Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0D016405.528ON59941713131e-175
KAFR0C054005.528ON481451536e-10
KNAG0B036805.528ON482441529e-10
CAGL0H04631g5.528ON588431511e-09
Suva_13.1555.528ON645451502e-09
NDAI0C010605.528ON637431502e-09
ZYRO0D12584g5.528ON579431483e-09
NCAS0H025605.528ON587431457e-09
TDEL0A039205.528ON466441447e-09
TPHA0D023405.528ON506441448e-09
Smik_13.1445.528ON639431412e-08
YML007W (YAP1)5.528ON650431412e-08
KLLA0A01760g5.528ON5831251412e-08
Skud_13.1475.528ON665431403e-08
SAKL0G04950g5.528ON567451393e-08
Kpol_1023.975.528ON591431393e-08
KLTH0G03784g5.528ON569441394e-08
Kpol_1004.225.528ON475431375e-08
Kwal_47.186315.528ON584431368e-08
TBLA0G009305.528ON608341342e-07
TPHA0K005205.528ON560381215e-06
NDAI0H016105.528ON519401072e-04
YDR423C (CAD1)5.528ON409321044e-04
Suva_2.600singletonOFF382321020.001
Smik_4.6985.528ON39331990.002
NCAS0F011005.528ON47533980.003
CAGL0F03069g5.528ON48664810.28
Ecym_40645.528ON42668800.36
ADR195C5.528ON28862732.2
NCAS0A125302.493ON30424704.9
NOTE: 3 genes in the same pillar as TBLA0D01640 were not hit in these BLAST results
LIST: KAFR0E03290 KNAG0C03210 Skud_4.697

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0D01640
         (599 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0D01640 Chr4 (402610..404409) [1800 bp, 599 aa] {ON} Anc_5.5...   510   e-175
KAFR0C05400 Chr3 complement(1082243..1083688) [1446 bp, 481 aa] ...    64   6e-10
KNAG0B03680 Chr2 (707204..708652) [1449 bp, 482 aa] {ON} Anc_5.5...    63   9e-10
CAGL0H04631g Chr8 complement(442448..444214) [1767 bp, 588 aa] {...    63   1e-09
Suva_13.155 Chr13 (244425..246362) [1938 bp, 645 aa] {ON} YML007...    62   2e-09
NDAI0C01060 Chr3 (206067..207980) [1914 bp, 637 aa] {ON} Anc_5.5...    62   2e-09
ZYRO0D12584g Chr4 complement(1064627..1066366) [1740 bp, 579 aa]...    62   3e-09
NCAS0H02560 Chr8 complement(509179..510942) [1764 bp, 587 aa] {O...    60   7e-09
TDEL0A03920 Chr1 complement(703498..704898) [1401 bp, 466 aa] {O...    60   7e-09
TPHA0D02340 Chr4 complement(483713..485233) [1521 bp, 506 aa] {O...    60   8e-09
Smik_13.144 Chr13 (242566..244485) [1920 bp, 639 aa] {ON} YML007...    59   2e-08
YML007W Chr13 (253848..255800) [1953 bp, 650 aa] {ON}  YAP1Basic...    59   2e-08
KLLA0A01760g Chr1 (154859..156610) [1752 bp, 583 aa] {ON} unipro...    59   2e-08
Skud_13.147 Chr13 (240056..242053) [1998 bp, 665 aa] {ON} YML007...    59   3e-08
SAKL0G04950g Chr7 complement(409365..411068) [1704 bp, 567 aa] {...    58   3e-08
Kpol_1023.97 s1023 (225050..226825) [1776 bp, 591 aa] {ON} (2250...    58   3e-08
KLTH0G03784g Chr7 complement(300734..302443) [1710 bp, 569 aa] {...    58   4e-08
Kpol_1004.22 s1004 complement(45952..47379) [1428 bp, 475 aa] {O...    57   5e-08
Kwal_47.18631 s47 (904593..906347) [1755 bp, 584 aa] {ON} YML007...    57   8e-08
TBLA0G00930 Chr7 (226547..228373) [1827 bp, 608 aa] {ON} Anc_5.5...    56   2e-07
TPHA0K00520 Chr11 (102027..103709) [1683 bp, 560 aa] {ON} Anc_5....    51   5e-06
NDAI0H01610 Chr8 complement(390369..391928) [1560 bp, 519 aa] {O...    46   2e-04
YDR423C Chr4 complement(1318046..1319275) [1230 bp, 409 aa] {ON}...    45   4e-04
Suva_2.600 Chr2 complement(1070824..1071000,1071004..1071024,107...    44   0.001
Smik_4.698 Chr4 complement(1238807..1239642,1239673..1240018) [1...    43   0.002
NCAS0F01100 Chr6 complement(218116..219543) [1428 bp, 475 aa] {O...    42   0.003
CAGL0F03069g Chr6 complement(301650..303110) [1461 bp, 486 aa] {...    36   0.28 
Ecym_4064 Chr4 (141770..143050) [1281 bp, 426 aa] {ON} similar t...    35   0.36 
ADR195C Chr4 complement(1041896..1042762) [867 bp, 288 aa] {ON} ...    33   2.2  
NCAS0A12530 Chr1 (2472725..2473639) [915 bp, 304 aa] {ON}              32   4.9  

>TBLA0D01640 Chr4 (402610..404409) [1800 bp, 599 aa] {ON} Anc_5.528
           YDR423C
          Length = 599

 Score =  510 bits (1313), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 274/417 (65%), Positives = 274/417 (65%)

