Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0C054503.455ON1202120260920.0
Skud_16.4123.455ON1208117626130.0
Smik_16.3713.455ON1208121525990.0
YPR122W (AXL1)3.455ON1208121725990.0
NCAS0A116303.455ON1201117825780.0
Suva_16.4513.455ON1218119825680.0
Kpol_1050.883.455ON1213118525030.0
NDAI0A046503.455ON1199121424890.0
KAFR0A053703.455ON1201121624870.0
SAKL0F06886g3.455ON1183116724140.0
TDEL0F034003.455ON1170121223790.0
ZYRO0C06336g3.455ON1189120523590.0
TPHA0D040603.455ON1201122023000.0
Ecym_44043.455ON1196120422630.0
KNAG0A077403.455ON1197120121840.0
AGR251C3.455ON1193121621820.0
Kwal_55.204643.455ON1189122021300.0
KLTH0E05104g3.455ON1185116520720.0
KLLA0D15631g3.455ON1170117117650.0
CAGL0D04686g3.455ON1181119915350.0
Skud_12.4744.246ON10222464278e-42
TPHA0B022604.246ON10415314269e-42
Suva_10.5064.246ON10232554233e-41
TBLA0I029404.246ON9652414213e-41
YLR389C (STE23)4.246ON10272434205e-41
NCAS0J014704.246ON9952504206e-41
TDEL0E012504.246ON9954304188e-41
KNAG0B060804.246ON9962384091e-39
AER053C4.246ON10132434036e-39
KLTH0D14278g4.246ON10012434019e-39
CAGL0H06457g4.246ON10082364011e-38
KAFR0A059704.246ON10112413973e-38
NDAI0J022404.246ON9992593973e-38
KLLA0E05105g4.246ON10042323973e-38
ZYRO0B12320g4.246ON9944433875e-37
Smik_12.4764.246ON10252553875e-37
Kpol_1055.834.246ON10202293867e-37
SAKL0H03124g4.246ON10062463857e-37
Ecym_32734.246ON10232283859e-37
Kwal_23.42374.246ON10012543841e-36
TBLA0A080504.246ON9952293562e-33
AGL138C8.376ON4702381131e-04
Kwal_23.33458.376ON4582201112e-04
NCAS0C049503.93ON10322001060.001
KLLA0D18095g8.376ON4692471020.002
Smik_12.2258.376ON4622281020.002
Kpol_1024.23singletonOFF454229980.006
Kpol_YGOB_1024.238.376ON464229980.006
CAGL0I07535g3.93ON1021106990.006
Kwal_56.226883.93ON1040106980.009
KLTH0C09570g3.93ON1042106980.009
TDEL0F050008.376ON456206950.015
NCAS0C029708.376ON461220950.016
TPHA0C024508.376ON469224940.017
TBLA0B082403.93ON1032230950.018
TPHA0P010403.93ON1038106950.018
NDAI0G023208.376ON463218940.019
KLTH0F08954g8.376ON458240930.024
KNAG0K006903.93ON1030179940.025
ZYRO0C03806g8.376ON465220930.026
Ecym_41918.376ON462226930.027
YLR163C (MAS1)8.376ON462224920.036
AFR334W3.93ON102990900.067
NDAI0G042803.93ON1034104900.068
SAKL0H14168g8.376ON461251890.077
Skud_12.2308.376ON462224880.090
ZYRO0B06490g3.93ON1028107890.10
SAKL0C09504g3.93ON1069119880.12
KLLA0B00957g5.541ON98291880.13
KAFR0C014303.93ON1035189870.19
ADR184W5.541ON990112870.19
Ecym_35853.93ON1032175870.19
KLTH0G04092g5.541ON99084860.22
YOL098C3.93ON103796860.24
TPHA0D024305.541ON988187850.25
KLLA0F27071g3.93ON103792850.29
Suva_10.2608.376ON462226840.30
TBLA0H010108.376ON499228840.31
KNAG0A027608.376ON467212840.33
Smik_15.583.93ON1038190840.41
Skud_15.553.93ON1038127830.47
TDEL0D053103.93ON1035200830.49
KAFR0H020308.376ON462228810.69
TBLA0A069405.541ON99166820.70
Kwal_47.185775.541ON98775810.83
ZYRO0D12870g5.541ON98697782.0
Smik_4.7045.541ON98999782.0
NCAS0F011405.541ON988114782.1
Ecym_40765.541ON98889772.5
Suva_15.673.93ON1038178772.6
KNAG0C039107.327ON81275772.6
CAGL0F03157g5.541ON99084754.7
SAKL0G05236g5.541ON98654754.7
Kpol_1004.325.541ON98885745.3
Skud_4.7055.541ON98997745.8
SAKL0G07524g5.401ON632141736.4
Kpol_461.167.327ON80774737.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0C05450
         (1202 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0C05450 Chr3 complement(1312984..1316592) [3609 bp, 1202 aa]...  2351   0.0  
Skud_16.412 Chr16 (741265..744891) [3627 bp, 1208 aa] {ON} YPR12...  1011   0.0  
Smik_16.371 Chr16 (659341..662967) [3627 bp, 1208 aa] {ON} YPR12...  1005   0.0  
YPR122W Chr16 (782045..785671) [3627 bp, 1208 aa] {ON}  AXL1Hapl...  1005   0.0  
NCAS0A11630 Chr1 (2311038..2314643) [3606 bp, 1201 aa] {ON} Anc_...   997   0.0  
Suva_16.451 Chr16 (784213..787869) [3657 bp, 1218 aa] {ON} YPR12...   993   0.0  
Kpol_1050.88 s1050 (199457..203098) [3642 bp, 1213 aa] {ON} (199...   968   0.0  
NDAI0A04650 Chr1 complement(1046461..1050060) [3600 bp, 1199 aa]...   963   0.0  
KAFR0A05370 Chr1 (1059317..1062922) [3606 bp, 1201 aa] {ON} Anc_...   962   0.0  
SAKL0F06886g Chr6 (524553..528104) [3552 bp, 1183 aa] {ON} simil...   934   0.0  
TDEL0F03400 Chr6 (628126..631638) [3513 bp, 1170 aa] {ON} Anc_3....   920   0.0  
ZYRO0C06336g Chr3 (479075..482644) [3570 bp, 1189 aa] {ON} simil...   913   0.0  
TPHA0D04060 Chr4 (867294..870899) [3606 bp, 1201 aa] {ON} Anc_3....   890   0.0  
Ecym_4404 Chr4 complement(840532..844122) [3591 bp, 1196 aa] {ON...   876   0.0  
KNAG0A07740 Chr1 complement(1226949..1230542) [3594 bp, 1197 aa]...   845   0.0  
AGR251C Chr7 complement(1213371..1216952) [3582 bp, 1193 aa] {ON...   845   0.0  
Kwal_55.20464 s55 complement(414783..418352) [3570 bp, 1189 aa] ...   825   0.0  
KLTH0E05104g Chr5 complement(449481..453038) [3558 bp, 1185 aa] ...   802   0.0  
KLLA0D15631g Chr4 (1319185..1322697) [3513 bp, 1170 aa] {ON} sim...   684   0.0  
CAGL0D04686g Chr4 (457938..461483) [3546 bp, 1181 aa] {ON} simil...   595   0.0  
Skud_12.474 Chr12 complement(839782..842850) [3069 bp, 1022 aa] ...   169   8e-42
TPHA0B02260 Chr2 (517138..520263) [3126 bp, 1041 aa] {ON} Anc_4....   168   9e-42
Suva_10.506 Chr10 complement(865239..868310) [3072 bp, 1023 aa] ...   167   3e-41
TBLA0I02940 Chr9 complement(699857..702754) [2898 bp, 965 aa] {O...   166   3e-41
YLR389C Chr12 complement(899577..902660) [3084 bp, 1027 aa] {ON}...   166   5e-41
NCAS0J01470 Chr10 complement(261880..264867) [2988 bp, 995 aa] {...   166   6e-41
TDEL0E01250 Chr5 (243919..246906) [2988 bp, 995 aa] {ON} Anc_4.2...   165   8e-41
KNAG0B06080 Chr2 complement(1197765..1200755) [2991 bp, 996 aa] ...   162   1e-39
AER053C Chr5 complement(735402..738443) [3042 bp, 1013 aa] {ON} ...   159   6e-39
KLTH0D14278g Chr4 complement(1172523..1175528) [3006 bp, 1001 aa...   159   9e-39
CAGL0H06457g Chr8 (633721..636747) [3027 bp, 1008 aa] {ON} highl...   159   1e-38
KAFR0A05970 Chr1 (1206007..1209042) [3036 bp, 1011 aa] {ON} Anc_...   157   3e-38
NDAI0J02240 Chr10 complement(547488..550487) [3000 bp, 999 aa] {...   157   3e-38
KLLA0E05105g Chr5 (447645..450659) [3015 bp, 1004 aa] {ON} simil...   157   3e-38
ZYRO0B12320g Chr2 complement(996046..999030) [2985 bp, 994 aa] {...   153   5e-37
Smik_12.476 Chr12 complement(838321..841398) [3078 bp, 1025 aa] ...   153   5e-37
Kpol_1055.83 s1055 (216511..219573) [3063 bp, 1020 aa] {ON} (216...   153   7e-37
SAKL0H03124g Chr8 (291984..295004) [3021 bp, 1006 aa] {ON} simil...   152   7e-37
Ecym_3273 Chr3 (515048..518119) [3072 bp, 1023 aa] {ON} similar ...   152   9e-37
Kwal_23.4237 s23 (630432..633437) [3006 bp, 1001 aa] {ON} YLR389...   152   1e-36
TBLA0A08050 Chr1 (1988388..1991375) [2988 bp, 995 aa] {ON} Anc_4...   141   2e-33
AGL138C Chr7 complement(453737..455149) [1413 bp, 470 aa] {ON} S...    48   1e-04
Kwal_23.3345 s23 (253614..254990) [1377 bp, 458 aa] {ON} YLR163C...    47   2e-04
NCAS0C04950 Chr3 complement(1009698..1012796) [3099 bp, 1032 aa]...    45   0.001
KLLA0D18095g Chr4 complement(1526808..1528217) [1410 bp, 469 aa]...    44   0.002
Smik_12.225 Chr12 complement(439006..440394) [1389 bp, 462 aa] {...    44   0.002
Kpol_1024.23 s1024 (68467..69831) [1365 bp, 454 aa] {OFF} (68467...    42   0.006
Kpol_YGOB_1024.23 s1024 (68437..69831) [1395 bp, 464 aa] {ON} AN...    42   0.006
CAGL0I07535g Chr9 complement(725369..728434) [3066 bp, 1021 aa] ...    43   0.006
Kwal_56.22688 s56 (236214..239336) [3123 bp, 1040 aa] {ON} YOL09...    42   0.009
KLTH0C09570g Chr3 complement(795587..798715) [3129 bp, 1042 aa] ...    42   0.009
TDEL0F05000 Chr6 complement(942516..943886) [1371 bp, 456 aa] {O...    41   0.015
NCAS0C02970 Chr3 (558478..559863) [1386 bp, 461 aa] {ON} Anc_8.376     41   0.016
TPHA0C02450 Chr3 (545815..547224) [1410 bp, 469 aa] {ON} Anc_8.3...    41   0.017
TBLA0B08240 Chr2 (1965563..1968661) [3099 bp, 1032 aa] {ON} Anc_...    41   0.018
TPHA0P01040 Chr16 (208875..211991) [3117 bp, 1038 aa] {ON} Anc_3...    41   0.018
NDAI0G02320 Chr7 (518661..520052) [1392 bp, 463 aa] {ON} Anc_8.3...    41   0.019
KLTH0F08954g Chr6 (770605..771981) [1377 bp, 458 aa] {ON} highly...    40   0.024
KNAG0K00690 Chr11 complement(124385..127477) [3093 bp, 1030 aa] ...    41   0.025
ZYRO0C03806g Chr3 complement(301873..303270) [1398 bp, 465 aa] {...    40   0.026
Ecym_4191 Chr4 (396094..397482) [1389 bp, 462 aa] {ON} similar t...    40   0.027
YLR163C Chr12 complement(491866..493254) [1389 bp, 462 aa] {ON} ...    40   0.036
AFR334W Chr6 (1043252..1046341) [3090 bp, 1029 aa] {ON} Syntenic...    39   0.067
NDAI0G04280 Chr7 (1027206..1030310) [3105 bp, 1034 aa] {ON} Anc_...    39   0.068
SAKL0H14168g Chr8 (1211470..1212855) [1386 bp, 461 aa] {ON} high...    39   0.077
Skud_12.230 Chr12 complement(438565..439953) [1389 bp, 462 aa] {...    39   0.090
ZYRO0B06490g Chr2 (517721..520807) [3087 bp, 1028 aa] {ON} simil...    39   0.10 
SAKL0C09504g Chr3 complement(865789..868998) [3210 bp, 1069 aa] ...    39   0.12 
KLLA0B00957g Chr2 complement(73661..76609) [2949 bp, 982 aa] {ON...    39   0.13 
KAFR0C01430 Chr3 (292206..295313) [3108 bp, 1035 aa] {ON} Anc_3....    38   0.19 
ADR184W Chr4 (1025969..1028941) [2973 bp, 990 aa] {ON} Syntenic ...    38   0.19 
Ecym_3585 Chr3 (1108374..1111472) [3099 bp, 1032 aa] {ON} simila...    38   0.19 
KLTH0G04092g Chr7 complement(325076..328048) [2973 bp, 990 aa] {...    38   0.22 
YOL098C Chr15 complement(132725..135838) [3114 bp, 1037 aa] {ON}...    38   0.24 
TPHA0D02430 Chr4 complement(499608..502574) [2967 bp, 988 aa] {O...    37   0.25 
KLLA0F27071g Chr6 complement(2496781..2499894) [3114 bp, 1037 aa...    37   0.29 
Suva_10.260 Chr10 complement(463944..465332) [1389 bp, 462 aa] {...    37   0.30 
TBLA0H01010 Chr8 (217060..218559) [1500 bp, 499 aa] {ON} Anc_8.3...    37   0.31 
KNAG0A02760 Chr1 (301136..302539) [1404 bp, 467 aa] {ON} Anc_8.3...    37   0.33 
Smik_15.58 Chr15 complement(95835..98951) [3117 bp, 1038 aa] {ON...    37   0.41 
Skud_15.55 Chr15 complement(92056..95172) [3117 bp, 1038 aa] {ON...    37   0.47 
TDEL0D05310 Chr4 (961842..964949) [3108 bp, 1035 aa] {ON} Anc_3....    37   0.49 
KAFR0H02030 Chr8 (374862..376250) [1389 bp, 462 aa] {ON} Anc_8.3...    36   0.69 
TBLA0A06940 Chr1 complement(1694417..1697392) [2976 bp, 991 aa] ...    36   0.70 
Kwal_47.18577 s47 (880989..883952) [2964 bp, 987 aa] {ON} YDR430...    36   0.83 
ZYRO0D12870g Chr4 complement(1083883..1086843) [2961 bp, 986 aa]...    35   2.0  
Smik_4.704 Chr4 complement(1246246..1249215) [2970 bp, 989 aa] {...    35   2.0  
NCAS0F01140 Chr6 complement(224043..227009) [2967 bp, 988 aa] {O...    35   2.1  
Ecym_4076 Chr4 complement(159621..162587) [2967 bp, 988 aa] {ON}...    34   2.5  
Suva_15.67 Chr15 complement(105988..109104) [3117 bp, 1038 aa] {...    34   2.6  
KNAG0C03910 Chr3 complement(766674..769112) [2439 bp, 812 aa] {O...    34   2.6  
CAGL0F03157g Chr6 complement(307854..310826) [2973 bp, 990 aa] {...    33   4.7  
SAKL0G05236g Chr7 complement(429654..432614) [2961 bp, 986 aa] {...    33   4.7  
Kpol_1004.32 s1004 complement(64627..67593) [2967 bp, 988 aa] {O...    33   5.3  
Skud_4.705 Chr4 complement(1245869..1248838) [2970 bp, 989 aa] {...    33   5.8  
SAKL0G07524g Chr7 (624810..626708) [1899 bp, 632 aa] {ON} simila...    33   6.4  
Kpol_461.16 s461 complement(30618..33041) [2424 bp, 807 aa] {ON}...    33   7.9  

