length = 892

 Score =  266 bits (679), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 152/375 (40%), Positives = 208/375 (55%), Gaps = 42/375 (11%)

Query: 660  ELQNVIIKYRDPMEESEIPET-KIQLISKDINXXXXXXXXXXXXENNKMELVYNKDEKAW 718
            +L NV++K+RD + +   P+T KI +IS DI+             + K+ + Y   EK+W
Sbjct: 524  DLVNVVLKWRDCIVD---PKTCKISVISSDISAVLALQS------SKKIPMEYETTEKSW 574

Query: 719  ILPNLMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLSGYDFIEPFRDENIS 778
             +PNL LPPG+Y++QFL+N +L+HS+FLPTATD FGN VNWFEVL GY  IEP RD  + 
Sbjct: 575  FVPNLKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEVLPGYYEIEPLRDVPVD 634

Query: 779  SAD---------------NSDGTLMQNIIPEKL---KTISMTKMAGNGSKGSTPRSNYTG 820
            S +                SD T+   I    L    T S  + +    + +TP S+YTG
Sbjct: 635  SMNYGSDLGVSMKESVNGGSDFTITAPIPRPPLLSQATSSSYRSSKYIERSTTPYSDYTG 694

Query: 821  XXXXXXXXXXXXXXXXXXXXXXLFTPLEPNKVEYSTEIPEIFK-NTTENNTSNAP----- 874
                                  +F PL P K EYST+IPE+FK N  E++  + P     
Sbjct: 695  -ILSRSNSARPLLNQKKSSSYDVFAPLPPKKYEYSTDIPELFKVNDEEDHDHDIPEDPPS 753

Query: 875  ---MQYHPERKRPGLLHNVVDCSQEELFGDLLADGLMDTETAEQMFLDKYPVPELPIYLN 931
               +    E ++P     V DC+Q+ LF DL     +D + AE+ FL KYPVP+LPIYLN
Sbjct: 754  YSSLLKGSEAEQPSFHCRVQDCNQDRLFSDLQQHDRIDAQAAEEFFLQKYPVPDLPIYLN 813

Query: 932  SKYMTQIVGEINQXXXXXXXXXXXXXXXXHIIPHVNLQHLLTSSIREEMISVACTTRYEG 991
            S Y+ ++  ++ +                 +IPHVNL HLLTSSIREE+ISV CTTRYEG
Sbjct: 814  SSYLNKVFNQLQKDNNAGETKAVVNP----VIPHVNLNHLLTSSIREEIISVGCTTRYEG 869

Query: 992  KFLTQILYTPCFYEN 1006
            KF+T ++Y PC+YEN
Sbjct: 870  KFITHVVYAPCYYEN 884

>Suva_2.599 Chr2 complement(1068063..1070546) [2484 bp, 827 aa] {ON}
            YDR422C (REAL)
          Length = 827

 Score =  262 bits (669), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 151/367 (41%), Positives = 198/367 (53%), Gaps = 27/367 (7%)

Query: 664  VIIKYRDPMEESEIPET-KIQLISKDINXXXXXXXXXXXXE----------NNKMELVYN 712
            VI+K+++    S +P T ++ +IS DI             E          N ++ ++Y+
Sbjct: 469  VILKWKN---NSNMPATTEVSIISHDIASTLKEQLEVNLDEDASLDSEKQLNPRIRMIYD 525

Query: 713  KDEKAWILPNLMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLSGYDFIEPF 772
               K W +P L LPPGIY++QF +N  L HS+FLPTATD  G  VNWFEVL GY  IEPF
Sbjct: 526  AVHKEWFVPELFLPPGIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLPGYHTIEPF 585

Query: 773  RDE-NISSADNSDGTLMQNIIPE-----KLKTISMTKMAGNGSKGSTPRSNYTGXXXXXX 826
            RDE +  S   S   +   I PE          S    A    + STP S+Y G      
Sbjct: 586  RDEADTESQVGSTIDVEAPIRPEPKRLSSSSRKSSYYSAKGVERPSTPFSDYRGLSRSNS 645

Query: 827  XXXXXXXXXXXXXXXXLFTPLEPNKVEYSTEIPEIFKNTTENNTSNAPMQYH-PERKRPG 885
                            L   ++P  +EYS EIP +F   T  N S  P+Q   P +  P 
Sbjct: 646  ANLRDSFVRLKASSLDLMAQIKPEILEYSNEIPSLF---TIGNGSATPIQEDLPSQDLPS 702

Query: 886  LLHNVVDCSQEELFGDLLADGLMDTETAEQMFLDKYPVPELPIYLNSKYMTQIVGEINQX 945
              H VVDC+Q++LF  L   G +D ETAE +FL +YP+P+LPIYLNS Y+ +I   +NQ 
Sbjct: 703  FTHKVVDCNQDDLFATLQQGGNIDAETAEIVFLSRYPIPDLPIYLNSSYLNKI---LNQG 759

Query: 946  XXXXXXXXXXXXXXXHIIPHVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTPCFYE 1005
                           HIIPHVNL HLLTSSIR+E+ISVACTTRYEGKF+TQ++Y PC+Y+
Sbjct: 760  NPNSESGDKDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPCYYK 819

Query: 1006 NLKSGEN 1012
              K+  N
Sbjct: 820  TQKAHGN 826

 Score = 32.7 bits (73), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 73/203 (35%), Gaps = 52/203 (25%)

Query: 138 ILSPGPSHPTVEQSKQQANYNEDQEMFKNGITQTKNSSSYRXXXXXXXXXXXXXXXXXXX 197
            LSPGPS  TV+Q+K   NY +D     N I         +                   
Sbjct: 137 FLSPGPSMATVKQTK---NYPDDLSTVNNTIVDETIGDERKDHP---------------- 177

Query: 198 XYASSHRPSVVALKKSLEETLDFTTNDPRQIYXXXXXXXXXXXXXXXXXXXIDIPTRNSA 257
            +   HR S++ALKK+L E     +  P +                     IDIP + + 
Sbjct: 178 -HHERHRSSIIALKKTLLENSATASPSPTR----SSSIHSTSLLPLSKAGSIDIPIKQTY 232

Query: 258 SRVGS------QYFDADFNVPRFEND-----------------FLHPDEPALNQKLIQNM 294
           S+  S      QY D D   P   +D                  L  ++  LNQ L+QN 
Sbjct: 233 SKKPSVHAYQYQYLDPD---PTLSDDSQLDKESKSDNIDAEAGVLQSEDMVLNQSLLQNA 289

Query: 295 LTQ--ERRKDQHNNQSFFTTDTT 315
           L +  +R    +++ S +T D+ 
Sbjct: 290 LKKDIQRLSRVNSSNSTYTIDSA 312

>TDEL0A03910 Chr1 complement(701073..703322) [2250 bp, 749 aa] {ON}
            Anc_5.527 YDR422C
          Length = 749

 Score =  260 bits (664), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 151/375 (40%), Positives = 204/375 (54%), Gaps = 37/375 (9%)

Query: 660  ELQNVIIKYRDPMEESEIPETKIQLISKDINXXXXXXXXXXXXENNKMELVYNKDEKAWI 719
            E  +VI+K+RD +E+    + KI +IS DI              +    + Y++ E  + 
Sbjct: 372  EKVHVILKWRDQIEDPS--KCKITIISTDIASALNFDPSDKSF-HGTFSMKYDEKENNFY 428

Query: 720  LPNLMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLSGYDFIEPFRD----- 774
            +PNL LPPGIY+ QF++N +++HS+ LP+ATD  GNIVNWFEV+ GY+ +EPFR+     
Sbjct: 429  VPNLSLPPGIYKFQFVINGEIRHSNLLPSATDSVGNIVNWFEVIPGYESVEPFRNEIDYH 488

Query: 775  ENIS--------------SADNSDGTL-MQNIIPEK--LKTISMTKMAGNGSKGSTPRSN 817
            EN+                 D S G + +   +P +  L     +  +    +  TP S+
Sbjct: 489  ENMGIDPPQSDSSTSTGKHHDESPGKVPLVQPVPGRPPLAARHTSSYSNKQERSGTPYSD 548

Query: 818  YTGXXXXXXXXXXXXXXXXXXXXXXLFTPLEPNKVEYSTEIPEIFK------NTTENN-- 869
            YTG                      L T L+P K EYS EIPE+FK       + EN   
Sbjct: 549  YTGVSRCNSAVRKSPLIHQTLSSIDLVTALQPKKYEYSNEIPELFKAGNVLGQSDENQFP 608