Query: 183 PYNGFANLNYSFLQXXXXXXXXXXXXXXPLSFTLHXXXXXXXXXXXXXXXTILSANKESP 242
           PYNGFANLNYSFLQ              PLSFTLH               TILSANKESP
Sbjct: 183 PYNGFANLNYSFLQTTSSTTAYNTNTSSPLSFTLHSPSNNNNHLMNSNNSTILSANKESP 242

Query: 243 ELYLKNSTSPNDLNSTNLQSDINAYWEGQNLDLLNSSSNPILSTNLKNISATSGLXXXXX 302
           ELYLKNSTSPNDLNSTNLQSDINAYWEGQNLDLLNSSSNPILSTNLKNISATSGL     
Sbjct: 243 ELYLKNSTSPNDLNSTNLQSDINAYWEGQNLDLLNSSSNPILSTNLKNISATSGLNNMIN 302

Query: 303 XXXXXXXXXXXXXKAXXXXXXXXXXXXXDGKSGIMDAPIDLNSMNWFNTDIETFNFDNQF 362
                        KA             DGKSGIMDAPIDLNSMNWFNTDIETFNFDNQF
Sbjct: 303 VANNNSSNSNPNSKASTITSNTTTTSTSDGKSGIMDAPIDLNSMNWFNTDIETFNFDNQF 362

Query: 363 DEQISKFCLKLNSACGNLSYQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHGDLKNL 422
           DEQISKFCLKLNSACGNLSYQ                                HGDLKNL
Sbjct: 363 DEQISKFCLKLNSACGNLSYQLTTTANNNAANIPINNNDLNELININTNDEEDHGDLKNL 422

Query: 423 NDVFENKFSVQQXXXXXXXXXXXXXXXXXXXXXXXXTPINSFNVNINDVETNLAFPNQTL 482
           NDVFENKFSVQQ                        TPINSFNVNINDVETNLAFPNQTL
Sbjct: 423 NDVFENKFSVQQSINNNNNDNNNNNSSENWNFNLSSTPINSFNVNINDVETNLAFPNQTL 482

Query: 483 LQDPSINVDKFEFPISPANNLNVSLNQQDKSNISXXXXXXXXXXNEMVPADPEMLPCTKI 542
           LQDPSINVDKFEFPISPANNLNVSLNQQDKSNIS          NEMVPADPEMLPCTKI
Sbjct: 483 LQDPSINVDKFEFPISPANNLNVSLNQQDKSNISDVDDDEDDDDNEMVPADPEMLPCTKI 542

Query: 543 WDRITALPKYTSADIENLCNELMSKAKCXXXXXXXXXXXXXXXXXNEKKSNSRHFQM 599
           WDRITALPKYTSADIENLCNELMSKAKC                 NEKKSNSRHFQM
Sbjct: 543 WDRITALPKYTSADIENLCNELMSKAKCSDKGVVVSSLDVDKVLLNEKKSNSRHFQM 599

 Score =  128 bits (322), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 64/92 (69%), Positives = 64/92 (69%)

Query: 23  KVQKDSNAELKSKRTAQNRAAQRAFXXXXXXXXXXXXXXXXXXXXVCRAHESETSFLRSQ 82
           KVQKDSNAELKSKRTAQNRAAQRAF                    VCRAHESETSFLRSQ
Sbjct: 23  KVQKDSNAELKSKRTAQNRAAQRAFRERKEKKMKSLEEKVVELEKVCRAHESETSFLRSQ 82

Query: 83  LILFGTELRKQHNTGNTPXXXXXXXXYRNRHK 114
           LILFGTELRKQHNTGNTP        YRNRHK
Sbjct: 83  LILFGTELRKQHNTGNTPSNNNSISNYRNRHK 114

>KAFR0C05400 Chr3 complement(1082243..1083688) [1446 bp, 481 aa]
           {ON} Anc_5.528 YDR423C
          Length = 481

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 26/45 (57%), Positives = 36/45 (80%), Gaps = 1/45 (2%)

Query: 527 NEMVPA-DPEMLPCTKIWDRITALPKYTSADIENLCNELMSKAKC 570
           N++VP+ D  +L C+++WDRITA PKY+  DI+ LC ELM+KAKC
Sbjct: 416 NDVVPSKDKNLLRCSEVWDRITAHPKYSDIDIDGLCGELMAKAKC 460

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 32/62 (51%)

Query: 31  ELKSKRTAQNRAAQRAFXXXXXXXXXXXXXXXXXXXXVCRAHESETSFLRSQLILFGTEL 90
           E K KRTAQNRAAQRAF                    + + +E E+ FLRSQLI    EL
Sbjct: 45  EAKLKRTAQNRAAQRAFRERKERKMKELEAKVDHLSNIQKQNEIESEFLRSQLITLVKEL 104

Query: 91  RK 92
           +K
Sbjct: 105 KK 106

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 21/26 (80%)

Query: 356 FNFDNQFDEQISKFCLKLNSACGNLS 381
           FNF++QFDE+++ FC+K+N  CG  S
Sbjct: 265 FNFEDQFDEKVTDFCIKMNQVCGTRS 290

>KNAG0B03680 Chr2 (707204..708652) [1449 bp, 482 aa] {ON} Anc_5.528
           YDR423C
          Length = 482

 Score = 63.2 bits (152), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 36/44 (81%), Gaps = 1/44 (2%)

Query: 528 EMVPA-DPEMLPCTKIWDRITALPKYTSADIENLCNELMSKAKC 570
           ++VP+ D ++L C++IWDRITA PKY+  DI+ LC ELM+KAKC
Sbjct: 418 QVVPSKDGKLLKCSEIWDRITAHPKYSDLDIDGLCGELMTKAKC 461