>TBLA0C05450 Chr3 complement(1312984..1316592) [3609 bp, 1202 aa] {ON}
            Anc_3.455 YPR122W
          Length = 1202

 Score = 2351 bits (6092), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1165/1202 (96%), Positives = 1165/1202 (96%)

Query: 1    MSWINTKTFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDP 60
            MSWINTKTFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDP
Sbjct: 1    MSWINTKTFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDP 60

Query: 61   RDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAI 120
            RDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAI
Sbjct: 61   RDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAI 120

Query: 121  EQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSH 180
            EQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSH
Sbjct: 121  EQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSH 180

Query: 181  PFHNFSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALA 240
            PFHNFSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALA
Sbjct: 181  PFHNFSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALA 240

Query: 241  NFGDIKDKDELTKFHINSIKPQXXXXXXXXXXXXXXCNSFKTNENLDLENFKLLDNAWLD 300
            NFGDIKDKDELTKFHINSIKPQ              CNSFKTNENLDLENFKLLDNAWLD
Sbjct: 241  NFGDIKDKDELTKFHINSIKPQKSLRISKSRSSISSCNSFKTNENLDLENFKLLDNAWLD 300

Query: 301  KYGDNVCFPTSLSHNTIFLSSSKQPILRLLFPISEKLTRFTKRDIKIYSNIWCHIFGDET 360
            KYGDNVCFPTSLSHNTIFLSSSKQPILRLLFPISEKLTRFTKRDIKIYSNIWCHIFGDET
Sbjct: 301  KYGDNVCFPTSLSHNTIFLSSSKQPILRLLFPISEKLTRFTKRDIKIYSNIWCHIFGDET 360

Query: 361  KGSFCDYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIIDILLQQVVKLL 420
            KGSFCDYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIIDILLQQVVKLL
Sbjct: 361  KGSFCDYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIIDILLQQVVKLL 420

Query: 421  VDNFTENLAYFLAENNIISILRFINSDVEINPMDECSELSGLLQENFKLFNPKYLFYGSE 480
            VDNFTENLAYFLAENNIISILRFINSDVEINPMDECSELSGLLQENFKLFNPKYLFYGSE
Sbjct: 421  VDNFTENLAYFLAENNIISILRFINSDVEINPMDECSELSGLLQENFKLFNPKYLFYGSE 480

Query: 481  FLLLENESLPQKNNMFDGNSTTFWIGQAIKFQTFLKEFMNWENIKIVGIGDIDEFKNVLN 540
            FLLLENESLPQKNNMFDGNSTTFWIGQAIKFQTFLKEFMNWENIKIVGIGDIDEFKNVLN
Sbjct: 481  FLLLENESLPQKNNMFDGNSTTFWIGQAIKFQTFLKEFMNWENIKIVGIGDIDEFKNVLN 540

Query: 541  IVKEMSKKTDLYYEFEYQKLKISKKSRICPRDYPFTYPIKNEYLPKFGYXXXXXXXXXXX 600
            IVKEMSKKTDLYYEFEYQKLKISKKSRICPRDYPFTYPIKNEYLPKFGY           
Sbjct: 541  IVKEMSKKTDLYYEFEYQKLKISKKSRICPRDYPFTYPIKNEYLPKFGYNLGLLRNILLN 600

Query: 601  XXESSRTVSFYMPQVSEEEDQNKLVSQNDMHKLWVNPKNSKDQLSESPCIVSFKLVNNSI 660
              ESSRTVSFYMPQVSEEEDQNKLVSQNDMHKLWVNPKNSKDQLSESPCIVSFKLVNNSI
Sbjct: 601  NLESSRTVSFYMPQVSEEEDQNKLVSQNDMHKLWVNPKNSKDQLSESPCIVSFKLVNNSI 660

Query: 661  QESPESTMHLELMGQLLHTLLINKLYPALNVGYTFEISPSVRGDVSLSFTLSGFSEGIFK 720
            QESPESTMHLELMGQLLHTLLINKLYPALNVGYTFEISPSVRGDVSLSFTLSGFSEGIFK
Sbjct: 661  QESPESTMHLELMGQLLHTLLINKLYPALNVGYTFEISPSVRGDVSLSFTLSGFSEGIFK 720

Query: 721  IIKECINIFGELTSSDLITKKEFRRARILVRDKYEDAASDSCVKLASVGLLILLERKMWT 780
            IIKECINIFGELTSSDLITKKEFRRARILVRDKYEDAASDSCVKLASVGLLILLERKMWT
Sbjct: 721  IIKECINIFGELTSSDLITKKEFRRARILVRDKYEDAASDSCVKLASVGLLILLERKMWT 780

Query: 781  LEERIDALELIDLEMFLEFAQKFFQNLFLSLYIEGNLEYADLINSYFSDKLVHHLTKRLD 840
            LEERIDALELIDLEMFLEFAQKFFQNLFLSLYIEGNLEYADLINSYFSDKLVHHLTKRLD
Sbjct: 781  LEERIDALELIDLEMFLEFAQKFFQNLFLSLYIEGNLEYADLINSYFSDKLVHHLTKRLD 840

Query: 841  YPKEDTLQSLPSTKLISGTNIYYELEGSVDDPNNSIVYFIQTGDLSNKKILSLTSLTAFI 900
            YPKEDTLQSLPSTKLISGTNIYYELEGSVDDPNNSIVYFIQTGDLSNKKILSLTSLTAFI
Sbjct: 841  YPKEDTLQSLPSTKLISGTNIYYELEGSVDDPNNSIVYFIQTGDLSNKKILSLTSLTAFI 900

Query: 901  ISFSLVPELRNKKQIGYVVFGGLRTLSDTVGLHITIMSDGKPLDIEIEIEKYISYLEFDL 960
            ISFSLVPELRNKKQIGYVVFGGLRTLSDTVGLHITIMSDGKPLDIEIEIEKYISYLEFDL
Sbjct: 901  ISFSLVPELRNKKQIGYVVFGGLRTLSDTVGLHITIMSDGKPLDIEIEIEKYISYLEFDL 960

Query: 961  LGNLDDETFQNNYLIKYIDLINGIYKKSTEQTSGPINIMNEIIANVHGGDSAILNSEXXX 1020
            LGNLDDETFQNNYLIKYIDLINGIYKKSTEQTSGPINIMNEIIANVHGGDSAILNSE   
Sbjct: 961  LGNLDDETFQNNYLIKYIDLINGIYKKSTEQTSGPINIMNEIIANVHGGDSAILNSEKIK 1020

Query: 1021 XXXXXXXELFGDAQMTEELKYVDIEFLKNLNLIKYLQFFKGSISTNSKRRSKLSIHIKSP 1080
                   ELFGDAQMTEELKYVDIEFLKNLNLIKYLQFFKGSISTNSKRRSKLSIHIKSP
Sbjct: 1021 NHKKNKNELFGDAQMTEELKYVDIEFLKNLNLIKYLQFFKGSISTNSKRRSKLSIHIKSP 1080

Query: 1081 MEERELFNRKLFLQLQTFLKIKGFPIKSNELQQIVERTNGRPTLLFKELFACFKARDESW 1140
            MEERELFNRKLFLQLQTFLKIKGFPIKSNELQQIVERTNGRPTLLFKELFACFKARDESW
Sbjct: 1081 MEERELFNRKLFLQLQTFLKIKGFPIKSNELQQIVERTNGRPTLLFKELFACFKARDESW 1140

Query: 1141 KFISIVLKEILKVISMSIKQQCKTRGSETRSSIQHSEFHNDHIITPTPLEKVEDINKYLH 1200
            KFISIVLKEILKVISMSIKQQCKTRGSETRSSIQHSEFHNDHIITPTPLEKVEDINKYLH
Sbjct: 1141 KFISIVLKEILKVISMSIKQQCKTRGSETRSSIQHSEFHNDHIITPTPLEKVEDINKYLH 1200

Query: 1201 LR 1202
            LR
Sbjct: 1201 LR 1202

>Skud_16.412 Chr16 (741265..744891) [3627 bp, 1208 aa] {ON} YPR122W
            (REAL)
          Length = 1208

 Score = 1011 bits (2613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/1176 (46%), Positives = 762/1176 (64%), Gaps = 28/1176 (2%)

Query: 1    MSWINTKTFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDP 60
            MS      +++  Y+P SYSNR  K+C+LPNGILALLISD + T+++CS+SV TGSH+DP
Sbjct: 1    MSLREVINYEVPIYIPLSYSNRTHKICKLPNGILALLISDPTDTSSSCSLSVCTGSHNDP 60

Query: 61   RDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAI 120
            +D  G+AHLCEHMILAAGSK+YP  GLFH ++A NNGSQNA+TTGEQTTFYFELP S + 
Sbjct: 61   KDTLGLAHLCEHMILAAGSKQYPDAGLFHTLIAKNNGSQNAYTTGEQTTFYFELPNSQSN 120

Query: 121  EQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSH 180
             +  F  ILD+F+SFFK PLFN +L +KEIYAI+SEH+GN+S+T+KI YHA RLL+N  H
Sbjct: 121  GEFAFEFILDVFASFFKNPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARLLANSDH 180

Query: 181  PFHNFSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALA 240
            PF  FSTGNIH+LS +  LKK NLK  L  YFKNNYF  N+TICI+GPQS+N L KLA++
Sbjct: 181  PFSRFSTGNIHSLSSIPQLKKINLKNSLNAYFKNNYFGENITICIRGPQSVNILAKLAIS 240

Query: 241  NFGDIKDKD--ELTKFHINSIKPQXXXXXXXXXXXXXXCNSFKTNENLDLENFKLLDNAW 298
             FGDIK K+  E   F I +                     F  N++  LE+FK+L+  W
Sbjct: 241  KFGDIKPKNSVEGNNFSIRA-------GSFRRSRSVKSTGDFSKNDHRKLESFKILETVW 293

Query: 299  LDKYGDNVCFPTSLSHNTIFLSSSKQPILRLLFPISEKLTRFTKRDIKIYSNIWCHIFGD 358
             +KY ++ CF      NTIF++S+K P++R LFP+S+K TRFTK DIKIYS++WC +FGD
Sbjct: 294  EEKYKNSKCFEHPPGKNTIFINSNKSPVIRFLFPVSDKNTRFTKEDIKIYSHLWCELFGD 353

Query: 359  ETKGSFCDYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIIDILLQQVVK 418
            E+ GS   YL    WIT+C+AF S FAIGN  L+LEL+LTN+G + +++I   +     K
Sbjct: 354  ESPGSLGSYLVSRGWITKCFAFTSEFAIGNIGLMLELELTNSGWESIKDITTTIFS---K 410

Query: 419  LLVDNFTENLAY---FLAENNIISILRFINSDVEINPMDECSELSGLLQENFKLFNPKYL 475
            LL   + +N+ Y   FL E N+I I RF+    E  PM+ECS LS +LQEN +   P  +
Sbjct: 411  LLPSFYVKNIDYLITFLKEQNLIDIARFLYQSSEDIPMEECSNLSTILQENLEYLTPSNV 470

Query: 476  FYGSEFLLLENESLPQKNNMFDGNSTTFWIGQAIKFQTFLKEFMNWENIKIVGIGDIDEF 535
            F G + L+  ++    K    + N   +WIGQAIKFQ FLK  MN EN +++ +G++  +
Sbjct: 471  FKGFKSLIEIDDPNIDKYENSEAN-MQWWIGQAIKFQNFLKSHMNHENTRLLILGNVKSY 529

Query: 536  KNVLNIVKEMSKKTDLYYEFEY--QKLKISKKSRICPRD-YPFTYPIKNEYLPKFGYXXX 592
            +    I K     TD +YEFEY   K+ +++      +  Y F +P  N +LP +     
Sbjct: 530  EVFDKIEKRSEMYTDFFYEFEYYTGKVDLTRDDESYAKSYYEFNFPTSNIFLPDYINDPL 589

Query: 593  XXXXXXXXXXESSRTVSFYMPQVSEEEDQN--KLVSQNDMHKLWVNPKNSKDQLSESPCI 650
                        S+  +   PQ+  E  +   +LVS+N  +++WV  K   + +S++  I
Sbjct: 590  KLQQLFLECSLKSKFATL-RPQIQSEPTKRLPQLVSKNLNYEMWV-LKEDPNFISDNKSI 647

Query: 651  VSFKLVNNSIQESPESTMHLELMGQLLHTLLINKLYPALNVGYTFEISPSVRGDVSLSFT 710
            VSF+++   I+ SPE+T+HLE++ Q+L  +  + LYPAL VGYT+EI+ S +G+V+L FT
Sbjct: 648  VSFEILGLGIKPSPEATIHLEVLAQVLFIITSSYLYPALRVGYTYEIASSSKGNVTLRFT 707

Query: 711  LSGFSEGIFKIIKECINIFGEL-TSSDLITKKEFRRARILVRDKYEDAASDSCVKLASVG 769
            +SGFSEG++ I K  ++   ++ T +  ++K   R+ARILVR KYE A+SD+CVKLAS+G
Sbjct: 708  ISGFSEGVYTIAKTFVDTLKKIATDATFLSKDTVRKARILVRRKYEGASSDNCVKLASIG 767

Query: 770  LLILLERKMWTLEERIDALELIDLEMFLEFAQKFFQNL-FLSLYIEGNLEYADLINSYFS 828
            LLI+LE  MWTL++RIDALEL +   F EF   F+ N   L L I+GNLEYAD IN Y +
Sbjct: 768  LLIVLEEYMWTLQDRIDALELTETSSFKEFCYLFWNNPKRLVLLIQGNLEYADEINHYLN 827

Query: 829  DKLVHHL-TKRLDYPKEDTLQSLPSTK-LISGTNIYYELEGSVDDPNNSIVYFIQTGDLS 886
            +    HL     D      L   PSTK L  GTN +    G  DDPNNSIVYFIQT   +
Sbjct: 828  NNFTQHLKVSNEDNRPTICLYPSPSTKNLDRGTNTFVSYNGHQDDPNNSIVYFIQTAKRN 887

Query: 887  NKKILSLTSLTAFIISFSLVPELRNKKQIGYVVFGGLRTLSDTVGLHITIMSDGKPLDIE 946
            + + ++LT LT ++ S +LVP+LRNKKQIGY+V GGLR L++TVG+HIT+MS G   ++E
Sbjct: 888  DIESMTLTFLTEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTETVGIHITVMSGGPAHNLE 947

Query: 947  IEIEKYISYLEFDLLGNLDDETFQNNYLIKYIDLINGIYKKSTEQTSGPINIMNEIIANV 1006
             +I +Y+SYL+  +L    +  F+   L  ++ L+        E +SGP+N++NEI+ANV
Sbjct: 948  NKINEYLSYLQLQVLNTFTESDFRRILLEPFLALLKQNSFNKLESSSGPVNLLNEIVANV 1007

Query: 1007 HGGDSAILNSEXXXXXXXXXXELFGDA-QMTEELKYVDIEFLKNLNLIKYLQFFKGSIST 1065
              GD+  LN+           ++        +E +  DI FL+ L L +YL+FF+  IS 
Sbjct: 1008 QNGDNYTLNNRQMKQHRKIRNKIIERRFSFQDEYEMFDIPFLQGLTLKRYLEFFESKISI 1067