Query: 870  TSNAPMQYHPERKRPGLLHNVVDCSQEELFGDLLADGLMDTETAEQMFLDKYPVPELPIY 929
            T   P    P   +P  L NVVDC+Q+ LF  L   GL+D ETAEQ+FL+KY VP+LP+Y
Sbjct: 609  TPPPPPMNPPSYDQPSFLENVVDCNQDNLFVSLQQGGLLDAETAEQLFLEKYTVPDLPVY 668

Query: 930  LNSKYMTQIVGEINQXXXXXXXXXXXXXXXXHIIPHVNLQHLLTSSIREEMISVACTTRY 989
            LNS Y+ +I  E  +                HIIPHVNL HLLTSSIR+EMISV CTTRY
Sbjct: 669  LNSTYLNKIFNEFQK----HNSLGSNSSGLNHIIPHVNLNHLLTSSIRDEMISVGCTTRY 724

Query: 990  EGKFLTQILYTPCFY 1004
            EGKF+TQ++Y PC+Y
Sbjct: 725  EGKFITQVVYAPCYY 739

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 72/312 (23%), Positives = 117/312 (37%), Gaps = 65/312 (20%)

Query: 1   MGNNPSILDXXXXXXXXXXXXXXXXXXXXXXXXXXXRNDSITSTLFPXXXXXXXQKY--- 57
           MGN+PS+ +                           R  SITS LFP         +   
Sbjct: 1   MGNSPSVQEHQQQPHGVLDANHPFRRAQLGNEMNSGRQQSITSQLFPSRNTRHVGPHSMN 60

Query: 58  LTKNQGENPNNVSLFKQNYSLTQNNETYEPILKPLSSPENDT---NITYNNSTFNNSRAS 114
             +N+  +P   SLFK +YSL    E          +P N     NI  N +  +   ++
Sbjct: 61  AKRNRHPHPQPPSLFKSDYSLRSTAE---------ETPANTGSTENIRDNMAGLSLKSSN 111

Query: 115 KNSXXXXXXXXXXXXXXXXXXLLILSPGPSHPTVEQSKQQANYNED-QEMFKNGITQTKN 173
           +N+                     L+PG S PTV+ ++Q A    D +   +NG+ Q K 
Sbjct: 112 ENAQVPS----------------FLTPGHSTPTVQPTRQAAVPAADLKNKLQNGLNQQKE 155

Query: 174 SSSYRXXXXXXXXXXXXXXXXXXXXYASSHRPSVVALKKSLEETLDFTTNDPRQIYXXXX 233
            SS+R                         RPSVVALKK+L +  +  +   R       
Sbjct: 156 ISSHRF-----------------------QRPSVVALKKTLLDDGELHSTSSR---STSG 189

Query: 234 XXXXXXXXXXXXXXXIDIPTRNSASRVGSQYFDADFNVPRFEN----DFLHPDEPALNQK 289
                          +D PT++ +    ++  DAD +   F++     +L  ++  LNQ 
Sbjct: 190 DVVSSASLDIYSALNLDSPTQSGSK---AKDTDADPDTSDFDDISDDGYLQSEDVVLNQS 246

Query: 290 LIQNMLTQERRK 301
           L+QN+L ++ ++
Sbjct: 247 LLQNVLRRDMKR 258

>CAGL0F03047g Chr6 complement(298906..301140) [2235 bp, 744 aa] {ON}
            similar to uniprot|P32578 Saccharomyces cerevisiae
            YDR422c SIP1 multicopy suppressor of SNF1
          Length = 744

 Score =  259 bits (662), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 157/402 (39%), Positives = 205/402 (50%), Gaps = 61/402 (15%)

Query: 663  NVIIKYRDPMEESEIPETKIQLISKDINX---------XXXXXXXXXXXENNKMELVYNK 713
            NVI+K+RD   +S   E K+ L+S +I                      + NK+ L Y+ 
Sbjct: 351  NVILKWRDSQNQSNNKELKVYLVSNEICASLKNDDKLFAEGKLLATDNSQFNKIPLSYDS 410

Query: 714  DEKAWILPNLMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLSGYDFIEPFR 773
                W +P+L LP GIY++QFLVN +L HSDFLPTATDD GNI+NWFEVL GYD IEP+R
Sbjct: 411  HNNEWYVPDLYLPQGIYRLQFLVNGNLVHSDFLPTATDDQGNIMNWFEVLRGYDRIEPYR 470

Query: 774  DEN----------------------ISSADNSDGTLMQNIIPEKLKTISMTKMAGNGSKG 811
            DE+                        S+DNS  T M+N  P  L   +        S+ 
Sbjct: 471  DESEIQSDYTSSVDTTLEGMENNGFQGSSDNS-TTSMRNNNPVALNLQAPAPSKAQASRN 529

Query: 812  S------------TPRSNYTGXXXXXXXXXXXX---XXXXXXXXXXLFTPLEPNKVEYST 856
            S            T  S+YTG                          F P++P   EYS 
Sbjct: 530  SSYYSAKSFEKSITQFSDYTGVSRTNSMVSAVSPINNANTRDNDLEFFPPIKPKVYEYSN 589

Query: 857  EIPEIFKNTTE-------NNTSNAPMQYHPERKRPGLLHNVVDCSQEELFGDLLADGLMD 909
             IP +F+ + +       N T N P  ++    RP   + VVDC+Q+ LFGDL   G MD
Sbjct: 590  NIPALFRISCDMEDVDDDNGTENNPRAFY---DRPSFTNRVVDCNQDALFGDLQKGGKMD 646

Query: 910  TETAEQMFLDKYPVPELPIYLNSKYMTQIVGEINQXXXXXXXXXXXXXXXXHIIPHVNLQ 969
             E AE +FL KY VP+LP+YLNS Y+ +I  E +Q                HIIPHVNL+
Sbjct: 647  AEEAENLFLKKYQVPDLPVYLNSTYLNKIFHEFHQVAGPSTQDSSIN----HIIPHVNLK 702

Query: 970  HLLTSSIREEMISVACTTRYEGKFLTQILYTPCFYENLKSGE 1011
            HLLTSSIR+ ++SVACTTRY GKF+TQ++Y PC  + L+S E
Sbjct: 703  HLLTSSIRDGIVSVACTTRYAGKFITQVIYAPCGNDQLESKE 744

 Score = 35.4 bits (80), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 59/148 (39%), Gaps = 49/148 (33%)

Query: 70  SLFKQNYSLTQNNETYEPILKPLSSPENDTNITYNNSTFNNSRASKNSXXXXXXXXXXXX 129
           SLFK++YS+T          K  S PE D +I  N +  + + +  +             
Sbjct: 3   SLFKEDYSVT----------KEASEPEADESIDVNMAGLSLTSSMGDGSA---------- 42

Query: 130 XXXXXXLLILSPGPSHPTVEQSKQQANYNEDQEMFKNGITQTKNSSSYRXXXXXXXXXXX 189
                 L I SPGPS+ TV+  K++  + ++      G +   N+   R           
Sbjct: 43  ------LHISSPGPSNATVQTIKREVTHGDESPQ---GDSDDINAQHSRA---------- 83

Query: 190 XXXXXXXXXYASSHRPSVVALKKSLEET 217
                      S HRPS+VALK SL+E 
Sbjct: 84  ----------MSEHRPSIVALKMSLKEV 101

>Smik_4.697 Chr4 complement(1236081..1238534) [2454 bp, 817 aa] {ON}
            YDR422C (REAL)
          Length = 817

 Score =  256 bits (655), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 137/325 (42%), Positives = 187/325 (57%), Gaps = 24/325 (7%)

Query: 704  NNKMELVYNKDEKAWILPNLMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVL 763
            N ++ +VY+   K W  P+L LPPGIY++QF +N  L HS++LPTATD  GN VNWFEVL
Sbjct: 502  NPRIRMVYDNVHKEWFFPDLFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVL 561

Query: 764  SGYDFIEPFRDENISSADNSDGTLMQNIIPEK------------LKTISMTKMAGNGSKG 811
             GY  IEPFR+E    AD   G+ ++ ++ E+                S    A    + 
Sbjct: 562  PGYHTIEPFRNE----ADL--GSQVEPVLEEESPIRPELKRFSSSSRKSSYYSAKGVERP 615

Query: 812  STPRSNYTGXXXXXXXXXXXXXXXXXXXXXXLFTPLEPNKVEYSTEIPEIFKNTTENNTS 871
            STP S+Y G                      L   ++P K+EYS EIP +F N  +  T+
Sbjct: 616  STPFSDYRGLSRSSSVNMRDSFVRLKASSLDLMAEIKPEKLEYSNEIPNLF-NIADGGTT 674