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 31/64 (48%)

Query: 29  NAELKSKRTAQNRAAQRAFXXXXXXXXXXXXXXXXXXXXVCRAHESETSFLRSQLILFGT 88
           + E + KRT QNRAAQRAF                    + + +E E+ FLR QL+    
Sbjct: 46  DKEARMKRTEQNRAAQRAFRERKERKMKELEAKVDKLTRIQKQNEVESEFLRGQLVTLVH 105

Query: 89  ELRK 92
           EL+K
Sbjct: 106 ELKK 109

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 19/24 (79%)

Query: 356 FNFDNQFDEQISKFCLKLNSACGN 379
             FD QFDEQ+S FC+++N ACG+
Sbjct: 233 ITFDTQFDEQVSDFCVRMNEACGS 256

>CAGL0H04631g Chr8 complement(442448..444214) [1767 bp, 588 aa] {ON}
           similar to uniprot|P19880 Saccharomyces cerevisiae
           YML007w YAP1
          Length = 588

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 1/43 (2%)

Query: 529 MVPA-DPEMLPCTKIWDRITALPKYTSADIENLCNELMSKAKC 570
           +VP+ D  +L C++IWDRITA PKY+  DI+ LC+ELM+KAKC
Sbjct: 525 VVPSRDDGLLRCSEIWDRITAHPKYSDIDIDGLCSELMAKAKC 567

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 31/62 (50%)

Query: 31 ELKSKRTAQNRAAQRAFXXXXXXXXXXXXXXXXXXXXVCRAHESETSFLRSQLILFGTEL 90
          E + KR AQNRAAQ+AF                    + + +E ET+FLR QL +   EL
Sbjct: 26 ETRMKRVAQNRAAQKAFRERKERKMKELERKVVDLENLTKLNEVETNFLRDQLSILVKEL 85

Query: 91 RK 92
          RK
Sbjct: 86 RK 87

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 19/23 (82%)

Query: 356 FNFDNQFDEQISKFCLKLNSACG 378
            +F+N FDEQ+S+FC KLN ACG
Sbjct: 239 IDFNNFFDEQVSEFCTKLNQACG 261

>Suva_13.155 Chr13 (244425..246362) [1938 bp, 645 aa] {ON} YML007W
           (REAL)
          Length = 645

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 25/45 (55%), Positives = 36/45 (80%), Gaps = 1/45 (2%)

Query: 527 NEMVPA-DPEMLPCTKIWDRITALPKYTSADIENLCNELMSKAKC 570
           NE+VP+ +  +L C++IWDRIT  PKY+  D++ LC+ELM+KAKC
Sbjct: 580 NEVVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKC 624

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 36/68 (52%)

Query: 25  QKDSNAELKSKRTAQNRAAQRAFXXXXXXXXXXXXXXXXXXXXVCRAHESETSFLRSQLI 84
           ++D + E K KRTAQNRAAQRAF                    + + +E E +FLR QL+
Sbjct: 59  KQDLDPETKLKRTAQNRAAQRAFRERKERKMKELEKKVHSLESIQQENEVEATFLRDQLV 118

Query: 85  LFGTELRK 92
              +EL+K
Sbjct: 119 TLVSELKK 126

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/32 (62%), Positives = 25/32 (78%), Gaps = 3/32 (9%)

Query: 347 NWFNTDIETFNFDNQFDEQISKFCLKLNSACG 378
           N F+ D   FNF+NQFDEQ+S+FC K+N ACG
Sbjct: 286 NMFSND---FNFENQFDEQVSEFCSKMNQACG 314

>NDAI0C01060 Chr3 (206067..207980) [1914 bp, 637 aa] {ON} Anc_5.528
           YDR423C
          Length = 637

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 1/43 (2%)

Query: 529 MVPA-DPEMLPCTKIWDRITALPKYTSADIENLCNELMSKAKC 570
           +VP+ D  +L C++IWDRITA PKY+  DI+ LC+ELM+KAKC
Sbjct: 574 IVPSRDGGLLRCSEIWDRITAHPKYSELDIDGLCSELMTKAKC 616

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 33/62 (53%)

Query: 31  ELKSKRTAQNRAAQRAFXXXXXXXXXXXXXXXXXXXXVCRAHESETSFLRSQLILFGTEL 90
           E ++KRTAQNRAAQRAF                    + + +E E+ FLRSQLI    EL
Sbjct: 75  EARNKRTAQNRAAQRAFRERKERKMKELEEKVANLTKIQKQNEIESEFLRSQLITLVNEL 134

Query: 91  RK 92
           +K
Sbjct: 135 KK 136

 Score = 38.9 bits (89), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 22/27 (81%)

Query: 355 TFNFDNQFDEQISKFCLKLNSACGNLS 381
           +F+F+++FDEQ+S FC K++ ACG  S
Sbjct: 311 SFDFNDKFDEQVSDFCGKMSMACGTRS 337

>ZYRO0D12584g Chr4 complement(1064627..1066366) [1740 bp, 579 aa]
           {ON} weakly similar to uniprot|P19880 YML007W
           Saccharomyces cerevisiae YAP1 bZip transcription factor
           required for oxidative stress tolerance
          Length = 579

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 24/43 (55%), Positives = 35/43 (81%), Gaps = 1/43 (2%)

Query: 529 MVPA-DPEMLPCTKIWDRITALPKYTSADIENLCNELMSKAKC 570
           +VP+ D ++L C+++WDRIT+ PKY+  DI+ LC ELM+KAKC
Sbjct: 516 VVPSSDGKLLKCSEVWDRITSHPKYSDMDIDGLCQELMAKAKC 558