Query: 1066 NSKRRSKLSIHIKSPMEERELFNRKLFLQLQTFLKIKGFPIKSNELQQIVERTNGRPTLL 1125
             S++RSKLSI I SPM E ++ +RK+FLQL+ FLKIKGF IKS +L+ IV+ + G P LL
Sbjct: 1068 YSRQRSKLSIMITSPMAEEDIVSRKMFLQLEAFLKIKGFAIKSEDLKSIVDNSKGSPVLL 1127

Query: 1126 FKELFACFKARDESWKFISIVLKEILKVISMSIKQQ 1161
             K LF  F+ R+E++K  ++VL+EI K+I +S KQ+
Sbjct: 1128 IKNLFTSFRRRNEAFKLGAVVLQEISKIIIVSFKQR 1163

>Smik_16.371 Chr16 (659341..662967) [3627 bp, 1208 aa] {ON} YPR122W
            (REAL)
          Length = 1208

 Score = 1005 bits (2599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/1215 (44%), Positives = 788/1215 (64%), Gaps = 33/1215 (2%)

Query: 1    MSWINTKTFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDP 60
            MS      +++ F++P SYSNR  K+C+LPNGILALLISD + T+++CS+SV TGSH+DP
Sbjct: 1    MSLREVTNYEVSFHIPLSYSNRAHKICKLPNGILALLISDPTDTSSSCSLSVCTGSHNDP 60

Query: 61   RDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAI 120
             DIPG+AHLCEHMIL+AGSKKYP PGLFH ++A NNGSQNA+TTGEQTTFYFELP +   
Sbjct: 61   MDIPGLAHLCEHMILSAGSKKYPDPGLFHALIAKNNGSQNAYTTGEQTTFYFELPNTQNN 120

Query: 121  EQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSH 180
             +  F  ILD+F+SFFK PLFN +L +KEIYAI+SEH+GN+S+T+KI YHA R+L+N  H
Sbjct: 121  GEFAFESILDVFASFFKDPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANSDH 180

Query: 181  PFHNFSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALA 240
            PF  FSTGNIH+LS +  LKK NLK  L  YF++N+F  N+T+CI+G QS+N LTKLA++
Sbjct: 181  PFSRFSTGNIHSLSSIPQLKKINLKSSLNTYFRSNFFGENITLCIRGSQSVNILTKLAIS 240

Query: 241  NFGDIKDKDELTKFHINSIKPQXXXXXXXXXXXXXXCNSFKTNENLDLENFKLLDNAWLD 300
             FGD+K K  + + H +  K                 N ++     +LE+FK+LD  W  
Sbjct: 241  KFGDVKPKSIVKERHFSIGKGPFRKSTSLRRSLNSPKNDYR-----NLEDFKILDTVWEK 295

Query: 301  KYGDNVCFPTSLSHNTIFLSSSKQPILRLLFPISEKLTRFTKRDIKIYSNIWCHIFGDET 360
            KY + +CF  +   N+IF++S+K P++R LFP+S++ TRFTK DIKIYS++WC +FGDE+
Sbjct: 296  KYQNTMCFQHAPECNSIFINSNKMPVMRFLFPVSDRNTRFTKDDIKIYSHLWCELFGDES 355

Query: 361  KGSFCDYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIIDILLQQVVKLL 420
             GS   YL    WIT+C+AF S FAIG+  LILEL+LTN+G K ++NI   +  +++   
Sbjct: 356  PGSLSHYLVSRGWITKCFAFTSEFAIGDIGLILELELTNSGWKSIKNITTTIFSELLPSF 415

Query: 421  VDNFTENLAYFLAENNIISILRFINSDVEINPMDECSELSGLLQENFKLFNPKYLFYGSE 480
                 ++L  FL E N+I + RF+    E  PM+ECS LS  LQEN +   P  +F G +
Sbjct: 416  YVKNIDHLVTFLKEQNLIDLARFLYQSSENLPMEECSNLSSFLQENLECLTPSNVFKGFK 475

Query: 481  FLLLENESLPQKNNMFDGNSTTFWIGQAIKFQTFLKEFMNWENIKIVGIGDIDEFKNVLN 540
             L+  ++   +K      N   +W GQAIKFQ FLK  M  +N +++ +GDI   K + +
Sbjct: 476  SLIEIDDPNIEKYEETKAN-VRWWTGQAIKFQNFLKSHMKHDNTRLLLLGDIKSHK-IFH 533

Query: 541  IVKEMSK-KTDLYYEFEY--QKLKISKKSRICPR-DYPFTYPIKNEYLPKFGYXXXXXXX 596
            I++  S+ +TD +YEFEY    + ++++++  P+  Y F +P  N +LP +         
Sbjct: 534  IIENKSEIRTDFFYEFEYYTGSVHLAEENKYYPKSSYEFNFPKSNLFLPDYISDPLKLRQ 593

Query: 597  XXXXXXESSRTVSFYMPQVSEEEDQN--KLVSQNDMHKLWVNPKNSKDQLSESPCIVSFK 654
                    S+  +   PQ+  E  +   +LVS+N  +++W+  K   +  S +  +VSF+
Sbjct: 594  LFLECSLKSKFATL-RPQIYSEPTRREPQLVSENLNYEMWI-LKEDPNFASNNKSVVSFE 651

Query: 655  LVNNSIQESPESTMHLELMGQLLHTLLINKLYPALNVGYTFEISPSVRGDVSLSFTLSGF 714
            ++   I+ SPE+T+HLE++ Q+L  +  + LYPAL +GYT+EI+ S +G V+L FT+SGF
Sbjct: 652  VLGLGIKPSPEATIHLEVLAQVLFIITSSHLYPALRIGYTYEIASSSKGSVTLRFTISGF 711

Query: 715  SEGIFKIIKECINIFGELTSSD--LITKKEFRRARILVRDKYEDAASDSCVKLASVGLLI 772
             EG+FKI+K  ++   +L ++D   ++K   R+ARI VR KYE A+SD+CVKLAS+GLLI
Sbjct: 712  PEGVFKIVKTFVDTL-KLIATDPTFLSKDTLRKARIFVRSKYESASSDNCVKLASIGLLI 770

Query: 773  LLERKMWTLEERIDALELIDLEMFLEFAQKFFQNL-FLSLYIEGNLEYADLINSYFSDKL 831
            +LE  +WTL++RI+ALEL ++E F EF   F++N   L L ++G+L+YAD IN Y +   
Sbjct: 771  VLEEFIWTLQDRINALELTEMESFKEFCSLFWKNPKQLVLLVQGSLDYADEINHYLNRNF 830

Query: 832  VHHLTKRLDYPKEDT--LQSLPSTK-LISGTNIYYELEGSVDDPNNSIVYFIQTGDLSNK 888
              HL K  +   + T  L   PSTK L  GTN +    G  DDPNNSIVYFIQT    + 
Sbjct: 831  TQHL-KVCNEGSKSTIHLYPSPSTKNLDEGTNAFISYNGHQDDPNNSIVYFIQTAQRDDI 889

Query: 889  KILSLTSLTAFIISFSLVPELRNKKQIGYVVFGGLRTLSDTVGLHITIMSDGKPLDIEIE 948
            + L+LT LT ++ S +LVP+LRN+KQIGY+V GGLR L+DTVG+H+T+MS     ++E +
Sbjct: 890  ENLALTFLTEYLFSLTLVPDLRNRKQIGYIVLGGLRVLTDTVGIHVTVMSGSSAHNLETK 949

Query: 949  IEKYISYLEFDLLGNLDDETFQNNYLIKYIDLINGIYKKSTEQTSGPINIMNEIIANVHG 1008
            I +Y+SYLE  +L NL +  F+   L  ++ L+        E+++GP++++NEI+ANV  
Sbjct: 950  INEYLSYLELQVLDNLTEIDFRKMLLEPFLTLLKQNSITKFEESAGPVDLLNEIVANVQN 1009

Query: 1009 GDSAILNSEXXXXXXXXXXELFGDA-QMTEELKYVDIEFLKNLNLIKYLQFFKGSISTNS 1067
            GD+  LN+           ++        EE + V+I FL+ L L KYL+FF+  IS  S
Sbjct: 1010 GDNYTLNNRQMKQHRKVRNKITEKRLNFQEEYEMVNIPFLQKLTLKKYLRFFQAKISIYS 1069

Query: 1068 KRRSKLSIHIKSPMEERELFNRKLFLQLQTFLKIKGFPIKSNELQQIVERTNGRPTLLFK 1127
             +RSK+SI I SPM E ++ +R++FLQL+ FLKIKGF IK+ +L++IVE + G P LL K
Sbjct: 1070 TQRSKISIMIASPMAEEKIASRRIFLQLEAFLKIKGFAIKNEDLKKIVEHSEGSPMLLVK 1129

Query: 1128 ELFACFKARDESWKFISIVLKEILKVISMSIKQQCKTRGSETRSSIQHSE------FHND 1181
             LF  F+ R+E++K  ++VL+EILK+I M+ KQ     GS    S  +SE      F  +
Sbjct: 1130 NLFTHFRKRNEAFKLGTVVLQEILKIIGMNFKQ---GYGSVLGFSSHNSEGQDVKNFWKN 1186

Query: 1182 HIITPTPLEKVEDIN 1196
             I    PL+++ D N
Sbjct: 1187 DIEPVIPLQELPDPN 1201

>YPR122W Chr16 (782045..785671) [3627 bp, 1208 aa] {ON}  AXL1Haploid
            specific endoprotease that performs one of two N-terminal
            cleavages during maturation of a-factor mating pheromone;
            required for axial budding pattern of haploid cells
          Length = 1208

 Score = 1005 bits (2599), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 556/1217 (45%), Positives = 789/1217 (64%), Gaps = 37/1217 (3%)

Query: 1    MSWINTKTFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDP 60
            MS      +++ FY+P SYSNR  K+C+LPNGILAL+ISD + T+++CS++V TGSH+DP
Sbjct: 1    MSLREVTNYEVSFYIPLSYSNRTHKVCKLPNGILALIISDPTDTSSSCSLTVCTGSHNDP 60

Query: 61   RDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAI 120
            +DI G+AHLCEHMIL+AGSKKYP PGLFH ++A NNGSQNAFTTGEQTTFYFELP +   
Sbjct: 61   KDIAGLAHLCEHMILSAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQNN 120

Query: 121  EQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSH 180
             + TF  ILD+F+SFFK+PLFN +L +KEIYAI+SEH+GN+S+T+KI YHA R+L+N  H
Sbjct: 121  GEFTFESILDVFASFFKEPLFNPLLISKEIYAIQSEHEGNISSTTKIFYHAARILANPDH 180

Query: 181  PFHNFSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALA 240
            PF  FSTGNIH+LS +  LKK  LK  L  YF+NN+F  N+T+CI+GPQS+N LTKLAL+
Sbjct: 181  PFSRFSTGNIHSLSSIPQLKKIKLKSSLNTYFENNFFGENITLCIRGPQSVNILTKLALS 240

Query: 241  NFGDIKDKDELTKFHINSIKPQXXXXXXXXXXXXXXCNSFKTNENLDLENFKLLDNAWLD 300
             FGDIK K  + +  I SI+ +                    N+  DL+ FK+L+  W  
Sbjct: 241  KFGDIKPKSAVKERSI-SIRTRSFRRSKSLKKRQDSSK----NDYSDLKTFKILNTTWEK 295

Query: 301  KYGDNVCFPTSLSHNTIFLSSSKQPILRLLFPISEKLTRFTKRDIKIYSNIWCHIFGDET 360
            KY + +CF      N+IF++S+K PI+RLLFP+S+K TRFTK DIKIYS++WC +FGDE+
Sbjct: 296  KYKNTMCFQQFPECNSIFINSNKVPIMRLLFPVSDKNTRFTKDDIKIYSHLWCELFGDES 355

Query: 361  KGSFCDYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIIDILLQQVVKLL 420
             GS   YL    W+T C+AF S FAIG+  LILEL+LTN+G + ++ I  I+L    +LL
Sbjct: 356  PGSLSYYLASKGWLTGCFAFTSEFAIGDIGLILELELTNSGWENIKRITTIVLN---RLL 412

Query: 421  VDNFTENLAY---FLAENNIISILRFINSDVEINPMDECSELSGLLQENFKLFNPKYLFY 477
               +  N+ Y   FL E N+I ++ F+    E  PM+ECS+LSG+LQ++ +   P  +F 
Sbjct: 413  PSFYVMNIDYLITFLKEQNLIDLVSFLYQSSEDLPMEECSKLSGILQDDLECLTPPNIFK 472

Query: 478  GSEFLLLENESLPQKNNMFDGNSTTFWIGQAIKFQTFLKEFMNWENIKIVGIGDIDEFKN 537
            G + L+  ++   +K      N   +W GQAIKFQ FLK FMN +N++++ +G+I    N
Sbjct: 473  GFKSLIEIDDPNIEKYENTKAN-IQWWTGQAIKFQNFLKSFMNHDNMRLLLLGNIKS-GN 530

Query: 538  VLNIVKEMSK-KTDLYYEFEYQKLKI---SKKSRICPRDYPFTYPIKNEYLPKFGYXXXX 593
            + + +K  S   TD +YEFEY    +   S         Y F +P  N +LP        
Sbjct: 531  IFDKMKNKSDICTDFFYEFEYYTANVHLASDNKFHSNSSYEFNFPTGNLFLPDCVSDPLK 590

Query: 594  XXXXXXXXXESSRTVSFYMPQVSEEEDQNK--LVSQNDMHKLWVNPKNSKDQLSESPCIV 651
                       S+  +   PQ+  E  + K  LVS+N  +++W+  K   +  S++  +V
Sbjct: 591  LQQLFLECSLKSKFATL-RPQIYSEPTRTKPQLVSENQNYEMWI-LKEDPNFASDNKSVV 648

Query: 652  SFKLVNNSIQESPESTMHLELMGQLLHTLLINKLYPALNVGYTFEISPSVRGDVSLSFTL 711
            SF+++   I+ SPE+T+HLE++ Q L  +  + LYPAL +GYT+EI+ S +G+V+L FT+
Sbjct: 649  SFEVLGLGIKPSPEATIHLEVLAQALFIITSSFLYPALRIGYTYEIASSSKGNVTLRFTI 708

Query: 712  SGFSEGIFKIIKECINIFGELTSSD--LITKKEFRRARILVRDKYEDAASDSCVKLASVG 769
            SGF EG+F I+K  ++   +L ++D   ++K   R+ARILVR+KY++A+SD+CVKLASVG
Sbjct: 709  SGFPEGVFTIVKTFVDTL-KLIATDPTFLSKDTLRKARILVRNKYKNASSDNCVKLASVG 767

Query: 770  LLILLERKMWTLEERIDALELIDLEMFLEFAQKFFQNL-FLSLYIEGNLEYADLINSYFS 828
            LLI+LE+ +WTLE+RI+ALEL +LE F +F   F++N   L L+++G+LEYAD IN Y +
Sbjct: 768  LLIVLEKYIWTLEDRINALELTELESFEKFCFLFWRNPKHLVLFMQGSLEYADAINRYLN 827

Query: 829  DKLVHHLTKRLDYPKEDT-LQSLPSTK-LISGTNIYYELEGSVDDPNNSIVYFIQTGDLS 886
            +    HL    +  K    L   PSTK L  GTN +    G  DDPNNSIVYFIQT    
Sbjct: 828  NNFTQHLKISNEGSKPTIRLYPPPSTKDLDQGTNAFISYNGHQDDPNNSIVYFIQTAQRD 887

Query: 887  NKKILSLTSLTAFIISFSLVPELRNKKQIGYVVFGGLRTLSDTVGLHITIMSDGKPLDIE 946
            + K L+LT LT ++ S +LVP+LRNKKQIGY+V GGLR L+DTVG+HIT+MS     ++E
Sbjct: 888  DIKNLTLTFLTEYLFSLTLVPDLRNKKQIGYIVLGGLRVLTDTVGIHITVMSGSSGHNLE 947