Query: 872  NAPMQYHPE--RKRPGLLHNVVDCSQEELFGDLLADGLMDTETAEQMFLDKYPVPELPIY 929
            +   +      +++P   + VVDC+Q++LF  L   G +D ETAE +FL +YP+P+LPIY
Sbjct: 675  SVIRESRDSSPQEQPSFTYKVVDCNQDDLFATLQQGGNIDAETAETVFLSRYPIPDLPIY 734

Query: 930  LNSKYMTQIVGEINQXXXXXXXXXXXXXXXXHIIPHVNLQHLLTSSIREEMISVACTTRY 989
            LNS Y+ +I   +NQ                HIIPHVNL HLLTSSIR+E+ISVACTTRY
Sbjct: 735  LNSSYLNKI---LNQSNPNSEPHDRDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRY 791

Query: 990  EGKFLTQILYTPCFYENLKSGENNE 1014
            EGKF+TQ++Y PC+Y+  K+  NNE
Sbjct: 792  EGKFITQVIYAPCYYKTQKARGNNE 816

>ADR194C Chr4 complement(1039625..1041538) [1914 bp, 637 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDR422C
            (SIP1)
          Length = 637

 Score =  252 bits (644), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 142/358 (39%), Positives = 202/358 (56%), Gaps = 28/358 (7%)

Query: 655  TESAAELQNVIIKYRDPMEESEIPETKIQLISKDINXXXXXXXXXXXXENNKMELVYNKD 714
            +++ AE   VIIK+RD + + +   TK+ ++S DI                K+ +V++KD
Sbjct: 299  SDAEAEFVEVIIKWRDCLLDPQ--RTKLSIVSPDI------ASVIHKNSKRKVAMVFSKD 350

Query: 715  EKAWILPNLMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLSGYDFIEPFRD 774
            E+ W+ P+L LPPGIY++QFL+N  L+HS+FLPTATD   NIVNWFEV+  YD  EP+RD
Sbjct: 351  EQFWVAPDLRLPPGIYKLQFLINGALRHSNFLPTATDSHSNIVNWFEVVPWYDRAEPYRD 410

Query: 775  ----ENISSADNSDGTLMQNIIPEKLK-TISMTKMAGNGSKGSTPRSNYTGXXXXXXXXX 829
                E     ++   T      P  LK   S +  A    + +TP S+YTG         
Sbjct: 411  PAPEEVAMPPESPQLTAPAAGRPPLLKRGTSSSSRARVVERSNTPISDYTGISRSGSARP 470

Query: 830  XXXXXXXXXXXXXLFTPLEPNKVEYSTEIPEIFK-NTTENNTSNAPMQYHPERKRPGLLH 888
                           +P+    ++YSTEIPE+FK      + + AP  ++          
Sbjct: 471  LLAHHKSANSIE--LSPIPRCVLQYSTEIPELFKPEGCPPDPNTAPGSFN---------E 519

Query: 889  NVVDCSQEELFGDLLADGLMDTETAEQMFLDKYPVPELPIYLNSKYMTQIVGEINQXXXX 948
            N+ DC+Q+ELF  L  D  M  + AE++ ++KYPVP+LP+YLNS Y+ +I  ++ +    
Sbjct: 520  NIQDCNQDELFRFLQEDWKMSAQEAEEVLVEKYPVPDLPVYLNSSYLNEIFTKLQR---S 576

Query: 949  XXXXXXXXXXXXHIIPHVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTPCFYEN 1006
                        HIIPHVNL HLLTSSIR+E+ISV CTTRYEGKF+TQI+Y PC+YE+
Sbjct: 577  SVTGDVKRSSFTHIIPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIMYAPCYYES 634

>Kwal_47.18642 s47 (908641..909570) [930 bp, 309 aa] {ON} YDR422C
            (SIP1) - SNF1 protein kinase substrate [contig 191]
            PARTIAL
          Length = 309

 Score =  241 bits (616), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 130/317 (41%), Positives = 181/317 (57%), Gaps = 23/317 (7%)

Query: 709  LVYNKDEKAWILPNLMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLSGYDF 768
            +V++ +   WI P+L LP G+Y+ QFL+N +L+HS+FLPTATD FGN VNWFEV++G+  
Sbjct: 1    MVFDMESNCWIAPDLYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAGHKV 60

Query: 769  IEPFRD-------EN--ISSADNSDGTLMQNIIPEKLKTISMTKMAGNGSKGSTPRSNYT 819
            IEP RD       EN    SA++   +    I+       +    A +  +  TP S+YT
Sbjct: 61   IEPSRDVISNDFTENQVAISANDPSASPRPPILSGSSSFSNWKNSAKHIERSGTPYSDYT 120

Query: 820  GXXXXXXXXXXXXXXXXXXXXXXLFTPLEPNKVEYSTEIPEIFKNTTENNTSNAPMQ--- 876
            G                      L  P+     EYS EIPE+FK   E +++  P Q   
Sbjct: 121  G-LCSRTDLAKPELRHKNTSSYDLLAPVPRPVYEYSNEIPELFKANFEGSSTPPPYQESV 179

Query: 877  --YHPERKRPGLLHNVVDCSQEELFGDLLADGLMDTETAEQMFLDKYPVPELPIYLNSKY 934
               +P + +P  LH V DC+Q+ LF DL  +G +D++ AE+ FL +YP P+LP+YL+S +
Sbjct: 180  PSQNPVKNQPSFLHRVQDCNQDVLFADLQKNGEIDSQAAEEAFLQQYPTPDLPVYLDSSF 239

Query: 935  MTQIVGEINQXXXXXXXXXXXXXXXXHIIPHVNLQHLLTSSIREEMISVACTTRYEGKFL 994
            +  +     +                HI+PHVNL HLLTSSIR+E+ISV CTTRYEGKF+
Sbjct: 240  LNAVFRGFQE-------KNDTKSKLNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFI 292

Query: 995  TQILYTPCFYENL-KSG 1010
            TQI+YTPC+Y N  KSG
Sbjct: 293  TQIIYTPCYYGNKEKSG 309

>YDR422C Chr4 complement(1315326..1317773) [2448 bp, 815 aa] {ON}
            SIP1Alternate beta-subunit of the Snf1p kinase complex,
            may confer substrate specificity; vacuolar protein
            containing KIS (Kinase-Interacting Sequence) and ASC
            (Association with Snf1 kinase Complex) domains involved
            in protein interactions
          Length = 815

 Score =  254 bits (650), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 145/367 (39%), Positives = 201/367 (54%), Gaps = 30/367 (8%)

Query: 664  VIIKYRDPMEESEIPETKIQLISKDINXXXXXXXXXXXXENN----------KMELVYNK 713
            V++K++D  + +    T++ ++S DI             EN           ++ +VY+ 
Sbjct: 454  VVLKWKD--DGTVAATTEVFIVSTDIASALKEQRELTLDENASLDSEKQLNPRIRMVYDD 511

Query: 714  DEKAWILPNLMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLSGYDFIEPFR 773
              K W +P+L LP GIY++QF +N  L HS+FLPTATD  GN VNWFEVL GY  IEPFR
Sbjct: 512  VHKEWFVPDLFLPAGIYRLQFSINGILTHSNFLPTATDSEGNFVNWFEVLPGYHTIEPFR 571

Query: 774  DENISSADNSDGTLMQNIIPEK--LKTI------SMTKMAGNGSKGSTPRSNYTGXXXXX 825
            +E  +  D+     +   +P++  LK        S    A    + STP S+Y G     
Sbjct: 572  NE--ADIDSQVEPTLDEELPKRPELKRFPSSSRKSSYYSAKGVERPSTPFSDYRGLSRSS 629

Query: 826  XXXXXXXXXXXXXXXXXLFTPLEPNKVEYSTEIPEIFKNTTENNTSNAPM---QYHPERK 882
                             L   ++P ++ YS EIP +F N  + +T +        HP+  
Sbjct: 630  SINMRDSFVRLKASSLDLMAEVKPERLVYSNEIPNLF-NIGDGSTISVKGDSDDVHPQEP 688

Query: 883  RPGLLHNVVDCSQEELFGDLLADGLMDTETAEQMFLDKYPVPELPIYLNSKYMTQIVGEI 942
             P   H VVDC+Q++LF  L   G +D ETAE +FL +YPVP+LPIYLNS Y+ +I+ + 
Sbjct: 689  -PSFTHRVVDCNQDDLFATLQQGGNIDAETAEAVFLSRYPVPDLPIYLNSSYLNRILNQS 747

Query: 943  NQXXXXXXXXXXXXXXXXHIIPHVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTPC 1002
            NQ                HIIPHVNL HLLTSSIR+E+ISVACTTRYEGKF+TQ++Y PC
Sbjct: 748  NQ---NSESHERDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVVYAPC 804