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 34/64 (53%)

Query: 29  NAELKSKRTAQNRAAQRAFXXXXXXXXXXXXXXXXXXXXVCRAHESETSFLRSQLILFGT 88
           ++E KSKRTAQNRAAQRAF                    + +    ET FLRSQL+   T
Sbjct: 45  DSEAKSKRTAQNRAAQRAFRERKEKKMKELEDKVHALEELNQQSLVETEFLRSQLVTLVT 104

Query: 89  ELRK 92
           EL++
Sbjct: 105 ELKR 108

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 26/39 (66%), Gaps = 4/39 (10%)

Query: 340 PIDLNSMNWFNTDIETFNFDNQFDEQISKFCLKLNSACG 378
           P D +S+ + N     FNF+++FDEQ+S+FC KL   CG
Sbjct: 302 PGDYDSVTFSNQ----FNFNDKFDEQVSEFCTKLGQVCG 336

>NCAS0H02560 Chr8 complement(509179..510942) [1764 bp, 587 aa] {ON}
           Anc_5.528 YDR423C
          Length = 587

 Score = 60.5 bits (145), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 35/43 (81%), Gaps = 1/43 (2%)

Query: 529 MVPA-DPEMLPCTKIWDRITALPKYTSADIENLCNELMSKAKC 570
           +VP+ D  +L C++IWDRI+A PKY+  DI+ LC+ELM+KAKC
Sbjct: 524 IVPSRDGGLLRCSEIWDRISAHPKYSDLDIDGLCSELMTKAKC 566

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 35/69 (50%)

Query: 24  VQKDSNAELKSKRTAQNRAAQRAFXXXXXXXXXXXXXXXXXXXXVCRAHESETSFLRSQL 83
            +K  + E K+KRTAQNRAAQRAF                    + + +E E+ FLR QL
Sbjct: 59  TKKQLDIEAKNKRTAQNRAAQRAFRERKERKMKELEEKVNNLTKIQKQNEIESEFLRGQL 118

Query: 84  ILFGTELRK 92
           I    EL+K
Sbjct: 119 ITLVNELKK 127

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 13/23 (56%), Positives = 18/23 (78%)

Query: 356 FNFDNQFDEQISKFCLKLNSACG 378
           F+  ++FDEQ+S FC K+N ACG
Sbjct: 284 FDVTDKFDEQVSDFCGKMNMACG 306

>TDEL0A03920 Chr1 complement(703498..704898) [1401 bp, 466 aa] {ON}
           Anc_5.528 YDR423C
          Length = 466

 Score = 60.1 bits (144), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 24/44 (54%), Positives = 36/44 (81%), Gaps = 1/44 (2%)

Query: 528 EMVPA-DPEMLPCTKIWDRITALPKYTSADIENLCNELMSKAKC 570
           ++VP+ D ++L C+++WDRIT  PKY++ DI+ LC ELM+KAKC
Sbjct: 401 DVVPSRDGKLLKCSEVWDRITTHPKYSAIDIDGLCGELMTKAKC 444

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 17/23 (73%), Positives = 21/23 (91%)

Query: 356 FNFDNQFDEQISKFCLKLNSACG 378
           FNFD+QFDEQ+S+FC K+N ACG
Sbjct: 249 FNFDDQFDEQVSQFCTKMNKACG 271

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 33/68 (48%)

Query: 25  QKDSNAELKSKRTAQNRAAQRAFXXXXXXXXXXXXXXXXXXXXVCRAHESETSFLRSQLI 84
           +K  + E K+KRTAQNRAAQRAF                      R    E+ FLRSQL+
Sbjct: 51  RKPLDEETKNKRTAQNRAAQRAFRERKEKKMKELEDKVQSLEQANRDTVVESEFLRSQLL 110

Query: 85  LFGTELRK 92
               EL+K
Sbjct: 111 TLVNELKK 118

>TPHA0D02340 Chr4 complement(483713..485233) [1521 bp, 506 aa] {ON}
           Anc_5.528 YDR423C
          Length = 506

 Score = 60.1 bits (144), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 1/44 (2%)

Query: 528 EMVP-ADPEMLPCTKIWDRITALPKYTSADIENLCNELMSKAKC 570
           ++VP  D  +L C +IWDRIT  P+Y+  DI+ LC ELM+ AKC
Sbjct: 442 QIVPLTDGRLLECGEIWDRITTYPRYSDIDIDGLCEELMASAKC 485

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 36/70 (51%)

Query: 23 KVQKDSNAELKSKRTAQNRAAQRAFXXXXXXXXXXXXXXXXXXXXVCRAHESETSFLRSQ 82
          K ++ +NA+ + KR AQNRAAQ+AF                    +   +E ET FLR+Q
Sbjct: 9  KDKEQNNADYRMKRIAQNRAAQKAFRERKEKKMKELQEKVRKLENINEKNEIETVFLRTQ 68

Query: 83 LILFGTELRK 92
          L+    EL+K
Sbjct: 69 LLSLVNELKK 78

 Score = 34.7 bits (78), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 3/33 (9%)

Query: 347 NWFNTDIETFNFDNQFDEQISKFCLKLNSACGN 379
           N F+T+   F+F N+FDEQ+S FC K+N    N
Sbjct: 262 NLFSTE---FDFANEFDEQVSTFCAKMNKTFEN 291

>Smik_13.144 Chr13 (242566..244485) [1920 bp, 639 aa] {ON} YML007W
           (REAL)
          Length = 639

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 34/43 (79%), Gaps = 1/43 (2%)