Query: 947  IEIEKYISYLEFDLLGNLDDETFQNNYLIKYIDLINGIYKKSTEQTSGPINIMNEIIANV 1006
              I +Y+SYL+  +L    +  F+   L  +++L+     K  E ++GP++++NEI+ANV
Sbjct: 948  TRINEYLSYLQLQVLNRFTEFDFRRILLEPFLNLLKQNSTKQFEGSAGPVDLLNEIVANV 1007

Query: 1007 HGGDSAILNSEXXXXXXXXXXELF-GDAQMTEELKYVDIEFLKNLNLIKYLQFFKGSIST 1065
              GD+  LN++          ++  G     E+ + +DI FL+ L L KYL FF+  IS 
Sbjct: 1008 QNGDNYTLNNKQMRQHRKVRNKIAEGRLNFQEDHEMIDISFLQKLTLKKYLAFFESKISI 1067

Query: 1066 NSKRRSKLSIHIKSPMEERELFNRKLFLQLQTFLKIKGFPIKSNELQQIVERTNGRPTLL 1125
             S +RSKLSI I SPM E+E+ +RK+FLQL+ FLKI GF IK+ +L++IVE + G P LL
Sbjct: 1068 YSAQRSKLSIMITSPMAEKEIASRKMFLQLEAFLKINGFAIKNEDLKKIVEHSKGNPILL 1127

Query: 1126 FKELFACFKARDESWKFISIVLKEILKVISMSIKQQCKTRGSETRSSIQHSE------FH 1179
             K LF  F+ R+E +K  ++VL+EILK+I M++KQ+    GS    S Q  E      F 
Sbjct: 1128 VKNLFTYFRRRNEVFKLGTVVLQEILKIIGMNLKQR---YGSILGFSSQDGEGQEIEKFW 1184

Query: 1180 NDHIITPTPLEKVEDIN 1196
            N+      PL+++ + N
Sbjct: 1185 NNDTSPIVPLQELPEPN 1201

>NCAS0A11630 Chr1 (2311038..2314643) [3606 bp, 1201 aa] {ON} Anc_3.455
            YPR122W
          Length = 1201

 Score =  997 bits (2578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/1178 (46%), Positives = 765/1178 (64%), Gaps = 41/1178 (3%)

Query: 1    MSWINTKTFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDP 60
            MSW   K FD+  YLP +YSNR  KLC LPNG+L LLISD + T T+CS+SVA+GSH+DP
Sbjct: 1    MSWQEIKDFDVPLYLPLAYSNRVHKLCLLPNGLLTLLISDPADTVTSCSLSVASGSHNDP 60

Query: 61   RDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAI 120
            +DI G+AHLCEHMILAAGSK YP PGL+HE L+ NNG  NAFTTGEQTTFYFE+P     
Sbjct: 61   KDIQGLAHLCEHMILAAGSKSYPDPGLYHETLSKNNGVHNAFTTGEQTTFYFEVPNVHHG 120

Query: 121  EQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSH 180
             +  F EILDIF+SFFK+PLFN +LTNKEIYAI+SEHDGNMS+ +KILYHA R+LS+  H
Sbjct: 121  GELVFDEILDIFASFFKEPLFNPLLTNKEIYAIQSEHDGNMSSVTKILYHATRMLSDPGH 180

Query: 181  PFHNFSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALA 240
            PF  FSTGN++TL+ +  L+  NL+  LF+YFK NY++  MT+C++GPQS+N LTK AL+
Sbjct: 181  PFSQFSTGNMNTLASIPKLQGVNLQRTLFQYFKKNYYASKMTLCLRGPQSVNILTKYALS 240

Query: 241  NFGDIKDKDELTKFHINSIKPQXXXXXXXXXXXXXXCNSFKTNENLDLENFKLLDNAWLD 300
             FGDIK+   LT+    S+                   +       DLE+F +L+ +W  
Sbjct: 241  KFGDIKENTALTRSRFGSMSSISTKRSSKSSTENHSTKN-------DLESFNILEESWRQ 293

Query: 301  KYGDNVCFPTSLSHNTIFLSSSKQPILRLLFPISEKLTRFTKRDIKIYSNIWCHIFGDET 360
            KY D  CFP     N IF+ SSKQP LR+LFP+++  TRFTK +IKI+ ++WC +FGDET
Sbjct: 294  KYCDIPCFPEISKENMIFIKSSKQPTLRILFPVTDNKTRFTKGEIKIFGDLWCELFGDET 353

Query: 361  KGSFCDYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIIDILLQQVVKLL 420
            KGS C YL   +WIT CYA+ S+FA+GN  LI+EL LT+TG +    II+I+L ++V+  
Sbjct: 354  KGSLCYYLVGKSWITSCYAYTSSFALGNIGLIIELTLTSTGWENSDTIIEIVLGKLVETF 413

Query: 421  VDNFTENLAYFLAENNIISILRFINSDVEINPMDECSELSGLLQENFKLFNPKYLFYGSE 480
             + +   LA F+ + N I ++RF+    + NPM+ECS LS LLQ + K  N  Y+F GS 
Sbjct: 414  SEQYVHELANFMEDQNSIDLIRFLYQVPKKNPMEECSNLSELLQNDLKAPNMAYIFKGS- 472

Query: 481  FLLLENESLPQKNNMFDGN--------STTFWIGQAIKFQTFLKEFMNWENIKIVGIGDI 532
                     P   +M +GN        +  +WI QAIKFQ+F+K+FMN  N +++ +G +
Sbjct: 473  ---------PPITDMHEGNVGGINSEHNQEWWIDQAIKFQSFMKKFMNSSNARVILLGSL 523

Query: 533  DEFKNVLNIVKEMSKKTDLYYEFEYQKLKISKKSRICPRDYPFTYPIKNEYLPKFGYXXX 592
            +    +     + +  T+ +YEFEY+   I+ K+      Y F  P KN+++P       
Sbjct: 524  ERIPELFKKEIQNTLTTEPFYEFEYKISTINLKASQSVNTYEFCIPHKNKFIPSACKGDG 583

Query: 593  XXXXXXXXXXESSRTVSFYMPQVSEEEDQNK--LVSQNDMHKLWVNPKNSKDQLSESPCI 650
                        S+  + ++ Q++    +NK  LV +N  +++W   K   + + +   I
Sbjct: 584  VLEQLFLESSLKSQYSNLHL-QINSMSFENKPQLVGRNQRYEMWT-LKEDLNSIMDLKSI 641

Query: 651  VSFKLVNNSIQESPESTMHLELMGQLLHTLLINKLYPALNVGYTFEISPSVRGDVSLSFT 710
            VSF++++  ++ SPE+T+HLE++ Q++ TL+  +LYPA+ +GY +EIS S +GDV L FT
Sbjct: 642  VSFEVLSTDMKGSPENTIHLEILNQIIFTLISPQLYPAIKLGYFYEISASSKGDVQLRFT 701

Query: 711  LSGFSEGIFKIIKECINIFGELTSS-DLITKKEFRRARILVRDKYEDAASDSCVKLASVG 769
            + GFSEGI  +I+  I     +T++ D  +K+  RRAR+LVR  YE+AA+D+CVKLAS+G
Sbjct: 702  IGGFSEGILMLIEIIIKTIIFITTTPDFPSKELLRRARVLVRSNYENAAADNCVKLASLG 761

Query: 770  LLILLERKMWTLEERIDALELIDLEMFLEFAQKFFQ-NLFLSLYIEGNLEYADLINSYFS 828
            LLI+LE  MW+LE+RIDALE + +  F EF Q F   + +L+L+I+GNL YAD IN +  
Sbjct: 762  LLIVLEENMWSLEDRIDALEDVTMASFKEFCQSFLNGSKYLTLFIQGNLSYADKINQF-- 819

Query: 829  DKLVHHLTKRLDYPKEDT--LQSLPSTKLIS-GTNIYYELEGSVDDPNNSIVYFIQTGDL 885
              L  + TK LD  K+ +  L +  ST ++  GTNI+ E  G +DDPNNSIVYFIQTG  
Sbjct: 820  --LNLNFTKHLDINKDTSLPLNAHTSTHILKPGTNIFAEYPGPLDDPNNSIVYFIQTGLR 877

Query: 886  SNKKILSLTSLTAFIISFSLVPELRNKKQIGYVVFGGLRTLSDTVGLHITIMSDGKPLDI 945
            S+  + +LTS T +I+S +LVPELRNKKQIGY+V GGLR L+DT+G++IT+MS  +P+D+
Sbjct: 878  SDTDLCTLTSFTEYIMSLTLVPELRNKKQIGYLVMGGLRVLTDTIGVYITVMSGSEPIDL 937

Query: 946  EIEIEKYISYLEFDLLGNLDDETFQNNYLIKYIDLINGIYKKSTEQTSGPINIMNEIIAN 1005
            E +I++YI+++E  +L  L + TF+  Y   Y+ L+    +    + SGP N++NEI+ N
Sbjct: 938  ESKIDEYIAFIENGVLNRLTEATFEREYKQAYLTLLGDNNQNKGGKLSGPANLLNEIVPN 997

Query: 1006 VHGGDSAILNSEXXXXXXXXXXELFGDAQ--MTEELKYVDIEFLKNLNLIKYLQFFKGSI 1063
            V  G S  LNS           ++  D Q   T+E  ++DI  ++ L L  YL FFK  I
Sbjct: 998  VQVGSSDQLNSTSMKLHRRFRNQI-SDKQYNFTDEELHIDIPLIEKLTLSSYLNFFKDKI 1056

Query: 1064 STNSKRRSKLSIHIKSPMEERELFNRKLFLQLQTFLKIKGFPIKSNELQQIVERTNGRPT 1123
            S  S  RSKLSI I S M  +++ NRK +LQL+ FLKIKGF IK  +LQ+IV+  +G  +
Sbjct: 1057 SIFSPTRSKLSIMITSSMAAKDIINRKTYLQLEAFLKIKGFTIKKEKLQEIVDSADGNSS 1116

Query: 1124 LLFKELFACFKARDESWKFISIVLKEILKVISMSIKQQ 1161
            LL K LF  F++R+E WK  ++VLKE++K+   S+KQ 
Sbjct: 1117 LLIKNLFNYFRSRNEGWKLCTVVLKEVVKMSITSLKQH 1154

>Suva_16.451 Chr16 (784213..787869) [3657 bp, 1218 aa] {ON} YPR122W
            (REAL)
          Length = 1218

 Score =  993 bits (2568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 559/1198 (46%), Positives = 764/1198 (63%), Gaps = 33/1198 (2%)

Query: 1    MSWINTKTFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDP 60
            MS      ++I FY+P SY NR  K+C+LPNGILAL+ISD + ++++CS+SV TGSH+DP
Sbjct: 1    MSLREVSNYEIPFYIPLSYGNRTHKICKLPNGILALIISDPTDSSSSCSLSVCTGSHNDP 60

Query: 61   RDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAI 120
             DIPG+AHLCEHMILAAGSKKYP PGLFH ++A NNGSQNAFTTGEQTTFYFELP + + 
Sbjct: 61   EDIPGLAHLCEHMILAAGSKKYPDPGLFHTLIAKNNGSQNAFTTGEQTTFYFELPNTQSN 120

Query: 121  EQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSH 180
             +  F   LD+F+SFFK+PLFN +L  KEIYAI+SEH+GNMS+T+KI YHA R+L+N  H
Sbjct: 121  GELAFESTLDVFASFFKEPLFNPLLIGKEIYAIQSEHEGNMSSTTKIFYHAARMLANADH 180

Query: 181  PFHNFSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALA 240
            PF +FSTGNIH+LS V +L+K N+K  L  YFKNN++  NMT+C++G QS+N LTKLA++
Sbjct: 181  PFSHFSTGNIHSLSSVPHLEKINVKNSLNTYFKNNFYGENMTLCMRGSQSVNILTKLAIS 240

Query: 241  NFGDIKDKDEL--TKFHINSIKPQXXXXXXXXXXXXXXCNSFKTNEN---LDLENFKLLD 295
             FGDI  K+++  + F I +   +               +    + N    +LEN K+ D
Sbjct: 241  KFGDISLKNDIKGSNFSIKAGSFRRSRSLRRSQDASKTGSPTSESSNTSSYNLENSKISD 300

Query: 296  NAWLDKYGDNVCFPTSLSHNTIFLSSSKQPILRLLFPISEKLTRFTKRDIKIYSNIWCHI 355
              W +KYG   CF     +N+IF++SSK PI+R LFP+S+K TRFTK DIK+YS++W  +
Sbjct: 301  TVWEEKYGSVSCFENPSKYNSIFINSSKAPIVRFLFPVSDKNTRFTKEDIKVYSHLWREL 360

Query: 356  FGDETKGSFCDYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIIDILLQQ 415
            FGDE+ GS   YL    W T  +AF S FAIGN  L+LEL+LT TG + +++I   +  +
Sbjct: 361  FGDESPGSLSHYLVSKGWATSSFAFISEFAIGNIGLVLELELTKTGWRSVESIATTIFSK 420

Query: 416  VVKLLVDNFTENLAYFLAENNIISILRFINSDVEINPMDECSELSGLLQENFKLFNPKYL 475
            ++        ++L  FL E N+I I RF+  + E  PM+ECS LSG+LQEN +   P  +
Sbjct: 421  LLPSFCTKNIDHLIGFLREQNLIDIARFLYQNSEDLPMEECSHLSGILQENLECLTPCNI 480

Query: 476  FYGSEFLLLENESLPQK--NNMFDGNSTTFWIGQAIKFQTFLKEFMNWENIKIVGIGDID 533
            F G + L+  N+   +K  NN  +     +W GQAIKFQ FLK FMN EN +I+ +GDI 
Sbjct: 481  FKGFKSLIEINDPNIEKYENNKLN---VQWWTGQAIKFQNFLKSFMNHENTRILLLGDIK 537

Query: 534  EFKNVLNIVKEMSKKTDLYYEFEY--QKLKISKKSRICPRD-YPFTYPIKNEYLPKFGYX 590
                   I  E    T+ +YEFEY   ++ +S+  +   +  Y F +P KN +LP F   
Sbjct: 538  SHNLFDKIEDESEIHTEFFYEFEYYMGRVHLSEDHKYHSQSPYEFNFPTKNPFLPDFVND 597

Query: 591  XXXXXXXXXXXXESSRTVSFYMPQVSEE--EDQNKLVSQNDMHKLWV---NPKNSKDQLS 645
                          S+  +   PQ+  E  E   +LVS+N  +++WV   +P  + D +S
Sbjct: 598  PLKLQQLYLECSLKSKFATL-RPQIQSEPIEILPQLVSKNLNYEMWVLKEDPNFTSDNVS 656

Query: 646  ESPCIVSFKLVNNSIQESPESTMHLELMGQLLHTLLINKLYPALNVGYTFEISPSVRGDV 705
                +VSF+++   I+ SPE+T+HLE++ Q+L     + LYPAL  GYT+EI+ S +G+V
Sbjct: 657  ----VVSFEVIGLGIKPSPEATIHLEVLAQILFITTSSNLYPALRAGYTYEIASSSKGNV 712

Query: 706  SLSFTLSGFSEGIFKIIKECINIFGEL-TSSDLITKKEFRRARILVRDKYEDAASDSCVK 764
            +L FT+SGFSEG+FKI K  ++    + T     +K   R+ARILVR KYE A+SD+ VK
Sbjct: 713  TLRFTISGFSEGVFKITKAFVDTLKLIGTDPTFPSKDALRKARILVRSKYESASSDNGVK 772