Query: 1003 FYENLKS 1009
            +Y+  KS
Sbjct: 805  YYKTQKS 811

>KLTH0G03762g Chr7 complement(297935..300064) [2130 bp, 709 aa] {ON}
            similar to uniprot|P32578 Saccharomyces cerevisiae
            YDR422C SIP1 Alternate beta-subunit of the Snf1p kinase
            complex may confer substrate specificity vacuolar protein
            containing KIS (Kinase-Interacting Sequence) and ASC
            (Association with Snf1 kinase Complex) domains involved
            in protein interactions
          Length = 709

 Score =  243 bits (619), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 135/359 (37%), Positives = 196/359 (54%), Gaps = 31/359 (8%)

Query: 663  NVIIKYRDPMEESEIPETKIQLISKDINXXXXXXXXXXXXENNKMELVYNKDEKAWILPN 722
            +VI+ ++D + + +    K+ ++SKDI+              +K+ +V++ +   W   +
Sbjct: 362  HVILNWKDNIVDPKT--CKMSIVSKDISSTLNPHKKF-----SKIPMVFDMERNCWTAHD 414

Query: 723  LMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLSGYDFIEPFRDENISSAD- 781
            L LP G+Y+ QFL+N +L+HSD+LPTATD FGN VNWFEV+ G+D IEP RD  ISS D 
Sbjct: 415  LYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGHDSIEPSRDV-ISSEDV 473

Query: 782  --NSDGTLMQNIIPEKLKTIS-------MTKMAGNGSKGSTPRSNYTGXXXXXXXXXXXX 832
              + D   ++   PE+    S           + +  +  TP S+YTG            
Sbjct: 474  KLSKDQIAVEQPAPERPALGSDGSSSSNWKGSSRHVERSGTPFSDYTG-LCSRSELTKPE 532

Query: 833  XXXXXXXXXXLFTPLEPNKVEYSTEIPEIFKNTTENNTSNAPMQYHP-----ERKRPGLL 887
                      L  P+   K EY+ EIPE+FK   + +    P +         +K P  L
Sbjct: 533  LRHNNTSSYDLLAPVPRPKYEYTDEIPELFKANFDGSLVPPPYEERELTKDGSQKPPSFL 592

Query: 888  HNVVDCSQEELFGDLLADGLMDTETAEQMFLDKYPVPELPIYLNSKYMTQIVGEINQXXX 947
            H V DC+Q+ LF DL  +G +D++ AE+ FL +YP P+LP+YL+S ++  +         
Sbjct: 593  HRVQDCNQDVLFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDSSFLNAVFSGFQD--- 649

Query: 948  XXXXXXXXXXXXXHIIPHVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTPCFYEN 1006
                         HI+PHVNL HLLTSSIR+E+ISV CTTRYEGKF+TQI+YTPC+Y N
Sbjct: 650  ----KTDSKTRVNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTPCYYSN 704

>Ecym_4065 Chr4 (144003..146168) [2166 bp, 721 aa] {ON} similar to
            Ashbya gossypii ADR194C
          Length = 721

 Score =  225 bits (573), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 127/326 (38%), Positives = 178/326 (54%), Gaps = 30/326 (9%)

Query: 706  KMELVYNKDEKAWILPNLMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLSG 765
            K+ +VY + E+ W   +L LP GIY++ F +N  ++HS++LPTATD   NIVNWFEV+ G
Sbjct: 399  KIPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWFEVVPG 458

Query: 766  YDFIEPFRDENIS------SADNSDGTLMQNIIPEKL--------KTISMTKMAGNGSKG 811
            YD IEP+RD  I       +A N    L+ N  P           +  S +  A    + 
Sbjct: 459  YDQIEPYRDAAIERSPNELAAYNETSLLLTNETPSPANIRPPLINRGTSSSSRARVIERT 518

Query: 812  STPRSNYTGXXXXXXXXXXXXXXXXXXXXXXL-FTPLEPNKVEYSTEIPEIFK------- 863
            +TP S+YTG                      +   P +P  + YS+++PE+FK       
Sbjct: 519  NTPISDYTGVLARNSCSNPAIYRHKSNNSTDVDILPKQPTLI-YSSDVPELFKVGNASTG 577

Query: 864  ---NTTENNTSNAPMQYHPERKRPGLLHNVVDCSQEELFGDLLADGLMDTETAEQMFLDK 920
                 ++ N    P +Y   +  P  + NV DC+Q+ELF  L     M+ + AE++FL+K
Sbjct: 578  GSQQGSDKNKLQNPSKYL--QDSPNFMKNVQDCNQDELFHYLQEKWNMNAQEAEEVFLEK 635

Query: 921  YPVPELPIYLNSKYMTQIVGEINQXXXXXXXXXXXXXXXXHIIPHVNLQHLLTSSIREEM 980
            Y VP+LPIYLNS  + +I  ++ Q                HIIPHVNL HLLTS+IR+E+
Sbjct: 636  YSVPDLPIYLNSTSLNEIFNKLQQ--NSAMGDLPKRKSLTHIIPHVNLNHLLTSNIRDEI 693

Query: 981  ISVACTTRYEGKFLTQILYTPCFYEN 1006
            ISV CTTRYEGKF+TQI+Y PC+YEN
Sbjct: 694  ISVGCTTRYEGKFITQIMYAPCYYEN 719

>KNAG0C03230 Chr3 (632659..634344) [1686 bp, 561 aa] {ON} Anc_5.527
            YDR422C
          Length = 561

 Score =  206 bits (523), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 140/370 (37%), Positives = 189/370 (51%), Gaps = 55/370 (14%)

Query: 664  VIIKYRDPMEESEIPETKIQLISKDINXXXXXXXXXXXX--ENNKMELVY---NKDEKAW 718
            VI+K+RDP  +     T   + S DI                 NK +L+Y   +  +K W
Sbjct: 217  VILKWRDPQLQP-YQGTGAAIKSHDIYSTLRAIKSELITPERENKEDLLYLDYDAKKKDW 275

Query: 719  ILPNLMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLSGYDFIEPFRDENIS 778
             +P+L LPPGIY+++FL+N  L HS+FLPTATD  G IVNWFEVL GY+ IEP+RDE++ 
Sbjct: 276  FVPDLYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVLPGYETIEPYRDESMI 335

Query: 779  SADNSDGTLMQNIIPEKLK-TISMTKMAGNGSKGST-----------PRSNYTGXXXXXX 826
              D+      ++I  +  K T  +T  AG     S            P  + T       
Sbjct: 336  GQDD------ESIDSQPYKSTTDVTDYAGISRSSSVVSKHSKSNLRLPNLHITSLNKESS 389

Query: 827  XXXXXXXXXXXXXXXXLFTPLEPNKVEYSTEIPEIFK----NTTENNTSNAPMQ------ 876
                            L    EP K EYSTEIPE+F+    NT + N      +      
Sbjct: 390  ASVNEANETNEGNDIQLLP--EP-KYEYSTEIPELFQFDDVNTRKTNDIKEVRKESKLET 446

Query: 877  YHPERKRPGLLHNVVDCSQEELFGDLLADGLMDTETAEQMFLDKYPVPELPIYLNSKYMT 936
             +P  K    L  VV+ +Q+ LF  +   G M TE AE+ FL K+ V +LPIYLNS Y+ 
Sbjct: 447  LYPNGKFDFTLARVVNSNQDALFASIQKIGKMTTEEAEEYFLTKFKVSDLPIYLNSTYLN 506

Query: 937  Q-IVGEINQXXXXXXXXXXXXXXXXHIIPHVNLQHLLTSSIREEMISVACTTRYEGKFLT 995
            +   GE+N                 HIIPHVNL+HLLT+SI+E++I V CTTRY GKF+T
Sbjct: 507  KNFSGEVN-----------------HIIPHVNLRHLLTTSIKEDIICVGCTTRYAGKFIT 549

Query: 996  QILYTPCFYE 1005
            Q++Y PC Y+
Sbjct: 550  QVIYAPCSYD 559

>Kpol_1004.21 s1004 complement(41725..43992) [2268 bp, 755 aa] {ON}
            complement(41725..43992) [2268 nt, 756 aa]
          Length = 755

 Score =  207 bits (527), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 130/383 (33%), Positives = 199/383 (51%), Gaps = 29/383 (7%)

Query: 645  SKVTSYFSTDTESAAELQNVIIKYRDPMEESEIPETKIQLISKDINXXXXXXXXXXXXEN 704
            S  +S FS D    +E   V +K+RD +++  I    I ++S +I              +
Sbjct: 379  SAFSSTFSLDL--GSENVRVFLKWRDLIDD--IENANISIVSNEI-LSVICMNDLDSENS 433