Query: 529 MVPA-DPEMLPCTKIWDRITALPKYTSADIENLCNELMSKAKC 570
           +VP+ +  +L C++IWDRIT  PKY+  D++ LC+ELM+KAKC
Sbjct: 576 VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKC 618

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 35/68 (51%)

Query: 25  QKDSNAELKSKRTAQNRAAQRAFXXXXXXXXXXXXXXXXXXXXVCRAHESETSFLRSQLI 84
           ++D + E K KRTAQNRAAQRAF                    + + +E E +FLR QL+
Sbjct: 59  KQDLDPETKQKRTAQNRAAQRAFRERKERKMKELEKKVQSLESIQQQNEVEATFLRDQLV 118

Query: 85  LFGTELRK 92
               EL+K
Sbjct: 119 TLVNELKK 126

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 24/32 (75%), Gaps = 3/32 (9%)

Query: 347 NWFNTDIETFNFDNQFDEQISKFCLKLNSACG 378
           N F+ D   FNF+NQFDEQ+S+FC K+N  CG
Sbjct: 281 NLFSND---FNFENQFDEQVSEFCSKMNQVCG 309

>YML007W Chr13 (253848..255800) [1953 bp, 650 aa] {ON}  YAP1Basic
           leucine zipper (bZIP) transcription factor required for
           oxidative stress tolerance; activated by H2O2 through
           the multistep formation of disulfide bonds and transit
           from the cytoplasm to the nucleus; mediates resistance
           to cadmium
          Length = 650

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 34/43 (79%), Gaps = 1/43 (2%)

Query: 529 MVPA-DPEMLPCTKIWDRITALPKYTSADIENLCNELMSKAKC 570
           +VP+ +  +L C++IWDRIT  PKY+  D++ LC+ELM+KAKC
Sbjct: 587 VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKC 629

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 34/67 (50%)

Query: 26  KDSNAELKSKRTAQNRAAQRAFXXXXXXXXXXXXXXXXXXXXVCRAHESETSFLRSQLIL 85
           +D + E K KRTAQNRAAQRAF                    + + +E E +FLR QLI 
Sbjct: 60  QDLDPETKQKRTAQNRAAQRAFRERKERKMKELEKKVQSLESIQQQNEVEATFLRDQLIT 119

Query: 86  FGTELRK 92
              EL+K
Sbjct: 120 LVNELKK 126

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 24/32 (75%), Gaps = 3/32 (9%)

Query: 347 NWFNTDIETFNFDNQFDEQISKFCLKLNSACG 378
           N F+ D   FNF+NQFDEQ+S+FC K+N  CG
Sbjct: 283 NMFSND---FNFENQFDEQVSEFCSKMNQVCG 311

>KLLA0A01760g Chr1 (154859..156610) [1752 bp, 583 aa] {ON}
           uniprot|P56095 Kluyveromyces lactis KLLA0A01760g YAP1
           AP- 1-like transcription factor
          Length = 583

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 61/125 (48%), Gaps = 34/125 (27%)

Query: 471 VETNLAFPNQTLLQDPSINVDKFE----------------------FPI--SPANNLNVS 506
           ++T LAFP+     DP +++ K E                       P+   PA N   S
Sbjct: 447 IDTGLAFPD---YDDPLLDILKEEQENEQVEGDSDPIQALINEEPSMPLCHDPAANAGAS 503

Query: 507 LNQQDKSNISXXXXXXXXXXNEMVPA-DPEMLPCTKIWDRITALPKYTSADIENLCNELM 565
           +++ DK               +++P+ D ++L C+++WDRITA P+Y+  DI+ LC EL 
Sbjct: 504 VSETDK------LSNQEEIVQDIIPSNDGKLLKCSEVWDRITAHPRYSDLDIDGLCLELR 557

Query: 566 SKAKC 570
           +KAKC
Sbjct: 558 TKAKC 562

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 31/62 (50%)

Query: 31  ELKSKRTAQNRAAQRAFXXXXXXXXXXXXXXXXXXXXVCRAHESETSFLRSQLILFGTEL 90
           E K KRTAQNRAAQRAF                    + +  E ET FLR+Q+    +EL
Sbjct: 52  EAKDKRTAQNRAAQRAFRERRERKMKELEDKVSQLESLNKQSELETKFLRNQVTNLLSEL 111

Query: 91  RK 92
           ++
Sbjct: 112 KR 113

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 26/41 (63%), Gaps = 3/41 (7%)

Query: 344 NSMNWFNTD---IETFNFDNQFDEQISKFCLKLNSACGNLS 381
           N++N + T       F+FD+QFDE +S FC KL+ ACG  S
Sbjct: 236 NTLNLYQTQSNVTSEFDFDSQFDESVSSFCSKLSMACGTKS 276

>Skud_13.147 Chr13 (240056..242053) [1998 bp, 665 aa] {ON} YML007W
           (REAL)
          Length = 665

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 34/43 (79%), Gaps = 1/43 (2%)

Query: 529 MVPA-DPEMLPCTKIWDRITALPKYTSADIENLCNELMSKAKC 570
           +VP+ +  +L C++IWDRIT  PKY+  D++ LC+ELM+KAKC
Sbjct: 602 VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKC 644

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 34/67 (50%)

Query: 26  KDSNAELKSKRTAQNRAAQRAFXXXXXXXXXXXXXXXXXXXXVCRAHESETSFLRSQLIL 85
           +D + E K KRTAQNRAAQRAF                    + + +E E +FLR QL+ 
Sbjct: 60  QDLDPETKQKRTAQNRAAQRAFRERKERKMMELEKKVQGLENIQQQNEVEATFLRDQLVT 119