Query: 765  LASVGLLILLERKMWTLEERIDALELIDLEMFLEFAQKFFQNL-FLSLYIEGNLEYADLI 823
            LAS+GLLI+LE  MWTL++RIDALEL D+E    F   F++N   L+L I+GNL+YAD I
Sbjct: 773  LASIGLLIVLEEYMWTLQDRIDALELTDMESLKNFCSLFWKNPKQLALLIQGNLDYADEI 832

Query: 824  NSYFSDKLVHHLTKRLDYPKEDTLQSLPS--TKLIS-GTNIYYELEGSVDDPNNSIVYFI 880
            N Y ++    HL K  D     T++  PS  TK I  GTN +    G  DDPNNS+ YFI
Sbjct: 833  NHYLNNNFTQHL-KVCDEGNRPTIRLYPSPNTKNIDPGTNAFISCNGHQDDPNNSLAYFI 891

Query: 881  QTGDLSNKKILSLTSLTAFIISFSLVPELRNKKQIGYVVFGGLRTLSDTVGLHITIMSDG 940
            QT    N + L+LT LT +I S +LVP+LRNKKQIGY+V  GLR L+DT+G+HIT+MS  
Sbjct: 892  QTAQRDNIENLTLTFLTEYIFSQTLVPDLRNKKQIGYIVLSGLRILTDTIGIHITVMSGS 951

Query: 941  KPLDIEIEIEKYISYLEFDLLGNLDDETFQNNYLIKYIDLINGIYKKSTEQTSGPINIMN 1000
                +E +I +Y+SYLEF +L N  + TF+   L  ++ L+        +  SGP N++N
Sbjct: 952  SAHSLETKINEYLSYLEFQVLNNFTESTFRTMLLEPFLALLKKNNFNKLKTLSGPSNLLN 1011

Query: 1001 EIIANVHGGDSAILNSEXXXXXXXXXXELFGDA-QMTEELKYVDIEFLKNLNLIKYLQFF 1059
            EI+ANV  GD  ILN+            +        EE + VDI FL+ L L KYL+FF
Sbjct: 1012 EIVANVQNGDDYILNNRQMKHHRRIRNSISEKRLHFQEENEMVDILFLQKLTLKKYLEFF 1071

Query: 1060 KGSISTNSKRRSKLSIHIKSPMEERELFNRKLFLQLQTFLKIKGFPIKSNELQQIVERTN 1119
               IS  S++RSKLSI I SPM E E+ +RK+FLQL+ FLKIKGF IKS +L++IVE + 
Sbjct: 1072 GSRISIYSRQRSKLSIMITSPMAEEEIASRKMFLQLEAFLKIKGFAIKSRDLEKIVEDSK 1131

Query: 1120 GRPTLLFKELFACFKARDESWKFISIVLKEILKVISMSIKQQCKTRGSETRSSIQHSE 1177
            G P LL K LF  F+ R E++K  ++VLKEI K+I+++ KQ   T GS    S + SE
Sbjct: 1132 GSPVLLLKNLFTFFRKRSEAFKLGTVVLKEISKIIAINFKQ---TYGSVLGFSSKDSE 1186

>Kpol_1050.88 s1050 (199457..203098) [3642 bp, 1213 aa] {ON}
            (199457..203098) [3642 nt, 1214 aa]
          Length = 1213

 Score =  968 bits (2503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/1185 (44%), Positives = 742/1185 (62%), Gaps = 40/1185 (3%)

Query: 1    MSWINTKTFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDP 60
            MSW   K +DI FY P SY  R  KLCRLPNG+L LLISD   ++  CS+SVATGSH+DP
Sbjct: 1    MSWSEVKNYDIPFYTPISYRGRTNKLCRLPNGMLVLLISDPGESSFGCSLSVATGSHNDP 60

Query: 61   RDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAI 120
            ++IPG+AHLCEHMILAAGSKKYP PGL+HE++A N G QNA+TTGEQTTFYFELP     
Sbjct: 61   KEIPGLAHLCEHMILAAGSKKYPNPGLYHELIAKNKGLQNAYTTGEQTTFYFELPNVNQT 120

Query: 121  EQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSH 180
                F +I+D+F+SFFK PLFN+ LT+KEIYAIESEH GN SN +KI YHAERLL+N +H
Sbjct: 121  STPVFEDIIDVFASFFKDPLFNQTLTSKEIYAIESEHTGNTSNPTKIFYHAERLLANSNH 180

Query: 181  PFHNFSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALA 240
            PF +FSTGNI+TLS    L+K NLK +L  YFK N+ + NMT+CIKGPQS+N LTK+A+ 
Sbjct: 181  PFSHFSTGNINTLSSGPQLRKINLKSLLDSYFKVNFKAENMTLCIKGPQSVNILTKIAIR 240

Query: 241  NFGDIKDKDELTKF-HINSIKPQXXXXXXXXXXXXXXCNSFK------TNENLDLENFKL 293
             F DIK  + + K     +I+                  S K      +  N  L + K+
Sbjct: 241  YFSDIKGLNSIKKPKRFGTIRKSISTSEKSIPLSPSSPTSCKSISSVLSETNSSLLSTKI 300

Query: 294  LDNAWLDKYGDNVCFPTSLSHNTIFLSSSKQPILRLLFPISEKLTRFTKRDIKIYSNIWC 353
            L+N W  KY + VCF     +NTI + S+K+P+LRL+FP+     +F+K ++  + N+WC
Sbjct: 301  LENVWSPKYNNMVCFDPKPKYNTIIVKSNKKPVLRLVFPVVTNKGKFSKEELITFCNLWC 360

Query: 354  HIFGDETKGSFCDYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIIDILL 413
               GDE++ S C+ L    +IT+  AF S FA+ N  LILE  LT+ G+  + +II+ ++
Sbjct: 361  ETLGDESENSICNILMNEEYITDILAFTSDFALNNIGLILEFSLTDKGLNNVSHIINSIM 420

Query: 414  QQVVKLLVDNFTENLAYFLAENNIISILRFINSDVEINPMDECSELSGLLQENFKLFNPK 473
            +  +  L   +TE LA FL+E + I +L F++ + E++PM+ECS+LSGL+Q +  +  P+
Sbjct: 421  ESAIPKLSKEYTEELARFLSECDSIDLLNFLHKESELSPMEECSDLSGLMQTDLDILKPE 480

Query: 474  YLFYGSEFLLLENESLPQKNNMFDGN-STTFWIGQAIKFQTFLKEFMNWENIKIVGIGDI 532
             LF  S  ++      P   N  + + S  +W+ +A  +Q FL+ +MN + ++I  + D 
Sbjct: 481  CLFKQSPMIV--GNKYPTIGNFGESSESRQWWLNKATMYQEFLEMYMNKDLLRIALLCDF 538

Query: 533  DEFKNVLNIVKEMSKKTDLYYEFEYQKLKISKKSRICPRDYP-----FTYPIKNEYLPKF 587
             E +     V E    TD +YEF+Y KL +  +    P D         +P KNEY+P+ 
Sbjct: 539  SEKQYFGKNVSEQKLVTDTFYEFDYIKLSVLPEK--VPEDQVDIFSNLKFPAKNEYIPEL 596

Query: 588  GYXXXXXXXXXXXXXESSRT--VSFYMPQVSEEEDQNKLVSQNDMHKLWVNPKNSKDQLS 645
            G                SR+  +S   P  +      KL  + DM+++WV     +   +
Sbjct: 597  GRSLLYLREMLKKVSYESRSPILSLTTPSKATRPIP-KLAEKGDMYEMWVMEDKFRPS-T 654

Query: 646  ESPCIVSFKLVNNSIQESPESTMHLELMGQLLHTLLINKLYPALNVGYTFEISPSVRGDV 705
            E   IV+F L++  +  +P++TMHLE++GQ+L+ LL  KLYP+L +GYT+EI+ S +GDV
Sbjct: 655  EKKTIVTFDLLSLDVPPTPKNTMHLEILGQILYVLLSPKLYPSLKLGYTYEIASSSKGDV 714

Query: 706  SLSFTLSGFSEGIFKIIKECINIFGELTSSDLI-TKKEFRRARILVRDKYEDAASDSCVK 764
             LSFTLSG+S+G+ +++K  I     +   D I +K+  RRARIL R KYE AA+++C K
Sbjct: 715  RLSFTLSGYSDGLTEVVKTVIKTCFTIAIDDEIPSKRLLRRARILTRRKYESAAAENCAK 774

Query: 765  LASVGLLILLERKMWTLEERIDALELIDLEMFLEFAQKFFQN-LFLSLYIEGNLEYADLI 823
            LASVGL+I+LE+ +W LE+R++ALE  D+  F EF   F ++  +L+L ++GNL+ A+ I
Sbjct: 775  LASVGLIIMLEKYIWPLEDRLNALEESDIHSFKEFCIAFLRSKKYLNLIVQGNLKCANEI 834

Query: 824  NSYFSDKLVHHL-------TKRLDYPKEDTLQSLPSTKLI-SGTNIYYELEGSVDDPNNS 875
            N Y +D   +HL       TK +D  K        +TKL+  GTN  +E  G  DDPNN 
Sbjct: 835  NKYLNDSFTNHLGEKSGKNTKSVDCSK--------TTKLLEPGTNCIFEHFGHPDDPNNC 886

Query: 876  IVYFIQTGDLSNKKILSLTSLTAFIISFSLVPELRNKKQIGYVVFGGLRTLSDTVGLHIT 935
            IVYFIQTG   +KK L+LTS T +++S +LVP+LRNKKQIGYVVFGG+R LSDTVG+HIT
Sbjct: 887  IVYFIQTGKRDDKKALALTSFTEYLLSLTLVPDLRNKKQIGYVVFGGMRVLSDTVGIHIT 946

Query: 936  IMSDGKPLDIEIEIEKYISYLEFDLLGNLDDETFQNNYLIKYIDLINGIYKKSTEQTSGP 995
            +MS   PLD+E +I++Y+ +LE ++L  L +E F   ++  Y+  + G        T+GP
Sbjct: 947  VMSGSNPLDLEEKIDEYLYFLESEVLKKLSEEQFGKKFVKDYLSTMGGDSTGDMMSTAGP 1006

Query: 996  INIMNEIIANVHGGDSAILNSEXXXXXXXXXXELFGDA-QMTEELKYVDIEFLKNLNLIK 1054
             N+++ I ANV  GD ++LNS           E+       + +    D+ F+K+L L K
Sbjct: 1007 PNVLDGIAANVQAGDFSVLNSLQMITHRRIKNEITSKRYNFSNDDIETDLNFIKHLTLKK 1066

Query: 1055 YLQFFKGSISTNSKRRSKLSIHIKSPMEERELFNRKLFLQLQTFLKIKGFPIKSNELQQI 1114
            YL+FF+ +IS +S  RSKLS+ I SPM  +E+ NRK FLQL+ FLK+ GF I ++ L+ +
Sbjct: 1067 YLKFFEENISISSVNRSKLSVAITSPMATQEIMNRKFFLQLEGFLKLNGFTINNDTLKSM 1126

Query: 1115 VERTNGRPTLLFKELFACFKARDESWKFISIVLKEILKVISMSIK 1159
            V  + GRP  LFK LF  F  R E WKF  IV  E+LK+I++S+K
Sbjct: 1127 VSESQGRPGKLFKLLFNYFSNRGEGWKFCKIVTSEVLKIIAISVK 1171

>NDAI0A04650 Chr1 complement(1046461..1050060) [3600 bp, 1199 aa] {ON}
            Anc_3.455 YPR122W
          Length = 1199

 Score =  963 bits (2489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/1214 (42%), Positives = 762/1214 (62%), Gaps = 38/1214 (3%)

Query: 1    MSWINTKTFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDP 60
            MSW + + +D  FY+P  YS+R  KLCRLPNGIL LLISD   T +ACS+SVATGSH+DP
Sbjct: 1    MSWQDVENYDTPFYIPRCYSDRVHKLCRLPNGILTLLISDPKDTISACSLSVATGSHNDP 60

Query: 61   RDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAI 120
             D+PG+AHLCEHM+LAAGSK YP  GL+H +L  NNG+QNAFTTGEQTTFYFE+PT+   
Sbjct: 61   ADLPGLAHLCEHMVLAAGSKDYPNAGLYHSMLTKNNGTQNAFTTGEQTTFYFEVPTTQNS 120

Query: 121  EQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSH 180
             +  F +++D+FSSFFK+PLFN +LTNKEIYAI+SEH+GN+S+ +KILYHA RL++NK H
Sbjct: 121  GELIFDKLVDVFSSFFKEPLFNPLLTNKEIYAIQSEHEGNISSLNKILYHATRLMANKDH 180

Query: 181  PFHNFSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALA 240
            PF  FSTGNI+TLS +  LKK NLK+ L +YF  N++   MT+C++GPQS+N+LTKL ++
Sbjct: 181  PFSQFSTGNINTLSSIPQLKKINLKKALLDYFARNFYGSKMTLCVRGPQSVNTLTKLVVS 240

Query: 241  NFGDIKDKDELTKFHINSIKPQXXXXXXXXXXXXXXCNSFKTNENLDLENFKLLDNAWLD 300
             FGDI+  + L +    SI  +                  K  +  DLE + +L + W  
Sbjct: 241  KFGDIRANNGLKRSKFGSISSRLSISSFQS----------KERQPTDLEQYNILKSTWKP 290

Query: 301  KYGDNVCFP-TSLSHNTIFLSSSKQPILRLLFPISEKLTRFTKRDIKIYSNIWCHIFGDE 359
            KY +  CF   S S N IF+ S+KQ  LR LFP+ +K ++F+ + + ++ N WC +FGDE
Sbjct: 291  KYREAPCFTHDSDSANMIFIRSNKQSTLRFLFPVEDKFSKFSSKTVSLFKNFWCELFGDE 350

Query: 360  TKGSFCDYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIIDILLQQVVKL 419
            TKGS C  L   +WIT+C+A+ S F+ G+  LIL+  LTNTG   +  II+I+L   +  
Sbjct: 351  TKGSLCYLLVGKSWITDCFAYTSEFSSGSYGLILQFALTNTGWDNVDKIINIVLDNTIAA 410

Query: 420  LVDNFTENLAYFLAENNIISILRFINSDVEINPMDECSELSGLLQENFKLFNPKYLFYGS 479
             +D  T+ L+ FL E N I ++RF+    E +PM+ECS +S LLQE+ +  +  YLF G+
Sbjct: 411  FIDKPTDQLSCFLKEQNTIDLIRFLYQPTEKSPMEECSNISCLLQEDLEDLDISYLFKGA 470

Query: 480  EFLLLENESLPQKNNMFD--GNSTTFWIGQAIKFQTFLKEFMNWENIKIVGIGDIDEFKN 537
              +   ++     NN  D        W+ QA +FQ FLK FMN  N+ +  +G+     +
Sbjct: 471  PTI---SDCYSNDNNTVDMIEYEQECWLKQAREFQEFLKVFMNRSNVFLFLLGNEKIAHS 527

Query: 538  VLNIVKEMSKKTDLYYEFEYQKLKIS-------KKSRICPRDYPFTYPIKNEYLPKFGYX 590
            + +I++       + Y    Q + ++       +  ++    Y F  P  N ++P     
Sbjct: 528  LRSIIR-------IRYFLLMQCMSLNILNVIYLRFPKLLSTQYTFQVPPPNAFIPPSCQD 580

Query: 591  XXXXXXXXXXXXESSRTVSFYMPQVSEE-EDQNKLVSQNDMHKLWVNPKNSKDQLSESPC 649
                          SR  +F +  ++    +   L+S+N  +++W    N  D   +   
Sbjct: 581  VTILQQLFLESSLKSRFSTFRLQLLNTNLGNVPHLISRNSSYEMWA-LDNPIDASIDKKS 639