Query: 705  NKMELVYNKDEKAWILPNLMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLS 764
            +   +VY  D   W+   L LPPGIY++QF VN  L+HSD+LPTATD+ GNIVNWFEV  
Sbjct: 434  DSARMVYYPDTSEWVTKYLFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEVPR 493

Query: 765  GYDFIEPFRDENISSADNSDGTL--MQNIIPEKLKTISMTKMAGNGSKGSTPRSNYTGXX 822
            GY+ IEPFRD +    + S G L  + N +     +  ++  + + S+ +TP S++ G  
Sbjct: 494  GYESIEPFRDNDYVKNEISGGILQPIPNTLGIPSVSSQLSSFSFHASRPTTPYSDFAGIN 553

Query: 823  XXXXXXXXXXXXXXXXXXXXL-FTPLEPN-KVEYSTEIPEIFKNT--------------T 866
                                L F+   P  K +Y+TEIPEI+K                 
Sbjct: 554  RSSPLPLREKSPDVKSTNFDLEFSTAVPEPKYDYTTEIPEIYKAVDLDLTTAKATETTTD 613

Query: 867  ENNTSNAPMQYHPERKRPGLLHNVVDCSQEELFGDL---LADGLMDTETAEQMFLDKYPV 923
            + + +  P+  +       + ++V+ CSQ +LF  L      GL +T+  E++FL KYP+
Sbjct: 614  DEDITKPPL--YLGTGGNSIFNDVIGCSQRDLFEKLSKNTGKGL-NTDELEKIFLAKYPI 670

Query: 924  PELPIYLNSKYMTQIVGEINQXXXXXXXXXXXXXXXXHIIPHVNLQHLLTSSIREEMISV 983
             +LPIYLN+ YM + + +                   HI+PHVN++HLLT +I++ +I+V
Sbjct: 671  TDLPIYLNTDYMNKALEQHRNIVGVDDVMQEEINVVNHIVPHVNIKHLLTHNIQDSVIAV 730

Query: 984  ACTTRYEGKFLTQILYTPCFYEN 1006
            ACT RY GKF+TQ++Y+PC  EN
Sbjct: 731  ACTVRYGGKFITQVVYSPCSVEN 753

>KAFR0E03300 Chr5 (654349..655749) [1401 bp, 466 aa] {ON} Anc_5.527
            YDR422C
          Length = 466

 Score =  193 bits (490), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 116/347 (33%), Positives = 173/347 (49%), Gaps = 54/347 (15%)

Query: 665  IIKYRDPMEESEIPETKIQLISKDI--------NXXXXXXXXXXXXENNKMELVYNKDEK 716
            I+K+R+P++ +    + + ++SKDI                     +  K+ L+Y+    
Sbjct: 157  ILKWREPIDHN----SAVAIVSKDIVSTLLTIAKTHKSSIITFIERKKFKINLLYDIVTN 212

Query: 717  AWILPNLMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLSGYDFIEPFRDEN 776
             W LPNL LPPGIY++QFL+N +L HS++LPTAT+  GNIVNWFEV+ GY  IEP+RDE 
Sbjct: 213  EWYLPNLFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEVICGYKTIEPYRDEE 272

Query: 777  ISSADNSDGTLMQNIIPEKLKTISMTKMAGNGSKGSTPRSNYTGXXXXXXXXXXXXXXXX 836
                                + I   K   N S  S   ++Y G                
Sbjct: 273  --------------------RIIHREKSTANESISSNSLTDYAGISRSSSIVSNKSSLIS 312

Query: 837  XXXXXXLFTPLEPNKVEYSTEIPEIFK--NTTENNTSNAPMQYHPERKRPGLLHNVVDCS 894
                      L  ++++Y+ EIPEIFK  +T  +N +N              L  V+D +
Sbjct: 313  SSLKLTNLN-LNDDEIKYTNEIPEIFKFDSTANSNVNNQAFDMS--------LSKVIDLN 363

Query: 895  QEELFGDLLADGLMDTETAEQMFLDKYPVPELPIYLNSKYMTQIVGEINQXXXXXXXXXX 954
            Q+ +F  L     M+T+ AE  FL+++ + +LPIYLNS ++ +I                
Sbjct: 364  QDHVFASLQKIARMNTDEAENYFLNRFKIHDLPIYLNSNFLNKIF-----------IRDN 412

Query: 955  XXXXXXHIIPHVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTP 1001
                  + +PHVNL HLLT+SI+++ + VACTTRY GKF+TQI+Y P
Sbjct: 413  NNETTNNTVPHVNLNHLLTTSIKDDTLCVACTTRYVGKFITQIMYAP 459

>Kpol_1023.98 s1023 (229891..231894) [2004 bp, 667 aa] {ON}
            (229891..231894) [2004 nt, 668 aa]
          Length = 667

 Score =  176 bits (445), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 110/358 (30%), Positives = 179/358 (50%), Gaps = 28/358 (7%)

Query: 663  NVIIKYRDPMEESEIPETKIQLISKDINXXXXXXXXXXXXENNKMELVYNKDEKAWILPN 722
            NV++++RD   ++E  ++ + +IS+DI              +N   + Y+K+E  W+LP+
Sbjct: 311  NVVLRWRDSYIQNETCKS-VSIISEDILTSVQAQNSGVLLISN-FSMTYDKNENNWVLPD 368

Query: 723  LMLPPGIYQVQFLVNS-DLKHSDFLPTATDDFGNIVNWFEVLSGYDFIEPFRDENISSAD 781
            L LPPG Y+++FL++  D ++S++LP   D+ G I+N  E+L GY  +EPF         
Sbjct: 369  LFLPPGKYRLRFLIDHHDFRYSNYLPVTEDELGTIINEIEILPGYKSVEPFEH------- 421

Query: 782  NSDGTLMQNIIPEKLKTISMTKMAGNGSKGSTPRSNYTGXXXXXXXXXXXXXXXXXXXXX 841
            N+   + +NII  +L   +  ++            N++                      
Sbjct: 422  NNHIMIQENIINSELSLNNSRQLQSEPPSYPELEENFSSPIESIISEDELDNDQYSKVYG 481

Query: 842  XLFTPLEPNK-----------VEYSTEIPEIFKNTTENNTSNAPMQYH-----PERKRPG 885
                 +  +K           V Y+ EIP++FK T  N   N   + +     P    PG
Sbjct: 482  KRNNSIGQSKTSLSIKPCISEVTYTNEIPQLFKITDNNCIVNENYERYGFVEPPSYGEPG 541

Query: 886  LLHNVVDCSQEELFGDLLADGLMDTETAEQMFLDKYPVPELPIYLNSKYMTQIV--GEIN 943
            L + V+DC+Q+ LF     +G +D E AEQ+FL+KYPVP+LP++L+S +  ++    + +
Sbjct: 542  LENRVIDCNQDILFATFQQNGAVDVELAEQLFLEKYPVPDLPVFLDSHFSEKLFDNNDSS 601

Query: 944  QXXXXXXXXXXXXXXXXHIIPHVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTP 1001
            +                  IPHVNL H+LT+ I   MISVACTTRY+ KF+T ILY+P
Sbjct: 602  KNLNDMNGEDIQIKNNGQDIPHVNLNHVLTNKISNGMISVACTTRYKRKFVTHILYSP 659

>TPHA0K00530 Chr11 (105141..107081) [1941 bp, 646 aa] {ON} Anc_5.527
            YDR422C
          Length = 646

 Score =  119 bits (299), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 93/314 (29%), Positives = 139/314 (44%), Gaps = 41/314 (13%)

Query: 706  KMELVYNKDEKAWILPNLMLPPGIYQVQFLVN-SDLKHSDFLPTATDDFGNIVNWFEVLS 764
            ++ L Y+     W + +L LP G Y+  FL+N +D+ HS  + T  D FG  VN+FEV  
Sbjct: 354  RLPLKYDSLTHEWKISDLFLPAGYYEFSFLINETDVHHSLHICTKMDRFGKRVNYFEVPK 413

Query: 765  GYDFIEPFRDENISSADNSDGTLMQNIIPEKLKTISMTKMAG---NGSKGSTPRSNYTGX 821
                 EP +   +SSA      L      +  + I  +K +    N       R+ Y   
Sbjct: 414  YVRTFEPLQ---LSSA------LYTVTQADDRRHIECSKTSSEFLNLLDNYDIRTRYNAN 464