Query: 86  FGTELRK 92
              EL+K
Sbjct: 120 LVNELKK 126

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 16/23 (69%), Positives = 20/23 (86%)

Query: 356 FNFDNQFDEQISKFCLKLNSACG 378
           FNF+NQFDEQ+S+FC K+N  CG
Sbjct: 284 FNFENQFDEQVSEFCSKMNQVCG 306

>SAKL0G04950g Chr7 complement(409365..411068) [1704 bp, 567 aa] {ON}
           weakly similar to uniprot|P19880 YML007W Saccharomyces
           cerevisiae YAP1 bZip transcription factor required for
           oxidative stress tolerance
          Length = 567

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 35/45 (77%), Gaps = 1/45 (2%)

Query: 527 NEMVPA-DPEMLPCTKIWDRITALPKYTSADIENLCNELMSKAKC 570
           +++VP+ D ++L C +IWDRIT+ PKY+  DI+ LC EL +KAKC
Sbjct: 502 DDVVPSRDGKLLKCGEIWDRITSHPKYSDLDIDGLCMELRTKAKC 546

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 33/62 (53%)

Query: 31  ELKSKRTAQNRAAQRAFXXXXXXXXXXXXXXXXXXXXVCRAHESETSFLRSQLILFGTEL 90
           E K+KRTAQNRAAQRAF                    V   +E ET FLRSQL+   +EL
Sbjct: 57  EAKNKRTAQNRAAQRAFRERKERKMKELEDKVTHLETVREQNEVETEFLRSQLMTLISEL 116

Query: 91  RK 92
           +K
Sbjct: 117 KK 118

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 13/23 (56%), Positives = 20/23 (86%)

Query: 356 FNFDNQFDEQISKFCLKLNSACG 378
           F+F++ FDEQ+S+FC ++N ACG
Sbjct: 268 FDFESHFDEQVSEFCTRMNQACG 290

>Kpol_1023.97 s1023 (225050..226825) [1776 bp, 591 aa] {ON}
           (225050..226825) [1776 nt, 592 aa]
          Length = 591

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 33/43 (76%), Gaps = 1/43 (2%)

Query: 529 MVP-ADPEMLPCTKIWDRITALPKYTSADIENLCNELMSKAKC 570
           ++P +D ++L C+++WDRITA P+Y+  DI+ LC ELM  AKC
Sbjct: 528 VIPTSDGKLLKCSEVWDRITAHPRYSDIDIDGLCQELMHNAKC 570

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 26/62 (41%), Positives = 34/62 (54%)

Query: 31  ELKSKRTAQNRAAQRAFXXXXXXXXXXXXXXXXXXXXVCRAHESETSFLRSQLILFGTEL 90
           E+K+KRTAQNRAAQRAF                    V + ++ E+ FLR+QL L   EL
Sbjct: 55  EVKNKRTAQNRAAQRAFRERKERKMKELEDKVHELEKVKQQNDVESEFLRNQLTLMIDEL 114

Query: 91  RK 92
           +K
Sbjct: 115 KK 116

 Score = 44.3 bits (103), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 20/23 (86%)

Query: 356 FNFDNQFDEQISKFCLKLNSACG 378
           FNFD+ FD+Q+S FC+K+N ACG
Sbjct: 293 FNFDDHFDQQVSSFCVKMNQACG 315

>KLTH0G03784g Chr7 complement(300734..302443) [1710 bp, 569 aa] {ON}
           weakly similar to uniprot|P19880 YML007W Saccharomyces
           cerevisiae YAP1 bZip transcription factor required for
           oxidative stress tolerance
          Length = 569

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 34/44 (77%), Gaps = 1/44 (2%)

Query: 528 EMVPA-DPEMLPCTKIWDRITALPKYTSADIENLCNELMSKAKC 570
           ++VPA D  +L C++IWDRITA PKY+  DI+ LC EL +KAKC
Sbjct: 505 DVVPARDGLLLKCSEIWDRITAHPKYSDIDIDGLCMELRTKAKC 548

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 34/68 (50%)

Query: 25 QKDSNAELKSKRTAQNRAAQRAFXXXXXXXXXXXXXXXXXXXXVCRAHESETSFLRSQLI 84
          +K  + E K+KRTAQNRAAQRAF                    V    E E+ FLRSQL 
Sbjct: 27 RKPLDTEAKNKRTAQNRAAQRAFRERKERKMRELEEQVERLEKVREQSEMESEFLRSQLQ 86

Query: 85 LFGTELRK 92
          +   E++K
Sbjct: 87 MLIAEIQK 94

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 17/23 (73%)

Query: 356 FNFDNQFDEQISKFCLKLNSACG 378
           F+F+  FDEQ+S FC ++N  CG
Sbjct: 269 FDFNTHFDEQVSVFCTQMNEVCG 291

>Kpol_1004.22 s1004 complement(45952..47379) [1428 bp, 475 aa] {ON}
           complement(45952..47379) [1428 nt, 476 aa]
          Length = 475

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 32/43 (74%), Gaps = 1/43 (2%)

Query: 529 MVPA-DPEMLPCTKIWDRITALPKYTSADIENLCNELMSKAKC 570
           +VP+ D +++ C++IWDRIT  P+YT  DI+ LC ELM  AKC
Sbjct: 412 VVPSTDSQLMRCSEIWDRITTNPRYTDLDIDGLCEELMFSAKC 454

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 39/71 (54%), Gaps = 1/71 (1%)