Query: 650  IVSFKLVNNSIQESPESTMHLELMGQLLHTLLINKLYPALNVGYTFEISPSVRGDVSLSF 709
            I+SF++ N S+  SPE++++LE++ Q+L TL+  +LYP++ +GY++EIS S +GD+ L  
Sbjct: 640  IMSFEIFNRSMIPSPENSINLEILSQILSTLISPQLYPSIRLGYSYEISSSPKGDIQLKV 699

Query: 710  TLSGFSEGIFKIIKECINIFGELTSSDLITKKE-FRRARILVRDKYEDAASDSCVKLASV 768
            T+ GFSEGI  I+   +     +  +     KE  RR+R+LVR+ YE AASD+CV LAS+
Sbjct: 700  TIGGFSEGIISILDTIVKTLLFIMKTPQFPSKELLRRSRVLVRNLYEAAASDNCVTLASM 759

Query: 769  GLLILLERKMWTLEERIDALELIDLEMFLEFAQKFFQN-LFLSLYIEGNLEYADLINSYF 827
            GLLI+LER MWTL++R++ALE ID+  F EF  +F +  ++++L I+GNL+Y + IN+Y 
Sbjct: 760  GLLIILERNMWTLQDRLEALEEIDMVSFKEFCVQFLEEPMYMNLLIQGNLDYGEEINNYL 819

Query: 828  SDKLVHHLTKRLDYPKEDTLQSLPSTKLISGTNIYYELEGSVDDPNNSIVYFIQTGDLSN 887
            +  L HHL    +   E    +L +  L  G+N Y +  G +DDPNNSIVYFIQTG  +N
Sbjct: 820  NTNLTHHLECS-NVKNEKQSSTLSTILLEPGSNFYAKYNGHMDDPNNSIVYFIQTGLRTN 878

Query: 888  KKILSLTSLTAFIISFSLVPELRNKKQIGYVVFGGLRTLSDTVGLHITIMSDGKPLDIEI 947
            ++ ++LT  T +I+S +LVP+LRNK+QIGY VFGGLR L+ T+G+HIT+MS   P D+EI
Sbjct: 879  RRTVTLTYFTEYIMSLTLVPDLRNKRQIGYAVFGGLRELTSTIGIHITVMSGISPSDLEI 938

Query: 948  EIEKYISYLEFDLLGNLDDETFQNNYLIKYIDLINGIYKKSTEQTSGPINIMNEIIANVH 1007
            +I++YI+YLE  LL +L +  F   Y   Y+DL++       E++ GP +++NE++ANV 
Sbjct: 939  KIDEYIAYLEETLLNSLTENQFTLQYKQGYLDLLSNHKFMELEKSGGPADLLNEVVANVQ 998

Query: 1008 GGDSAILNSEXXXXXXXXXXELFGDA-QMTEELKYVDIEFLKNLNLIKYLQFFKGSISTN 1066
             G++  LNS           E+     Q   + + VDIE +KNL   ++L+FF+  +S  
Sbjct: 999  SGNADELNSHFMKSHKHFFNEISNKRYQFKGDSELVDIEVIKNLTKKEFLKFFREKVSIK 1058

Query: 1067 SKRRSKLSIHIKSPMEERELFNRKLFLQLQTFLKIKGFPIKSNELQQIVERTNGRPTLLF 1126
            SK RSK+S+ I+SPM E E+ NRK FLQLQ FLK++GF I S  L+ IVER NGRP+ L 
Sbjct: 1059 SKVRSKISVMIESPMAEMEIVNRKTFLQLQAFLKLEGFTINSEILRDIVERANGRPSALI 1118

Query: 1127 KELFACFKARDESWKFISIVLKEILKVISMSIKQQ--CKTRGSETRSSIQHSEFHNDHII 1184
            K+LF  F+ R+E+ +  +++LKE++KV + S+K +   K   S+ +   Q S   +    
Sbjct: 1119 KDLFKYFRERNEALRLCTVILKEVVKVSASSLKHRYTPKVSSSKMKPKRQSSSNWDQDTE 1178

Query: 1185 TPTPLEKVEDINKY 1198
               PL++++D+N++
Sbjct: 1179 PAIPLKEIKDLNEF 1192

>KAFR0A05370 Chr1 (1059317..1062922) [3606 bp, 1201 aa] {ON} Anc_3.455
            YPR122W
          Length = 1201

 Score =  962 bits (2487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/1216 (42%), Positives = 780/1216 (64%), Gaps = 41/1216 (3%)

Query: 1    MSWINTKTFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDP 60
            MSW   +  D+    P SYSNR  KLC LPNGI  LLISD + T++ACS++VATGSH+DP
Sbjct: 1    MSWTEVRHHDVQLCTPLSYSNRTHKLCTLPNGIPTLLISDPADTSSACSLTVATGSHNDP 60

Query: 61   RDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAI 120
             +IPG+AHL EHMILAAGSK+YP PGL+HE+++ NNGSQNAFTTGEQTTFYFELP +   
Sbjct: 61   PNIPGLAHLAEHMILAAGSKQYPDPGLYHELISKNNGSQNAFTTGEQTTFYFELPDTHKQ 120

Query: 121  EQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSH 180
             +  F ++LD+F+SFFK PLFN  + NKEIYAIE+EH  NMS  +KILYH+ RLL+NK H
Sbjct: 121  GELEFDKVLDVFASFFKNPLFNSSIINKEIYAIENEHTNNMSRQTKILYHSTRLLANKFH 180

Query: 181  PFHNFSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALA 240
            PF  F+TGNI +L     L+  ++K +L  YF  ++ +  MT+C++GP S+N LTKLA+A
Sbjct: 181  PFSQFTTGNIFSLDNNSQLRSISIKSLLVNYFAEHFKANKMTLCLRGPHSVNVLTKLAIA 240

Query: 241  NFGDIKDKDELTKFHINSIKPQXXXXXXXXXXXXXXCNSFKTNENLDLENFKLLDNAWLD 300
             F DIK +++L +    SI  +                         +E+  +L+N W  
Sbjct: 241  KFSDIKSQNDLQRNKFGSISSKRDSRQPRQGYS-------------KIESSNILENIWSK 287

Query: 301  KYGDNVCFPT-SLSHNTIFLSSSKQPILRLLFPISEKLTRFTKRDIKIYSNIWCHIFGDE 359
            +Y +  CF   S   N+IF+ S K+P++R LFP+S + T FT+R+I ++SN WC +FGDE
Sbjct: 288  RYANLPCFVNESKKVNSIFIKSKKKPLVRFLFPLSSQSTIFTQREIILFSNFWCTLFGDE 347

Query: 360  TKGSFCDYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIIDILLQQVVKL 419
            ++GS   +L +  W T  +++ STFA+G+  L++EL LTN+GV ++ +II++L +++VK+
Sbjct: 348  SEGSLMHFLVEKGWSTSGHSYVSTFAVGSIGLVIELALTNSGVGQITDIINVLFEKIVKI 407

Query: 420  LVDNFTENLAYFLAENNIISILRFINSDVEINPMDECSELSGLLQENFKLFNPKYLFYGS 479
            L    T  +A FL E NII  +RF+   VE +PM+ECS+LSGLLQEN ++ + KYLF GS
Sbjct: 408  LTTKHTTLMADFLNEQNIIEQVRFLYRGVEKDPMEECSDLSGLLQENMQVLDIKYLFKGS 467

Query: 480  EFLL-LENESLPQKNNMFDGNSTTFWIGQAIKFQTFLKEFMNWENIKIVGIG-DIDEFKN 537
              +  L +       +M DG     W   AIKFQ FL  FMN+EN++++ +G +  E + 
Sbjct: 468  PSITQLYSGKNQYSESMTDGKIQ--WTAYAIKFQNFLLTFMNYENLRLLFLGSNAKETRL 525

Query: 538  VLNIVKEMSKKTDLYYEFE-YQKLKISKK--SRICPRDYPFTYPIKNEYLPKFGYXXXXX 594
            +    K +  +TD +YEF+ Y+     +K  S I   +Y FT P  N ++PK        
Sbjct: 526  ITKEKKRIEFETDFFYEFDFYRTFTDFRKCSSDIETENYIFTLPSSNLFIPKSCRSYTYL 585

Query: 595  XXXXXXXXESSRTVSFYMPQVSEEEDQ--NKLVSQNDMHKLWVNPK--NSKDQLSESPCI 650
                      S+  S   PQV  E+      LVS +  +++W  P   NS   L  S  I
Sbjct: 586  QQAFQESSLKSKLASL-RPQVQIEKIHFAPTLVSDSPNYEMWTLPCAINSSPSL-RSKTI 643

Query: 651  VSFKLVNNSIQESPESTMHLELMGQLLHTLLINKLYPALNVGYTFEISPSVRGDVSLSFT 710
            V+F+L++ ++  S EST+HLE++ QLL  L+ +KLYP+L +GY+++I+ S +GDV L FT
Sbjct: 644  VTFELISTNMIPSAESTIHLEILAQLLFYLVSSKLYPSLKLGYSYDIASSSKGDVRLKFT 703

Query: 711  LSGFSEGIFKIIKECINIFGELTSSD---LITKKEFRRARILVRDKYEDAASDSCVKLAS 767
            +SGFSEG+  +++E I     +        +T +  R+AR+LVR KY++A  ++C KL S
Sbjct: 704  ISGFSEGLLLVLEEIIQSVLHIAKDKENIYVTNELLRKARVLVRRKYDEACCENCAKLGS 763

Query: 768  VGLLILLERKMWTLEERIDALELIDLEMFLEFAQKF-FQNL-FLSLYIEGNLEYADLINS 825
            VGLLILLE  +WTLE+RIDALE  D+  F  F  +F F++  + +L+I+GNL+ A  I+ 
Sbjct: 764  VGLLILLESFLWTLEDRIDALEDTDMTSFKNFVNEFLFESFNYFTLFIQGNLDRAHEIHH 823

Query: 826  YFSDKLVHHLTKRLDYPKEDTLQSLPSTKLIS-GTNIYYELEGSVDDPNNSIVYFIQTGD 884
            Y +D L HH    LD   E  + + P TK++  G+N +   +G  +DPNN+IVYFIQ+G 
Sbjct: 824  YLNDNLTHH----LDILPEKVILNKPRTKILQEGSNFFVAYDGHEEDPNNAIVYFIQSGL 879

Query: 885  LSNKKILSLTSLTAFIISFSLVPELRNKKQIGYVVFGGLRTLSDTVGLHITIMSDGKPLD 944
             S+    +LT+ T +++S +L+P+LR+KKQIGY+V GG+R L D++GLHIT++S   P D
Sbjct: 880  RSDSIAYTLTAFTEYLMSMTLLPDLRHKKQIGYIVVGGMRVLVDSIGLHITVVSGTPPQD 939

Query: 945  IEIEIEKYISYLEFDLLGNLDDETFQNNYLIKYIDLINGIYKKSTEQTSGPINIMNEIIA 1004
            +E +I++Y+++LE  +LG L +E F+N Y+  Y+D++NG    +   T+G  N++N+I++
Sbjct: 940  LEDKIDEYMNFLERIILGRLTEEEFRNQYVQNYLDMLNGKNNGTLNGTAGAHNLLNDIVS 999

Query: 1005 NVHGGDSAILNSEXXXXXXXXXXELFGDAQ-MTEELKYVDIEFLKNLNLIKYLQFFKGSI 1063
            NV  G+  ILNS           ++  D     ++++ ++ E ++ L L  Y+QFFK  I
Sbjct: 1000 NVANGEYEILNSSEMREHKRLWNQISDDDHSFLDDIELINREVIETLTLKGYMQFFKKKI 1059

Query: 1064 STNSKRRSKLSIHIKSPMEERELFNRKLFLQLQTFLKIKGFPIKSNELQQIVERTNGRPT 1123
            S +S +RSKLS+ + SPM E E+ NRKLFLQL+ FLKIKGF IKSN+L++IV++ +G+P+
Sbjct: 1060 SIHSNKRSKLSVMVTSPMPENEIINRKLFLQLEAFLKIKGFAIKSNQLKEIVDKADGKPS 1119

Query: 1124 LLFKELFACFKARDESWKFISIVLKEILKVISMSIKQQ-CKTRGSETRSSIQHS-EFHND 1181
            ++ K L + F+ R+E+WK +  VLKE+LK    ++K +  K   S T+S    S E  ++
Sbjct: 1120 VVLKLLLSEFRERNEAWKLLRAVLKEVLKTTGQTLKHRYGKVLPSPTKSDNSASLEKSSN 1179

Query: 1182 HIITPT-PLEKVEDIN 1196
            + + P  PL+++ED+N
Sbjct: 1180 YSVKPVIPLKRIEDLN 1195

>SAKL0F06886g Chr6 (524553..528104) [3552 bp, 1183 aa] {ON} similar to
            uniprot|P40851 Saccharomyces cerevisiae YPR122W AXL1
            Haploid specific endoprotease that performs one of two
            N-terminal cleavages during maturation of a- factor
            mating pheromone required for axial budding pattern of
            haploid cells
          Length = 1183

 Score =  934 bits (2414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 497/1167 (42%), Positives = 737/1167 (63%), Gaps = 23/1167 (1%)

Query: 1    MSWINTKTFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDP 60
            MS    + FD+ FY P S S+R+ ++ +L NG+L LLIS+ +   T+C++SVATGSH+DP
Sbjct: 1    MSSFGVRNFDVQFYTPISCSSRSHRVIQLDNGMLVLLISNPAEKATSCALSVATGSHNDP 60

Query: 61   RDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAI 120
            ++I G+AH CEHMIL+AGSK YP P  +H+V++ N GSQNAFTTGEQTTF FELP  +  
Sbjct: 61   KEILGLAHFCEHMILSAGSKSYPDPNAYHDVISKNGGSQNAFTTGEQTTFCFELPNLSNS 120

Query: 121  EQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSH 180
            ++  F ++LDIFSS FKKPLFNE+L NKEIYAI SEH  N S+  KI YHA RLL+N  H
Sbjct: 121  DELVFDKVLDIFSSSFKKPLFNELLVNKEIYAINSEHTANKSSRDKIFYHATRLLANGDH 180

Query: 181  PFHNFSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALA 240
            PF  FSTG+I TLS ++ L K +L+  + +YFKNN+++ NM +CIKGPQSLN+L KL  +
Sbjct: 181  PFSQFSTGDITTLSDILQLNKVDLRTEVIKYFKNNFYAENMCLCIKGPQSLNTLGKLVFS 240

Query: 241  NFGDIKDKDELTKFHINSIKPQXXXXXXXXXXXXXXCNSFKTNE-NLDLENFKLLDNAWL 299
             F DIK            +                   +F  +   L LE+FK+L   WL
Sbjct: 241  KFNDIK-----------GLPISRPLRTKNQPWLKLKSRNFSNDGFGLGLESFKILSRNWL 289

Query: 300  DKYGDNVCFPTSLSHNTIFLSSSKQPILRLLFPISEKLTRFTKRDIKIYSNIWCHIFGDE 359
             KYG+   F    +HNT+ + S K P LRL+FPI  +LTR TK++I + S  WC +FGDE
Sbjct: 290  QKYGNVGIFTGCDNHNTVLVDSQKLPALRLIFPIHHRLTRLTKKEIDLLSQCWCELFGDE 349

Query: 360  TKGSFCDYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIIDILLQQVVKL 419
            ++GS C ++ KN++ITE  AF S FA+ + +LILEL LTNTG K LQ I+ +   + V +
Sbjct: 350  SEGSLCHFMKKNDYITELTAFMSHFAVNDNALILELYLTNTGWKNLQMIVAVFFNKYVPI 409

Query: 420  LVDNFTENLAYFLAENNIISILRFINSDVEINPMDECSELSGLLQENFKLFNPKYLFYGS 479
            +++  T  LA FL+E N I +L+F+  DV ++ M+ECS LS LL  + +   P ++  G+
Sbjct: 410  VIECGTYELAEFLSELNCIELLKFLYQDVTLSSMEECSNLSSLLLTDIESLGPSFILKGN 469