Query: 822  XXXXXXXXXXXXXXXXXXXXXLFTPLEPNKVEYSTEIPEIFKNTTEN-----NTSNAPMQ 876
                                   T    N  +Y+ +IPE+FK + +N       +     
Sbjct: 465  FYSHNESG---------------TGNNFNNNKYTNQIPELFKFSEKNIRELSTETEITFL 509

Query: 877  YHPERKRPGLLHNVVDCSQEELFGDLLADGLMDTETAEQMFLDKYPVPELPIYLNSKYMT 936
              P    P   +N+VDCSQE+LF  L  +G +D+  AEQ+ L +YPV ELPI+  +  M 
Sbjct: 510  EPPSYGEPSFYNNIVDCSQEKLFLSLQQNGAVDSYVAEQVILQRYPVSELPIFFENISME 569

Query: 937  QIVGE---INQXXXXXXXXXXXXXXXXHII-----PHVNLQHLLTSSIREEMISVACTTR 988
            ++      +N+                  I     PHV L HL+T  I   ++SVA TTR
Sbjct: 570  KLASHNNNLNKSHTNKHWLEGLTPNESDNITPKEPPHVILNHLVTQKISRNVVSVAVTTR 629

Query: 989  YEGKFLTQILYTPC 1002
            Y+ K++TQILY+P 
Sbjct: 630  YKQKYITQILYSPI 643

>TBLA0I03270 Chr9 complement(793849..795150) [1302 bp, 433 aa] {ON}
           Anc_3.517 YER027C
          Length = 433

 Score = 58.9 bits (141), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 40/58 (68%)

Query: 707 MELVYNKDEKAWILPNLMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLS 764
           + LV   D+   +   L LPPG ++ +F+V+++L+ SDFLPTATD  GN VN+ EV++
Sbjct: 186 IGLVPVPDQPGLLHVKLQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEVVA 243

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 25/37 (67%)

Query: 965  HVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTP 1001
            HV L HL TSSI+   + VA   RY+ K++TQILY P
Sbjct: 395  HVVLNHLATSSIKHNTLCVASIVRYKSKYVTQILYAP 431

>Kwal_47.19040 s47 complement(1073036..1074325) [1290 bp, 429 aa]
           {ON} YER027C (GAL83) - glucose repression protein, a
           component of the Snf1 complex [contig 188] FULL
          Length = 429

 Score = 58.2 bits (139), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 39/58 (67%)

Query: 707 MELVYNKDEKAWILPNLMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLS 764
           + LV   D+       L LPPG ++ +F+V+++L+ SDFLPTATD  GN VN+ E++S
Sbjct: 152 IGLVPVPDQPGLFHIKLQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEIVS 209

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 25/38 (65%)

Query: 965  HVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTPC 1002
            HV L HL TSSI+   + VA   RY+ K+ TQILY+P 
Sbjct: 391  HVVLNHLATSSIKHSTLCVASIVRYKRKYATQILYSPL 428

>Ecym_1210 Chr1 (423627..424979) [1353 bp, 450 aa] {ON} similar to
           Ashbya gossypii AER361C
          Length = 450

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 34/42 (80%)

Query: 723 LMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLS 764
           L LPPG ++ +F+V+++L+ SDFLPTATD  GN VN+ E+++
Sbjct: 217 LQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYMEIVA 258

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 26/40 (65%), Gaps = 1/40 (2%)

Query: 963  IP-HVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTP 1001
            IP HV L HL TSSI+   + VA   RY+ K+ TQILY P
Sbjct: 409  IPNHVVLNHLATSSIKHNTLCVASIVRYKSKYATQILYAP 448

>KLLA0B00583g Chr2 complement(44819..46279) [1461 bp, 486 aa] {ON}
           uniprot|Q00995 Kluyveromyces lactis FOG1 protein
          Length = 486

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/41 (53%), Positives = 33/41 (80%)

Query: 723 LMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVL 763
           L LPPG ++ +F+V+++L+ SDFLPTATD  GN VN+ E++
Sbjct: 241 LQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEIV 281

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 24/38 (63%)

Query: 965  HVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTPC 1002
            HV L HL TSSI+   + VA   RY+ K+ TQILY P 
Sbjct: 448  HVVLNHLATSSIKHNTLCVASIVRYKRKYATQILYAPL 485

>CAGL0A03696g Chr1 (377255..378502) [1248 bp, 415 aa] {ON} similar
           to uniprot|Q04739 Saccharomyces cerevisiae YER027c GAL83
           glucose repression protein
          Length = 415

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 36/47 (76%), Gaps = 2/47 (4%)

Query: 723 LMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEV--LSGYD 767
           L LPPG ++ +F+V+++L+ SDFLPTATD  GN VN+ E+  ++G D
Sbjct: 202 LQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEIAPVAGTD 248

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/41 (53%), Positives = 27/41 (65%), Gaps = 1/41 (2%)

Query: 963  IP-HVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTPC 1002
            IP HV L HL TSSI+   + VA   RY+ K++TQILY P 
Sbjct: 374  IPNHVILNHLATSSIKHNTLCVASIVRYKRKYVTQILYAPL 414

>KAFR0I02380 Chr9 (482219..483448) [1230 bp, 409 aa] {ON} Anc_3.517
           YER027C
          Length = 409

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 34/42 (80%)

Query: 723 LMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLS 764
           L LPPG ++ +F+V+++L+ SD+LPTATD  GN VN+ EV++
Sbjct: 178 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEVIA 219

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 24/38 (63%)

Query: 965  HVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTPC 1002
            HV L HL TSSI+   + VA   RY  K++TQILY P 
Sbjct: 371  HVILNHLATSSIKHNTLCVASIVRYRQKYVTQILYAPL 408

>KNAG0E01590 Chr5 complement(317054..318325) [1272 bp, 423 aa] {ON}
           Anc_3.517 YER027C
          Length = 423

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 34/42 (80%)

Query: 723 LMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLS 764
           L LPPG ++ +F+V+++L+ SD+LPTATD  GN VN+ EV++
Sbjct: 192 LQLPPGTHKFRFIVDNELRFSDYLPTATDQMGNFVNYLEVVA 233

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 24/38 (63%)

Query: 965  HVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTPC 1002
            HV L HL TSSI+   + VA   RY+ K+ TQILY P 
Sbjct: 385  HVILNHLATSSIKHNTLCVASIVRYKQKYATQILYAPL 422

>Smik_5.150 Chr5 complement(213879..215132) [1254 bp, 417 aa] {ON}
           YER027C (REAL)
          Length = 417

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 35/46 (76%)

Query: 723 LMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLSGYDF 768
           L LPPG ++ +F+V+++L+ SD+LPTATD  GN VN+ EV +  D+
Sbjct: 204 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEVTAPPDW 249

 Score = 48.5 bits (114), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 26/38 (68%)

Query: 965  HVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTPC 1002
            HV L HL TSSI+   + VA   RY+ K++TQILYTP 
Sbjct: 379  HVILNHLATSSIKHNTLCVASIVRYKQKYVTQILYTPL 416

>Kpol_195.2 s195 complement(4330..5637) [1308 bp, 435 aa] {ON}
           complement(4330..5637) [1308 nt, 436 aa]
          Length = 435

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 33/42 (78%)

Query: 723 LMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLS 764
           L LPPG ++ +F+V+++L+ SDFLPTATD  GN VN+ E ++
Sbjct: 178 LQLPPGTHKFRFIVDNELRFSDFLPTATDQMGNFVNYLEAVA 219

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 25/38 (65%)

Query: 965  HVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTPC 1002
            HV L HL TSSI+   + VA   RY+ K++TQILY P 
Sbjct: 397  HVVLNHLATSSIKHNTLCVASIVRYKRKYVTQILYAPL 434

>Suva_5.123 Chr5 complement(184865..186136) [1272 bp, 423 aa] {ON}
           YER027C (REAL)
          Length = 423

 Score = 55.5 bits (132), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 35/46 (76%)

Query: 723 LMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLSGYDF 768
           L LPPG ++ +F+V+++L+ SD+LPTATD  GN VN+ EV +  D+
Sbjct: 207 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEVTAPPDW 252

 Score = 48.5 bits (114), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 26/38 (68%)

Query: 965  HVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTPC 1002
            HV L HL TSSI+   + VA   RY+ K++TQILYTP 
Sbjct: 385  HVILNHLATSSIKHNTLCVASIVRYKQKYVTQILYTPL 422

>Skud_5.136 Chr5 complement(206871..208127) [1257 bp, 418 aa] {ON}
           YER027C (REAL)
          Length = 418

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 35/46 (76%)

Query: 723 LMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLSGYDF 768
           L LPPG ++ +F+V+++L+ SD+LPTATD  GN VN+ EV +  D+
Sbjct: 205 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEVSAPPDW 250