Query: 23  KVQK-DSNAELKSKRTAQNRAAQRAFXXXXXXXXXXXXXXXXXXXXVCRAHESETSFLRS 81
           K++K D +AE + +RTAQNRAAQRAF                    + + +E ET FLRS
Sbjct: 33  KIRKNDIDAEARIRRTAQNRAAQRAFRERKEKKMKELENKVNSLENIHQKNEVETEFLRS 92

Query: 82  QLILFGTELRK 92
           Q++    EL+K
Sbjct: 93  QVLTLVNELKK 103

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 14/19 (73%), Positives = 17/19 (89%)

Query: 356 FNFDNQFDEQISKFCLKLN 374
           FNF+NQFDEQ+S FC K+N
Sbjct: 191 FNFNNQFDEQVSTFCAKMN 209

>Kwal_47.18631 s47 (904593..906347) [1755 bp, 584 aa] {ON} YML007W
           (YAP1) - jun-like transcription factor [contig 192] FULL
          Length = 584

 Score = 57.0 bits (136), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 24/43 (55%), Positives = 33/43 (76%), Gaps = 1/43 (2%)

Query: 529 MVPA-DPEMLPCTKIWDRITALPKYTSADIENLCNELMSKAKC 570
           +VPA D  +L C+++WDRIT+ PKY+  DI+ LC EL +KAKC
Sbjct: 521 VVPARDGTLLKCSEVWDRITSHPKYSDIDIDGLCLELRTKAKC 563

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 33/68 (48%)

Query: 25 QKDSNAELKSKRTAQNRAAQRAFXXXXXXXXXXXXXXXXXXXXVCRAHESETSFLRSQLI 84
          +K  + E K+KRTAQNRAAQRAF                    V    E E+ FLRSQL 
Sbjct: 27 RKPLDTEAKNKRTAQNRAAQRAFRERKERKMRELEEQVERLERVREQSELESEFLRSQLQ 86

Query: 85 LFGTELRK 92
              E++K
Sbjct: 87 KLLAEIQK 94

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 19/23 (82%)

Query: 356 FNFDNQFDEQISKFCLKLNSACG 378
           F+F++ FDEQ+S+FC ++N  CG
Sbjct: 281 FDFNSHFDEQVSEFCTRMNEVCG 303

>TBLA0G00930 Chr7 (226547..228373) [1827 bp, 608 aa] {ON} Anc_5.528
           YDR423C
          Length = 608

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 20/34 (58%), Positives = 27/34 (79%)

Query: 537 LPCTKIWDRITALPKYTSADIENLCNELMSKAKC 570
           + C+++WDRIT+ PKY+  DI+ LC ELM KAKC
Sbjct: 554 MQCSEVWDRITSHPKYSDLDIDGLCTELMHKAKC 587

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 35/68 (51%)

Query: 25  QKDSNAELKSKRTAQNRAAQRAFXXXXXXXXXXXXXXXXXXXXVCRAHESETSFLRSQLI 84
           +K S+ E KSKRTAQNRAAQRAF                    V +  E E+ FLR QL 
Sbjct: 42  RKLSDQEAKSKRTAQNRAAQRAFRERRERKMQELEDKVKSLEEVHKKSEIESQFLRDQLK 101

Query: 85  LFGTELRK 92
           +   EL++
Sbjct: 102 VLLGELQR 109

>TPHA0K00520 Chr11 (102027..103709) [1683 bp, 560 aa] {ON} Anc_5.528
           YDR423C
          Length = 560

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 26/38 (68%)

Query: 533 DPEMLPCTKIWDRITALPKYTSADIENLCNELMSKAKC 570
           D   L C+++W R+T  PKY+  DI+ LC ELM +AKC
Sbjct: 501 DGSYLKCSQVWSRLTEHPKYSELDIDGLCTELMLQAKC 538

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 33/64 (51%)

Query: 29  NAELKSKRTAQNRAAQRAFXXXXXXXXXXXXXXXXXXXXVCRAHESETSFLRSQLILFGT 88
           ++++KSKRT QNR AQRAF                    V  A E ET+FLRS+L     
Sbjct: 37  DSDVKSKRTFQNRNAQRAFRERKERKLKELEDKVLALEQVNEAKELETNFLRSRLKSMAD 96

Query: 89  ELRK 92
           EL+K
Sbjct: 97  ELKK 100

>NDAI0H01610 Chr8 complement(390369..391928) [1560 bp, 519 aa] {ON}
           Anc_5.528 YDR423C
          Length = 519

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 28/40 (70%), Gaps = 8/40 (20%)

Query: 539 CTKIWDRIT--------ALPKYTSADIENLCNELMSKAKC 570
           C+KIW+RI         + P++  +DI++LCNELM+KA+C
Sbjct: 459 CSKIWERINNKMNIETNSGPRFKDSDIDDLCNELMTKARC 498

>YDR423C Chr4 complement(1318046..1319275) [1230 bp, 409 aa] {ON}
           CAD1AP-1-like basic leucine zipper (bZIP)
           transcriptional activator involved in stress responses,
           iron metabolism, and pleiotropic drug resistance;
           controls a set of genes involved in stabilizing
           proteins; binds consensus sequence TTACTAA
          Length = 409

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 26/32 (81%)

Query: 539 CTKIWDRITALPKYTSADIENLCNELMSKAKC 570
           C  I + I++LPKY+S DI++LC+EL+ KAKC
Sbjct: 356 CYHILEEISSLPKYSSLDIDDLCSELIIKAKC 387

 Score = 35.4 bits (80), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 16/23 (69%), Positives = 20/23 (86%)