Query: 480  EFLLLENESLPQKNNMFDG-NSTTFWIGQAIKFQTFLKEFMNWENIKIVGIGDIDEFKNV 538
                  NE   +  +  +   S  +WIG AIKFQ+F+KEF+N+EN+++V +GD+ E   +
Sbjct: 470  PMNDC-NEIDSELGSFAESEESRMWWIGHAIKFQSFIKEFINFENVRLVLMGDLKECPLM 528

Query: 539  LNIVKEMSKKTDLYYEFEYQKLKISK---KSRICPRDYPFTYPIKNEYLPKFGYXXXXXX 595
               +  +    + YYEFEY K +  +   K  +    Y F  P KN +LP  G+      
Sbjct: 529  KTDLTSLKLNIEPYYEFEYHKCRSDQSNFKLTVEEISYSFHIPYKNVFLPSVGFNLSLIK 588

Query: 596  XXXXXXXESSRTVSFYM-PQVSEEEDQNKLVSQNDMHKLWVNPKNSKDQLSESPCIVSFK 654
                     S+T +  +  Q +      KL+ +N  +++WV  ++ +    +S  IV+F+
Sbjct: 589  NALLASSNRSQTAALSLGSQNANPHVLPKLLGKNCFYEMWVKEEDFELTF-KSKSIVTFE 647

Query: 655  LVNNSIQESPESTMHLELMGQLLHTLLINKLYPALNVGYTFEISPSVRGDVSLSFTLSGF 714
            +++  +   P  TM LE++ +LL  +L ++LYP+  +GYT+EI+ S +GDV + FT+SGF
Sbjct: 648  IISTHLNPEPSYTMMLEILCELLGDMLSSQLYPSEKIGYTYEIAASSKGDVRIGFTVSGF 707

Query: 715  SEGIFKIIKECINIFGELTSSDLITKKE-FRRARILVRDKYEDAASDSCVKLASVGLLIL 773
            SEG++KII++ +    ++  S+++  ++ FR++RI VR+KYE+AAS +   L ++GLLI+
Sbjct: 708  SEGVYKIIEKIVGTLVQIVYSEVVIARDLFRKSRIAVRNKYEEAASVNSTTLVNIGLLIV 767

Query: 774  LERKMWTLEERIDALELIDLEMFLEFAQKFFQN-LFLSLYIEGNLEYADLINSYFSDKLV 832
            LE+ MW LE R++ALE  D+E F +F   FF N  +++L+I+G+  Y D IN +    L 
Sbjct: 768  LEKYMWRLESRLEALESTDMESFKQFLSDFFGNSTYMNLFIQGDQTYTDQINIFLDRNLT 827

Query: 833  HHLTKRLDYPKEDTLQSLPSTKLISGTNIYYELEGSVDDPNNSIVYFIQTGDLSNKKILS 892
             HL+K+ D  K   L    ST L  G+N++   +G  DDPNNSIVYFIQTGD ++    +
Sbjct: 828  GHLSKKRDAVK--ILNEPTSTILKPGSNLFITHKGFKDDPNNSIVYFIQTGDRTDNYSYT 885

Query: 893  LTSLTAFIISFSLVPELRNKKQIGYVVFGGLRTLSDTVGLHITIMSDGKPLDIEIEIEKY 952
            LT+ TAF+IS +LVP+LR +KQ+GY+V GGLRTLS TVGLHITI S   P  +E +I +Y
Sbjct: 886  LTAFTAFLISLTLVPDLRGRKQVGYIVLGGLRTLSSTVGLHITITSSSPPHFLEEKIGEY 945

Query: 953  ISYLEFDLLGNLDDETFQNNYLIKYIDLINGIYKKSTEQTSGPINIMNEIIANVHGGDSA 1012
            +SYLE DLL NL  + F+  Y+ +Y+++I     + TE+   P+N+M+ I ANV  G+  
Sbjct: 946  LSYLEKDLLDNLKPQLFREKYVKEYLNVILSGKMEKTERELAPVNLMSRIKANVRSGNLD 1005

Query: 1013 ILNSEXXXXXXXXXXELFGDAQMTEELKYVDIEFLKNLNLIKYLQFFKGSISTNSKRRSK 1072
             +                      +E + +D++ +++L+ + Y+QFFK  IS  S  RSK
Sbjct: 1006 RVGRTMKSHRRIRAQISSKRYNFEDEDEPIDLQLIESLDFVHYMQFFKQKISIYSSLRSK 1065

Query: 1073 LSIHIKSPMEERELFNRKLFLQLQTFLKIKGFPIKSNELQQIVERTNGRPTLLFKELFAC 1132
            +S+ + SPM   E++NRK+FLQL++FLK+KGF I   +LQ+IV +++G+PT+L KELF  
Sbjct: 1066 ISVMVSSPMSRSEIYNRKVFLQLESFLKLKGFKISGEQLQKIVRKSDGKPTVLMKELFRY 1125

Query: 1133 FKARDESWKFISIVLKEILKVISMSIK 1159
            F +R ES K  +++LKEI + +S S+K
Sbjct: 1126 FASRGESLKICTVMLKEITRQLSSSLK 1152

>TDEL0F03400 Chr6 (628126..631638) [3513 bp, 1170 aa] {ON} Anc_3.455
            YPR122W
          Length = 1170

 Score =  920 bits (2379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/1212 (41%), Positives = 738/1212 (60%), Gaps = 61/1212 (5%)

Query: 1    MSWINTKTFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDP 60
            MSW   K  ++ F+ P SYSNR  KLC+LPNGIL LLISD + + +ACS++VA GS++D 
Sbjct: 1    MSWSQVKHINVPFFTPLSYSNRTHKLCQLPNGILLLLISDPTESVSACSLTVAAGSYNDS 60

Query: 61   RDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAI 120
             D+PG+AHLCEHM+LA GSKKYP PG +H+++  NNGS NAFTTGEQTTFYFELP     
Sbjct: 61   DDVPGVAHLCEHMLLAGGSKKYPSPGCYHDMITKNNGSYNAFTTGEQTTFYFELPDFNQA 120

Query: 121  EQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSH 180
             +  F + +DIF+SFF +PLF+  L NKEIYAI++EHD N+SN +KILYHA RLL +KSH
Sbjct: 121  PEAGFEKAIDIFASFFSEPLFDHTLINKEIYAIQNEHDSNVSNVTKILYHATRLLGDKSH 180

Query: 181  PFHNFSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALA 240
            PF  F+TGN+ +L   + LK   L+ +L  +F+ NY    MTIC++GP S+N L KLA++
Sbjct: 181  PFSRFATGNMSSLKNTLRLKGPTLRNLLSNHFRENYAPSRMTICLRGPSSVNGLAKLAIS 240

Query: 241  NFGDIKDKDELTKFHINSIKPQXXXXXXXXXXXXXXCNSFKTNENLDLENFKLLDNAWLD 300
             FG+++      K    ++ P                           + F +L   W  
Sbjct: 241  KFGELRPHKANEKVQA-ALTPN--------------------------DGFNILQTRWGH 273

Query: 301  KYGDNVCFPTSLSHNTIFLSSSKQPILRLLFPISEKLTRFTKRDIKIYSNIWCHIFGDET 360
                N CFP+ L  NTI + S K PI+R LFP+ +K TRFTK+D  I+   W  +FGDE+
Sbjct: 274  TKAANNCFPSCLERNTICVDSGKLPIMRFLFPVWQKFTRFTKKDFLIFERFWFELFGDES 333

Query: 361  KGSFCDYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIIDILLQQVVKLL 420
             GSFC +L +  WIT CYA+ S F+  NT LILEL LTN+G   ++ I   L+  +V   
Sbjct: 334  AGSFCHFLVEKGWITNCYAYISRFSTDNTGLILELSLTNSGWHNIELIAQTLIFYLVPKF 393

Query: 421  VDNFTENLAYFLAENNIISILRFINSDVEINPMDECSELSGLLQENFKLFNPKYLFYGSE 480
                T  LA FL+E   I ++RF+ S+ E +PM ECS L  +LQE+    +   +F GS 
Sbjct: 394  SREHTVQLARFLSEQFSIDLIRFLYSNAENSPMTECSNLCEVLQEDINGLDNSCIFMGSP 453

Query: 481  FLLLENESLPQKNNMFDGN--STTFWIGQAIKFQTFLKEFMNWENIKIVGIGDIDEFKNV 538
             +L E  +      +F  N  S  +WIGQAIKFQ+FLKEFMN  N++++ +G +++    
Sbjct: 454  MVLNEQST----QGLFSENEESQKWWIGQAIKFQSFLKEFMNHSNMRLILLGCLEDCSLS 509

Query: 539  LNIVKEMSKKTDLYYEFEY--QKLKISKKSRICPRDYPFTYPIKNEYLPKFGYXXXXXXX 596
                +     TD +Y+F Y   KL + K       DY F+ P KNE+ P +         
Sbjct: 510  TTATQGKIAGTDPFYDFAYFTCKLSLRKPHANILNDYKFSIPPKNEFKPSWAENFPSLMR 569

Query: 597  XXXXXXESSRTVSFYMPQVSEEEDQN-KLVSQNDMHKLWV---NPKNSKDQLSESPCIVS 652
                    S+  S      S+E  +  +LVSQN+ + +WV    P +S     +S  IVS
Sbjct: 570  KLYYSSTKSQQASLGFAIKSDEGTRTPQLVSQNENYDMWVLSDCPASSH----QSKAIVS 625

Query: 653  FKLVNNSIQESPESTMHLELMGQLLHTLLINKLYPALNVGYTFEISPSVRGDVSLSFTLS 712
            F++    IQ SPE+TM+LE++ Q+++  L + LYP+L +G+TFEI PS RGDV L   +S
Sbjct: 626  FEISCWEIQPSPENTMNLEILAQVINLTLASDLYPSLKLGFTFEIYPSSRGDVRLGLVIS 685

Query: 713  GFSEGIFKIIKECINIFGELTSSDLITKKE-FRRARILVRDKYEDAASDSCVKLASVGLL 771
            G+S+ + K+I+   +I   L S      +E FR+ARI VR  Y+ A  +S + +AS+GLL
Sbjct: 686  GYSKRLGKVIESLSSIIRRLKSEKSFPSRELFRKARISVRSNYDKAEDNSSINVASIGLL 745

Query: 772  ILLERKMWTLEERIDALELIDLEMFLEFAQKFFQ-NLFLSLYIEGNLEYADLINSYFSDK 830
            +++E+ MW+L++RIDA+E IDL+ F  FA  F     FL L+I+G+L +AD IN+     
Sbjct: 746  VVMEKYMWSLQDRIDAIECIDLQTFKAFAASFADYRKFLRLFIQGDLSHADDINACLDRN 805

Query: 831  LVHHL-TKRLDYPKEDTLQSLPSTKLIS-GTNIYYELEGSVDDPNNSIVYFIQTGDLSNK 888
            L +HL   + D+ +E       STKL+   TN Y E  G  DDP NS VY+IQTG   + 
Sbjct: 806  LTNHLHGTQTDFQRE---PEYCSTKLLDPATNFYVEYPGRKDDPTNSTVYYIQTGPRDDC 862

Query: 889  KILSLTSLTAFIISFSLVPELRNKKQIGYVVFGGLRTLSDTVGLHITIMSDGKPLDIEIE 948
               +LT+L+A+++SF+L PELRNK+QIGYVV GGLR L + VGLHI+IMS  +PL +E +
Sbjct: 863  TAYTLTALSAYMMSFTLKPELRNKRQIGYVVMGGLRLLRNAVGLHISIMSTLEPLALEEK 922

Query: 949  IEKYISYLEFDLLGNLDDETFQNNYLIKYIDLINGIYKKSTEQTSGPINIMNEIIANVHG 1008
            I +Y+ YLE ++L  + ++TF+N YL  +++L +        + SGP ++M++I+ANV  
Sbjct: 923  INEYLLYLEREVLTPMTEDTFRNKYLKDFLNLQSKGNLDKLRKDSGPADLMDQIVANVQS 982

Query: 1009 GDSAILNSEXXXXXXXXXXELF-GDAQMTEELKYVDIEFLKNLNLIKYLQFFKGSISTNS 1067
            GDS ILNS           ++  G     +    ++   L+ L +  YL FF+  IS +S
Sbjct: 983  GDSDILNSSFMKKHKRLRNQIADGRYTFADRDSAINTTLLQELTIDHYLCFFRERISIHS 1042

Query: 1068 KRRSKLSIHIKSPMEERELFNRKLFLQLQTFLKIKGFPIKSNELQQIVERTNGRPTLLFK 1127
            K R+KLS+ +KSPM + E+ NR+++ Q+  FLK+ G  I++ +L+++V+R+ G+P LL K
Sbjct: 1043 KTRAKLSVMVKSPMTDEEIVNRQIYSQVDAFLKLHGLTIETAKLRELVQRSKGKPMLLAK 1102

Query: 1128 ELFACFKARDESWKFISIVLKEILKVISMSIKQQCKTRGSETRSSIQHSEFHNDHIITP- 1186
            EL+  F +R E+WK  +++L+E+LK++++++K +      + ++++  SE+ +    TP 
Sbjct: 1103 ELYQSFHSRHETWKLCTVMLRELLKMLTVNLKFR-----HQRQTNMAASEWGS----TPA 1153

Query: 1187 TPLEKVEDINKY 1198
            T L  ++DIN Y
Sbjct: 1154 TGLTLIKDINIY 1165

>ZYRO0C06336g Chr3 (479075..482644) [3570 bp, 1189 aa] {ON} similar to
            uniprot|P40851 Saccharomyces cerevisiae YPR122W AXL1
            Haploid specific endoprotease that performs one of two
            N-terminal cleavages during maturation of a- factor
            mating pheromone required for axial budding pattern of
            haploid cells
          Length = 1189

 Score =  913 bits (2359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/1205 (42%), Positives = 752/1205 (62%), Gaps = 44/1205 (3%)

Query: 7    KTFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDPRDIPGI 66
            K +DI F  P S+  R  KLC+LPNG+L LLISD +  ++ACS+SVA+GSH+DP +IPG+
Sbjct: 7    KYYDIPFLTPFSFEGRTHKLCKLPNGLLTLLISDPTENSSACSLSVASGSHNDPSEIPGL 66

Query: 67   AHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAIEQNTFG 126
            AHLCEHM+LAAGS+KYP PG +HE++  N GSQNAFTTGEQT+FYFELP      Q  F 
Sbjct: 67   AHLCEHMVLAAGSRKYPDPGYYHEMIMKNGGSQNAFTTGEQTSFYFELPNIYHSLQEGFD 126

Query: 127  EILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSHPFHNFS 186
            E LD+F+SFF +PLFN  L NKE YAIESEHD N+S+  KI Y A RLL+N +HPF  FS
Sbjct: 127  EALDVFASFFSEPLFNSTLINKETYAIESEHDVNLSSQGKIFYQATRLLANGNHPFSRFS 186

Query: 187  TGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALANFGDIK 246
            TGNI TL+ + +LK  NLK +L EYFK N+ +  MT+C++GPQS++SL KLAL  F  IK
Sbjct: 187  TGNISTLNSIPHLKNLNLKNLLHEYFKENFCASKMTLCLRGPQSIHSLAKLALTKFSLIK 246

Query: 247  DKDELTKFHINSIKPQXXXXXXXXXXXXXXCNSFKTNENLDLENFKLLDNAWLDKYGDNV 306
            +             PQ               +S +  E ++ +   +  N WL KY   +
Sbjct: 247  NN------------PQRYRPSPPVSPSKSKRSSNEWVE-VNPKEMNISKNTWLPKYRGQL 293