 Score = 48.1 bits (113), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/37 (56%), Positives = 26/37 (70%)

Query: 965  HVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTP 1001
            HV L HL TSSI+   + VA   RY+ K++TQILYTP
Sbjct: 380  HVILNHLATSSIKHNTLCVASIVRYKQKYVTQILYTP 416

>TPHA0A05810 Chr1 complement(1317530..1318804) [1275 bp, 424 aa]
           {ON} Anc_3.517 YER027C
          Length = 424

 Score = 55.1 bits (131), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 22/41 (53%), Positives = 32/41 (78%)

Query: 723 LMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVL 763
           L LPPG ++ +F+V+++L+ SDFLPTATD  GN VN+ E +
Sbjct: 183 LQLPPGTHKFRFIVDNELRFSDFLPTATDQMGNFVNYLEAV 223

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 25/38 (65%)

Query: 965  HVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTPC 1002
            HV L HL TSSI+   + VA   RY+ K++TQILY P 
Sbjct: 386  HVVLHHLATSSIKHNTLCVASIVRYKRKYVTQILYAPL 423

>YER027C Chr5 complement(208979..210232) [1254 bp, 417 aa] {ON}
           GAL83One of three possible beta-subunits of the Snf1
           kinase complex, allows nuclear localization of the Snf1
           kinase complex in the presence of a nonfermentable
           carbon source; contains glycogen-binding domain
          Length = 417

 Score = 55.1 bits (131), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 35/46 (76%)

Query: 723 LMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLSGYDF 768
           L LPPG ++ +F+V+++L+ SD+LPTATD  GN VN+ EV +  D+
Sbjct: 204 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEVSAPPDW 249

 Score = 48.1 bits (113), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 26/38 (68%)

Query: 965  HVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTPC 1002
            HV L HL TSSI+   + VA   RY+ K++TQILYTP 
Sbjct: 379  HVILNHLATSSIKHNTLCVASIVRYKQKYVTQILYTPL 416

>SAKL0F02002g Chr6 (167591..169102) [1512 bp, 503 aa] {ON} similar
           to gnl|GLV|CAGL0A03696g Candida glabrata CAGL0A03696g
           and similar to YER027C uniprot|Q04739 Saccharomyces
           cerevisiae YER027C GAL83 One of three possible
           beta-subunits of the Snf1 kinase complex allows nuclear
           localization of the Snf1 kinase complex in the presence
           of a nonfermentable carbon source contains
           glycogen-binding domain and similar to YGL208W
           uniprot|P34164 Saccharomyces cerevisiae YGL208W SIP2
           Member of a family of proteins including Sip1p and
           Gal83p that interact with Snf1p and Snf4p and are
           involved in the response to glucose starvation component
           of Snf1 protein complex involved in response to glucose
           starvation
          Length = 503

 Score = 55.1 bits (131), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 33/41 (80%)

Query: 723 LMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVL 763
           L LPPG ++ +F+V+++L+ SD+LPTATD  GN VN+ E++
Sbjct: 253 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEIV 293

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 24/37 (64%)

Query: 965  HVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTP 1001
            HV L HL TSSI+   + VA   RY+ K+ TQILY P
Sbjct: 465  HVVLNHLATSSIKHNTLCVASIVRYKSKYATQILYAP 501

>NCAS0E00620 Chr5 (106661..108163) [1503 bp, 500 aa] {ON} Anc_3.517
          Length = 500

 Score = 54.7 bits (130), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 37/56 (66%)

Query: 707 MELVYNKDEKAWILPNLMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEV 762
           + L+   D++      L LP G ++ +F+V+++LK SDFLPTATD  GN VN+ EV
Sbjct: 255 ISLIPVPDKQGLFHVKLQLPAGTHRFRFIVDNELKFSDFLPTATDQTGNFVNYLEV 310

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 26/38 (68%)

Query: 965  HVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTPC 1002
            HV L HL+T+SI+   + VA   RY+ K++TQILY P 
Sbjct: 462  HVVLNHLVTTSIKHNTLCVASIIRYKHKYVTQILYAPL 499

>NDAI0B06010 Chr2 complement(1460221..1461732) [1512 bp, 503 aa]
           {ON} Anc_3.517 YER027C
          Length = 503

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 32/40 (80%)

Query: 723 LMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEV 762
           L LPPG ++ +F+V+++L+ SD+LPTATD  GN VN+ E+
Sbjct: 251 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEI 290

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 25/38 (65%)

Query: 965  HVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTPC 1002
            HV L HL TSSI+   + VA   RY+ K++TQILY P 
Sbjct: 465  HVILNHLATSSIKHNTLCVASIVRYKRKYVTQILYAPL 502

>NCAS0F03730 Chr6 complement(750798..752096) [1299 bp, 432 aa] {ON}
           Anc_3.517 YER027C
          Length = 432

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 32/40 (80%)

Query: 723 LMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEV 762
           L LPPG ++ +F+V+++L+ SD+LPTATD  GN VN+ E+
Sbjct: 207 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEI 246

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 25/38 (65%)

Query: 965  HVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTPC 1002
            HV L HL TSSI+   + VA   RY+ K++TQILY P 
Sbjct: 394  HVILNHLATSSIKHNTLCVASIVRYKRKYVTQILYAPL 431

>AER361C Chr5 complement(1307677..1309104) [1428 bp, 475 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER027C
           (GAL83) and YGL208W (SIP2)
          Length = 475

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 33/42 (78%)

Query: 723 LMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLS 764
           L LPPG ++ +F+V+++L+ SDFL TATD  GN VN+ E++S
Sbjct: 236 LQLPPGTHRFRFIVDNELRFSDFLLTATDQMGNFVNYLEIVS 277

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 24/38 (63%)

Query: 965  HVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTPC 1002
            HV L HL TSSI+   + VA   RY+ K+ TQILY P 
Sbjct: 437  HVVLNHLATSSIKHNTLCVASIVRYKQKYATQILYAPL 474

>TDEL0D05850 Chr4 complement(1062927..1064141) [1215 bp, 404 aa]
           {ON} Anc_3.517 YER027C
          Length = 404

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 33/42 (78%)

Query: 723 LMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLS 764
           L LP G ++ +F+V+++L+ SD+LPTATD  GN VN+ EV++
Sbjct: 187 LQLPVGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEVIA 228

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/41 (53%), Positives = 27/41 (65%), Gaps = 1/41 (2%)

Query: 963  IP-HVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTPC 1002
            IP HV L HL TSSI+   + VA   RY+ K++TQILY P 
Sbjct: 363  IPNHVVLNHLATSSIKHNTLCVASIVRYKRKYVTQILYAPL 403

>ZYRO0E08404g Chr5 complement(672301..673347) [1047 bp, 348 aa] {ON}
           some similarities with uniprot|Q04739 Saccharomyces
           cerevisiae YER027C GAL83 One of three possible beta-
           subunits of the Snf1 kinase complex allows nuclear
           localization of the Snf1 kinase complex in the presence
           of a nonfermentable carbon source contains
           glycogen-binding domain and some similarities with
           YGL208W uniprot|P34164 Saccharomyces cerevisiae YGL208W
           SIP2 Member of a family of proteins including Sip1p and
           Gal83p that interact with Snf1p and Snf4p and are
           involved in the response to glucose starvation component
           of Snf1 protein complex involved in response to glucose
           starvation
          Length = 348

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 37/57 (64%)

Query: 709 LVYNKDEKAWILPNLMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLSG 765
           LV   D+   +   L LP G ++ +F+V+++L+ SD+LPTATD  GN VN+ E+  G
Sbjct: 141 LVPVPDQPGLLHAKLQLPIGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEIGRG 197

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 25/38 (65%)

Query: 965  HVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTPC 1002
            HV L HL TSSI+   + VA   RY+ K++TQILY P 
Sbjct: 310  HVVLNHLATSSIKHNTLCVASIVRYKRKYVTQILYAPL 347

>Suva_7.53 Chr7 (93895..95139) [1245 bp, 414 aa] {ON} YGL208W (REAL)
          Length = 414

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 37/56 (66%)

Query: 707 MELVYNKDEKAWILPNLMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEV 762
           + LV + D+       L L PG ++ +F+V+++L+ SDFLPTATD  GN VN+ EV
Sbjct: 189 IGLVPDSDKSGSFHVKLRLLPGTHRFRFVVDNELRVSDFLPTATDQMGNFVNYIEV 244

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 27/38 (71%)

Query: 965  HVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTPC 1002
            HV L HL+TSSI+   + V+   RY+ K++TQILYTP 
Sbjct: 374  HVVLNHLITSSIKHNTLCVSSIVRYKQKYVTQILYTPI 411