Query: 25 QKDSNAELKSKRTAQNRAAQRAF 47
          +K  ++E KS+RTAQNRAAQRAF
Sbjct: 38 RKRIDSEAKSRRTAQNRAAQRAF 60

>Suva_2.600 Chr2
           complement(1070824..1071000,1071004..1071024,
           1071028..1071144,1071132..1071362,1071366..1071527,
           1071531..1071734,1071738..1071752,1071756..1071953,
           1071957..1071977) [1146 bp, 382 aa] {OFF} YDR423C
           (PSEUDO)
          Length = 382

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 25/32 (78%)

Query: 539 CTKIWDRITALPKYTSADIENLCNELMSKAKC 570
           C+ I   I+++PK++S DI+NLC ELM KAKC
Sbjct: 329 CSHILRHISSIPKHSSLDIDNLCCELMVKAKC 360

>Smik_4.698 Chr4 complement(1238807..1239642,1239673..1240018) [1182
           bp, 393 aa] {ON} YDR423C (REAL)
          Length = 393

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 24/31 (77%)

Query: 539 CTKIWDRITALPKYTSADIENLCNELMSKAK 569
           C  I   I++LPKY+S DI+NLC ELM+KA+
Sbjct: 340 CCHILKEISSLPKYSSLDIDNLCCELMTKAE 370

 Score = 34.3 bits (77), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 20/23 (86%)

Query: 25 QKDSNAELKSKRTAQNRAAQRAF 47
          +K  ++E K++RTAQNRAAQRAF
Sbjct: 22 RKRVDSEAKNRRTAQNRAAQRAF 44

>NCAS0F01100 Chr6 complement(218116..219543) [1428 bp, 475 aa] {ON}
           Anc_5.528 YDR423C
          Length = 475

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 24/33 (72%), Gaps = 1/33 (3%)

Query: 539 CTKIWDRI-TALPKYTSADIENLCNELMSKAKC 570
           C+ IW R  T  PK++  DI++LC EL++KAKC
Sbjct: 422 CSAIWKRFKTQKPKFSDDDIDSLCQELITKAKC 454

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 30/60 (50%)

Query: 33 KSKRTAQNRAAQRAFXXXXXXXXXXXXXXXXXXXXVCRAHESETSFLRSQLILFGTELRK 92
          K++RTAQNRAAQRAF                    +   +E E++FLR  ++    +++K
Sbjct: 34 KNRRTAQNRAAQRAFRERKERKMKELEDKISDLERIKDNNEVESTFLRDYMMDLICDMQK 93

>CAGL0F03069g Chr6 complement(301650..303110) [1461 bp, 486 aa]
          {ON} some similarities with uniprot|P24813
          Saccharomyces cerevisiae YDR423c CAD1 transcriptional
          activator
          Length = 486

 Score = 35.8 bits (81), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 29/64 (45%)

Query: 29 NAELKSKRTAQNRAAQRAFXXXXXXXXXXXXXXXXXXXXVCRAHESETSFLRSQLILFGT 88
          + E K+KRTAQNRAAQRAF                    +     SET +L+  L    T
Sbjct: 18 DTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEYLKECLSELLT 77

Query: 89 ELRK 92
          E+ K
Sbjct: 78 EVTK 81

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 19/34 (55%)

Query: 536 MLPCTKIWDRITALPKYTSADIENLCNELMSKAK 569
           +L C  I   +     Y S D ENLC ELM+KAK
Sbjct: 420 VLRCEDICGTVGPSIGYDSLDFENLCAELMNKAK 453

>Ecym_4064 Chr4 (141770..143050) [1281 bp, 426 aa] {ON} similar to
           Ashbya gossypii ADR195C
          Length = 426

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 31/68 (45%)

Query: 25  QKDSNAELKSKRTAQNRAAQRAFXXXXXXXXXXXXXXXXXXXXVCRAHESETSFLRSQLI 84
           +K  + E K++RTAQNRAAQRAF                         E E   LR+Q++
Sbjct: 47  RKPLDTEAKNRRTAQNRAAQRAFRERKERKMKDLEDKVRKLEEQRLQSEREVQSLRNQVV 106

Query: 85  LFGTELRK 92
               EL+K
Sbjct: 107 SLLRELKK 114

>ADR195C Chr4 complement(1041896..1042762) [867 bp, 288 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YML007W
          (YAP1) and YDR423C (CAD1)
          Length = 288

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 27/62 (43%)

Query: 31 ELKSKRTAQNRAAQRAFXXXXXXXXXXXXXXXXXXXXVCRAHESETSFLRSQLILFGTEL 90
          E K++RTAQNRAAQRAF                       + E E   LR  +I    EL
Sbjct: 37 EAKNRRTAQNRAAQRAFRERKERKMRDLEDQVRRLEEERSSAECEVQSLRGHVIALVREL 96

Query: 91 RK 92
          R+
Sbjct: 97 RR 98

>NCAS0A12530 Chr1 (2472725..2473639) [915 bp, 304 aa] {ON} 
          Length = 304

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 20/24 (83%)

Query: 24  VQKDSNAELKSKRTAQNRAAQRAF 47
           V +D + ++K+K+ AQNRAAQ+AF
Sbjct: 96  VNEDDSEDIKAKKKAQNRAAQKAF 119

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.128    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 37,474,598
Number of extensions: 1195704
Number of successful extensions: 3472
Number of sequences better than 10.0: 32
Number of HSP's gapped: 3529
Number of HSP's successfully gapped: 76
Length of query: 599
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 484
Effective length of database: 40,294,809
Effective search space: 19502687556
Effective search space used: 19502687556
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)