>YGL208W Chr7 (97338..98585) [1248 bp, 415 aa] {ON}  SIP2One of
           three beta subunits of the Snf1 serine/threonine protein
           kinase complex involved in the response to glucose
           starvation; null mutants exhibit accelerated aging;
           N-myristoylprotein localized to the cytoplasm and the
           plasma membrane
          Length = 415

 Score = 52.0 bits (123), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 31/40 (77%)

Query: 723 LMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEV 762
           L L PG ++ +F+V+++L+ SDFLPTATD  GN VN+ EV
Sbjct: 206 LRLLPGTHRFRFIVDNELRVSDFLPTATDQMGNFVNYIEV 245

 Score = 48.9 bits (115), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/37 (56%), Positives = 27/37 (72%)

Query: 965  HVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTP 1001
            HV L HL+TSSI+   + VA   RY+ K++TQILYTP
Sbjct: 375  HVVLNHLVTSSIKHNTLCVASIVRYKQKYVTQILYTP 411

>Smik_7.55 Chr7 (92235..93482) [1248 bp, 415 aa] {ON} YGL208W (REAL)
          Length = 415

 Score = 52.0 bits (123), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 31/40 (77%)

Query: 723 LMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEV 762
           L L PG ++ +F+V+++L+ SDFLPTATD  GN VN+ EV
Sbjct: 206 LRLLPGTHRFRFVVDNELRVSDFLPTATDQMGNFVNYIEV 245

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/41 (53%), Positives = 28/41 (68%), Gaps = 1/41 (2%)

Query: 963  IP-HVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTPC 1002
            IP HV L HL+TSSI+   + VA   RY+ K++TQILY P 
Sbjct: 372  IPNHVVLNHLITSSIKHNTLCVASIVRYKQKYVTQILYAPI 412

>KLTH0G01848g Chr7 (136780..138030) [1251 bp, 416 aa] {ON} similar
           to uniprot|P34164 Saccharomyces cerevisiae YGL208W SIP2
           Member of a family of proteins including Sip1p and
           Gal83p that interact with Snf1p and Snf4p and are
           involved in the response to glucose starvation component
           of Snf1 protein complex involved in response to glucose
           starvation and similar to YER027C uniprot|Q04739
           Saccharomyces cerevisiae YER027C GAL83 One of three
           possible beta-subunits of the Snf1 kinase complex allows
           nuclear localization of the Snf1 kinase complex in the
           presence of a nonfermentable carbon source contains
           glycogen-binding domain
          Length = 416

 Score = 52.0 bits (123), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 709 LVYNKDEKAWILPNLMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEV 762
           LV   D+       L LPPG ++ +F+V+++L+ SD+L TATD  GN VN+ E+
Sbjct: 154 LVPVADQPGVFHIKLQLPPGTHRFRFIVDNELRFSDYLATATDQMGNFVNYLEI 207

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 25/38 (65%)

Query: 965  HVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTPC 1002
            HV L HL TSSI+   + VA   RY+ K+ TQILY+P 
Sbjct: 378  HVVLNHLATSSIKHNTLCVASIVRYKRKYATQILYSPL 415

>Skud_7.60 Chr7 (102699..104024) [1326 bp, 441 aa] {ON} YGL208W
           (REAL)
          Length = 441

 Score = 52.0 bits (123), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 31/40 (77%)

Query: 723 LMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEV 762
           L L PG ++ +F+V+++L+ SDFLPTATD  GN VN+ EV
Sbjct: 232 LRLLPGTHRFRFIVDNELRVSDFLPTATDQMGNFVNYIEV 271

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 27/38 (71%)

Query: 965  HVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTPC 1002
            HV L HL+TSSI+   + VA   RY+ K++TQILYTP 
Sbjct: 401  HVVLNHLVTSSIKHNTLCVASIVRYKQKYVTQILYTPI 438

>KNAG0B00600 Chr2 (97910..99079) [1170 bp, 389 aa] {ON} Anc_3.517
           YER027C
          Length = 389

 Score = 51.6 bits (122), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 31/40 (77%)

Query: 723 LMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEV 762
           L LP G ++ +F+V+++L+ SDFLPTATD  GN VN+ EV
Sbjct: 193 LKLPVGTHKFRFVVDNELRFSDFLPTATDQTGNFVNYIEV 232

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 27/37 (72%)

Query: 965  HVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTP 1001
            +V L HLLTSSI+  M+ + C+ RY  K++TQ+ YTP
Sbjct: 351  YVTLNHLLTSSIKNNMLCLGCSVRYRQKYVTQVYYTP 387

>NDAI0I02890 Chr9 complement(682274..684022) [1749 bp, 582 aa] {ON}
           Anc_3.517 YER027C
          Length = 582

 Score = 51.6 bits (122), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 31/40 (77%)

Query: 723 LMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEV 762
           L LP G ++ +F+V+++L+ SD+LPTATD  GN VN+ EV
Sbjct: 280 LQLPEGTHRFRFIVDNELRFSDYLPTATDQTGNFVNYLEV 319

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/41 (53%), Positives = 28/41 (68%), Gaps = 1/41 (2%)

Query: 963  IP-HVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTPC 1002
            IP HV L HL+T+SI+   + VA   RY+ K+ TQILYTP 
Sbjct: 541  IPNHVVLNHLVTTSIKHNTLCVASIIRYKHKYATQILYTPL 581

>KNAG0B03690 Chr2 (708946..709926) [981 bp, 326 aa] {ON} Anc_5.527
           YDR422C
          Length = 326

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 706 KMELVYNKDEKAWILPNLMLPPGIYQVQFLVNSDLK-HSDFLPTATDDFGNIVNWFEVLS 764
           ++ L +  D   W+ P+L LPPG Y+ +F++N     HS++LP  T   G   N+F V+ 
Sbjct: 111 QIPLQFEGDSSEWVAPDLYLPPGEYKFRFVINDTCSMHSEYLPILTVGDGIAYNYFVVIE 170

Query: 765 GYDFIEP 771
             + +EP
Sbjct: 171 NDEVVEP 177

>KAFR0F04140 Chr6 complement(814903..815949) [1047 bp, 348 aa] {ON}
           Anc_3.517 YER027C
          Length = 348

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 33/45 (73%)

Query: 718 WILPNLMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEV 762
           W    L LPPG ++ +F+V+++L+ SD +P+ATD  GN+VN+ EV
Sbjct: 143 WARVRLKLPPGNHRFRFVVDNELRFSDDVPSATDSMGNLVNYIEV 187

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 17/38 (44%), Positives = 29/38 (76%)

Query: 965  HVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTPC 1002
            HV L HL+ +S++  M++++ TTRY+ KF+TQ+ Y+P 
Sbjct: 310  HVVLNHLIVNSVKSNMLAISTTTRYKEKFITQVCYSPI 347

>CAGL0K09350g Chr11 complement(922651..923949) [1299 bp, 432 aa]
           {ON} similar to uniprot|P34164 Saccharomyces cerevisiae
           YGL208w SIP2 or uniprot|Q04739 Saccharomyces cerevisiae
           YER027c GAL83
          Length = 432

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 29/40 (72%)

Query: 723 LMLPPGIYQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEV 762
           L L PG ++ +F+V++ L+ SD LPTATD  GN VN+ EV
Sbjct: 213 LQLAPGTHRFRFIVDNQLRFSDNLPTATDQMGNFVNYLEV 252

 Score = 39.3 bits (90), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 25/40 (62%), Gaps = 1/40 (2%)

Query: 963  IP-HVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTP 1001
            IP H  L HL+T+SI+   + VA   RY  K+++QI Y P
Sbjct: 392  IPNHSVLNHLVTTSIKHNTLCVATNNRYRQKYVSQIYYVP 431

>CAGL0L03652g Chr12 complement(419874..422297) [2424 bp, 807 aa]
           {ON} similar to uniprot|P39677 Saccharomyces cerevisiae
           YJL102w MEF2
          Length = 807

 Score = 32.3 bits (72), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%)

Query: 763 LSGYDFIEPFRDENISSADNSDGTLMQNIIPEKLKTIS 800
           +S Y  +EP  D +IS   N  GT+MQ++   +  TIS
Sbjct: 678 VSNYTLLEPVMDAHISVPQNDIGTVMQDLCSARTATIS 715

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.128    0.358 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 97,866,787
Number of extensions: 4207873
Number of successful extensions: 18839
Number of sequences better than 10.0: 186
Number of HSP's gapped: 19113
Number of HSP's successfully gapped: 233
Length of query: 1016
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 896
Effective length of database: 39,721,479
Effective search space: 35590445184
Effective search space used: 35590445184
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 71 (32.0 bits)