Query: 307  CFPTSLSHNTIFLSSSKQPILRLLFPISEKLTRFTKRDIKIYSNIWCHIFGDETKGSFCD 366
            CF +      IF+ SSK P +R +FP  E+ TRFT +DIKI +++W  +FGDE+ GSF  
Sbjct: 294  CFTSDEQEKFIFIKSSKNPAVRFIFPAMERNTRFTSKDIKILTHLWPELFGDESPGSFSH 353

Query: 367  YLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIIDILLQQVVKLLVDNFTE 426
            +L    W+T  YAF S  AIGN++LILEL LT TG + L +I  +L +Q +  L    T 
Sbjct: 354  WLQSKGWVTYSYAFVSEVAIGNSNLILELDLTRTGFQNLSHIAKVLFEQAIPALSQKNTL 413

Query: 427  NLAYFLAENNIISILRFINSDVEINPMDECSELSGLLQENFKLFNPKYLFYGSEFLLLEN 486
             LA F+++ N I ++RF+  + EI+PM+EC  LS L+Q++ +  +P Y+F GS  ++ E 
Sbjct: 414  ELAQFMSKQNCIDLIRFLYQNAEISPMEECVNLSSLMQDDLEALDPAYIFKGSPMMIDE- 472

Query: 487  ESLPQKNNMFDGN------STTFWIGQAIKFQTFLKEFMNWENIKIVGIGDIDEFKNVLN 540
                Q +N+  GN      S  +WIGQAIKFQ+FLK+FM   N+++V  G+  E +  L 
Sbjct: 473  ----QHHNI--GNYGENKESDRWWIGQAIKFQSFLKQFMVQSNMRVVVSGNSRESQ--LE 524

Query: 541  IVKEMSKKTDLYYEFEYQKLKISKKSRICP--RDYPFTYPIKNEYLPKFG--YXXXXXXX 596
             +     + DL+YEFEY K        I     DY F  P  +  +P     Y       
Sbjct: 525  ELSSQEFQVDLFYEFEYFKRDGIPFKDILEWNNDYNFKIPQLDCPMPDIAKSYSQLKKIL 584

Query: 597  XXXXXXESSRTVSFYMPQVSEEEDQNKLVSQNDMHKLWVNPKNSKDQLSESPCIVSFKLV 656
                    S  +SF +   +  +    LVSQN  H++WV P +    L     IVSF++ 
Sbjct: 585  NDSSQKSQSAPLSFTI-HNNLLKPVPHLVSQNCYHEMWVMPDDEDPSL-HLKSIVSFEIF 642

Query: 657  NNSIQESPESTMHLELMGQLLHTLLINKLYPALNVGYTFEISPSVRGDVSLSFTLSGFSE 716
               ++  P +TM+LE++GQ++  LL  ++YP+L +G+T EI+ S +GD+ L FT+SGFS+
Sbjct: 643  GLDLEACPRNTMNLEILGQIIFILLSPEIYPSLKLGFTCEIT-SNKGDIRLGFTISGFSK 701

Query: 717  GIFKIIKECINIFGELTSS-DLITKKEFRRARILVRDKYEDAASDSCVKLASVGLLILLE 775
             +   +K  I     ++   D ++K+  RRARILVR+KYE+AA+++C  + S+GL I+LE
Sbjct: 702  QLTSFVKSIIETIKRISQDPDFLSKETLRRARILVRNKYENAANENCANIGSIGLYIVLE 761

Query: 776  RKMWTLEERIDALELIDLEMFLEFAQKFF-QNLFLSLYIEGNLEYADLINSYFSDKLVHH 834
            + MWTLE+R++ALE ID++ F +F Q F     +LSL+++G+L  AD +N Y      HH
Sbjct: 762  KYMWTLEDRLEALEDIDMDNFKQFCQSFLGSKKYLSLFVQGDLSCADELNEYLHRSFTHH 821

Query: 835  LTKRLDYPKEDTLQSLPSTKLIS-GTNIYYELEGSVDDPNNSIVYFIQTGDLSNKKILSL 893
            L   + Y  +    ++ +TK++  GTN   +  G  DDPNNSI+YFIQTG  +++ I +L
Sbjct: 822  LGGGI-YETQGKTFTVETTKMLEPGTNACVQHGGQKDDPNNSIIYFIQTGRRNDRMIFTL 880

Query: 894  TSLTAFIISFSLVPELRNKKQIGYVVFGGLRTLSDTVGLHITIMSDGKPLDIEIEIEKYI 953
            T+ T FI+S +L  ELRNK+Q+GY+V GGLR LS++VGLHITIMS G PLD+E +I++Y+
Sbjct: 881  TNFTVFIMSLNLALELRNKRQVGYLVIGGLRLLSNSVGLHITIMSGGSPLDLETKIDEYL 940

Query: 954  SYLEFDLLGNLDDETFQNNYLIKYIDLINGIYKKSTEQTSGPINIMNEIIANVHGGDSAI 1013
             YLE   L  LD++TF   Y+  Y+ L++G  +    ++SGP ++++E++ANV  GDS I
Sbjct: 941  WYLE-SQLQKLDEQTFHQEYVRCYLQLLDGGCRGDANESSGPADLLSELVANVQIGDSEI 999

Query: 1014 LNSEXXXXXXXXXXELFGDA-QMTEELKYVDIEFLKNLNLIKYLQFFKGSISTNSKRRSK 1072
            L+S+          ++  +      E + +D + +  ++L +YL FFK  IS +SK RSK
Sbjct: 1000 LSSQTMKRHKKLQTQIIQEQYDFVTESEALDDDLISQMSLEQYLSFFKHYISIHSKLRSK 1059

Query: 1073 LSIHIKSPMEERELFNRKLFLQLQTFLKIKGFPIKSNELQQIVERTNGRPTLLFKELFAC 1132
            +SI I S + E+++ N+K+FLQL+TFLKIKGF I ++EL+ IVER+NG+P +L  EL++C
Sbjct: 1060 ISIMISSSIAEKDIINKKIFLQLETFLKIKGFAIPADELKDIVERSNGKPKILAMELYSC 1119

Query: 1133 FKARDESWKFISIVLKEILKVISMSIKQQCKTRGSETRSSIQHSEFHNDHIITPT-PLEK 1191
            F+ R+++ +  S++L E+ K+++ S++ +      +  S     E+  D  + P   L+ 
Sbjct: 1120 FRTRNDALRLCSVILAELFKMLAKSLRHRYGNLAHDDTSKRDLQEWSTD--VKPALDLKV 1177

Query: 1192 VEDIN 1196
            +EDIN
Sbjct: 1178 IEDIN 1182

>TPHA0D04060 Chr4 (867294..870899) [3606 bp, 1201 aa] {ON} Anc_3.455
            YPR122W
          Length = 1201

 Score =  890 bits (2300), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 529/1220 (43%), Positives = 746/1220 (61%), Gaps = 42/1220 (3%)

Query: 1    MSWINTKTFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDP 60
            MSW   K +DI  Y+P+S    + KLCRLPNGIL ++ISD S    +CS+SVATGSH+DP
Sbjct: 1    MSWTQVKNYDIPIYIPASSRGMDYKLCRLPNGILTMVISDPSREMASCSLSVATGSHNDP 60

Query: 61   RDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAI 120
              IPG+AHLCEHMIL+AGSKKYP P  +H++++ +NGS NA+TTGEQTTFYFE+P     
Sbjct: 61   SVIPGLAHLCEHMILSAGSKKYPDPNSYHKLISESNGSHNAYTTGEQTTFYFEIPCLFTS 120

Query: 121  EQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSH 180
             ++ F  +LDIFSS FK PLF E   NKEIYAIESEHDGN  N +KILYHA RLL+N  H
Sbjct: 121  SESNFERLLDIFSSSFKDPLFKETSVNKEIYAIESEHDGNTCNLTKILYHATRLLANSKH 180

Query: 181  PFHNFSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALA 240
            PF  FSTGNI TL K   L K   K++L  YFK NY + NMT+CIKGPQS+N LTK AL 
Sbjct: 181  PFSRFSTGNITTLGKGAKLLKTTSKKLLESYFKTNYNASNMTLCIKGPQSVNVLTKYALT 240

Query: 241  NFGDIKDKDELTKFHINSIK-PQXXXXXXXXXXXXXXCNSFKTN-ENLDLENFKLLDNAW 298
             F  I D        I S+K P                   K N E+  LE+F +L NA+
Sbjct: 241  YFNGIDDSIRNDNTFIKSLKSPVYMHQRFSFSSLSQESAMSKGNEEDCRLEDFHILSNAY 300

Query: 299  LDKYGDNVCFPTSLSHNTIFLSSSKQPILRLLFPISEKLTRFTKRDIKIYSNIWCHIFGD 358
              KY D  CF  + +HN IF+ S+KQPILRLLFPI      F K D+  +  +WC +FGD
Sbjct: 301  NPKYKDIKCFKRNPNHNAIFIKSTKQPILRLLFPIDMDDDYFNKDDLLRFIMVWCELFGD 360

Query: 359  ETKGSFCDYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIIDILLQQVVK 418
            E   S C +L K+N IT+C+AF S FA+ +  L++EL LT TGVK  + II+ +    ++
Sbjct: 361  ENDNSLCYFLKKDNLITDCFAFHSNFALNSVGLVVELSLTGTGVKNQELIINSICNSAIE 420

Query: 419  LLVDNFTENLAYFLAENNIISILRFINSDVEINPMDECSELSGLLQENFKLFNPKYLFYG 478
             L +     LA FL+E N I I+RFIN   E   MDE SE+S  LQEN  L  P +L   
Sbjct: 421  KLSEANDTELARFLSECNTIDIIRFINKGKEDTSMDEISEISSRLQENLALNRPSFLL-- 478

Query: 479  SEFLLLENESLPQKNNMFDGN--STTFWIGQAIKFQTFLKEFMNWENIKIVGIGDID--E 534
             EF  + + S    +N F+ N  S  +W+ +A  FQ FLK ++N +N++I+ +GDI+  +
Sbjct: 479  KEFPFINDYSETGISN-FEENEWSKNWWLSKAYNFQQFLKRYVNRKNLRILFLGDIETPK 537

Query: 535  FKNVLNIVKEMSKKTDLYYEFEYQKLKIS-KKSRICPRDYPFT---YPIKNEYLPKFGYX 590
            F  +   +K  S  TD +Y+FEY   K   K +++   D  F     P +N ++P+ G  
Sbjct: 538  FTTLTEDLKVYS--TDPFYDFEYITFKYKFKANQLRQEDDIFRNIGIPKRNTFMPEIGKS 595

Query: 591  XXXXXXXXXXXXESSRTVSFYMPQVSEEEDQNKLVSQNDMHKLWVNPKNSKDQLSES-PC 649
                        + + ++ + +   +  E +  LV +N   + WV   NS  Q S +   
Sbjct: 596  LAILSANLEAILKRNESIGYPIIYNNSIESKPGLVLKNSNQETWV--LNSPLQHSSTESS 653

Query: 650  IVSFKLVNNSIQESPESTMHLELMGQLLHTLLINKLYPALNVGYTFEISPSVRGDVSLSF 709
            I SF++ N SI+ SP STMHLE++GQLL  L+  +LYPAL +GYT+EI  SV GDV L  
Sbjct: 654  IFSFEITNWSIKPSPASTMHLEVLGQLLGILMTRELYPALRLGYTYEIGASVNGDVKLMI 713

Query: 710  TLSGFSEGIFKIIKECINIFGELT-SSDLITKKEFRRARILVRDKYEDAASDSCVKLASV 768
            T+SGF  GI  +++  I I   ++  +  +T     RAR++ R KYEDAAS + VKLASV
Sbjct: 714  TISGFQSGIMSLLQNIIKICNSISIKNPTVTHSALHRARVMTRRKYEDAASGNSVKLASV 773

Query: 769  GLLILLERKMWTLEERIDALELIDLEMFLEFAQKFFQNL-FLSLYIEGNLEYADLINSYF 827
            GLLI+LE+ MWTLE+R DALE  D+  F  F  +FF++  ++  +I G  E A  ++   
Sbjct: 774  GLLIMLEKHMWTLEDRFDALEESDINSFYNFCSQFFKSAKYIKSFISGTNELAMKLSHLI 833

Query: 828  SDKLVHHLTKRLDYPKEDTLQSLPSTKLISGTNIYYELEGSVDDPNNSIVYFIQTGDLSN 887
             D  +   T  L+Y +++ +  L +  L  G N+Y++  G   D NN I YFIQTG+ +N
Sbjct: 834  YDHWILSDTISLNYFEKNNI--LSTCFLKPGENVYFQHPGDEGDINNCINYFIQTGERNN 891

Query: 888  KKILSLTSLTAFIISFSLVPELRNKKQIGYVVFGGLRTLSDTVGLHITIMSDGKPLDIEI 947
            + I +LTSLT +I+  +LV ELRN+KQ+GYVVFGG+R+L++T+GLHITIMS   P D+E 
Sbjct: 892  EYIATLTSLTDYIMQSNLVSELRNRKQVGYVVFGGMRSLTNTIGLHITIMSLADPEDLER 951

Query: 948  EIEKYISYLEFDLLGNLDDETFQNNYLIKYIDLINGIYKKSTEQTSGP------INIMNE 1001
             I++Y+  LE D +G+L++ TF+  +L+ +I+ +        + T+ P      +N++++
Sbjct: 952  SIDEYMWRLENDTIGSLNESTFKLTFLLPFINTMQ-------KDTNNPFNNVTNVNLVDD 1004

Query: 1002 IIANVHGGDSAILNSEXXXXXXXXXXELFGDAQMTEELKY---VDIEFLKNLNLIKYLQF 1058
            ++ANV  GDS    ++           +F + ++   LKY   +D+  +K L L +YL+F
Sbjct: 1005 VVANVQAGDSVNFETQQMKLHNNLKKRIFNN-RIQLNLKYNEAIDLNIIKKLTLKEYLEF 1063

Query: 1059 FKGSISTNSKRRSKLSIHIKSPMEERELFNRKLFLQLQTFLKIKGFPIKSNELQQIVERT 1118
            F+ +IS NSK RSK+SIHI S M + E+ NRKLFLQL TFLK+KG  IK +EL++IVE +
Sbjct: 1064 FRATISINSKNRSKISIHIISLMAKEEIANRKLFLQLVTFLKVKGLTIKRDELKEIVEIS 1123

Query: 1119 NGRPTLLFKELFACFKARDESWKFISIVLKEILKVISMSIKQQCKTRGSETRSSIQHSEF 1178
             G+P+ L KE+   FK +DE+ K   I++KEI+K+ISM++     +    T+S+ + + +
Sbjct: 1124 EGKPSKLLKEIVKYFKKKDEAKKLYFIIIKEIIKIISMTV---INSSSITTKSTSKKNNW 1180

Query: 1179 HNDHIITPTPLEKVEDINKY 1198
              + I +  PL  V DI  Y
Sbjct: 1181 QTEPIKSALPLVLVNDIKAY 1200

>Ecym_4404 Chr4 complement(840532..844122) [3591 bp, 1196 aa] {ON}
            similar to Ashbya gossypii AGR251C
          Length = 1196

 Score =  876 bits (2263), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/1204 (40%), Positives = 728/1204 (60%), Gaps = 33/1204 (2%)

Query: 9    FDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDPRDIPGIAH 68
            FD+  Y P S S R+ ++ +L N +LALLISD S T  +C+ISVATGSH+DP ++PG+AH
Sbjct: 10   FDVTLYTPISSSKRSHRIIQLSNNLLALLISDPSETIASCAISVATGSHNDPPELPGLAH 69

Query: 69   LCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAIEQNTFGEI 128
             CEHM+L++GSKKYP+P  FHE L  NNGS+NA TTGEQT+FYFE+P +T+ E + F ++
Sbjct: 70   FCEHMVLSSGSKKYPEPNFFHESLTRNNGSKNAHTTGEQTSFYFEVPHTTSAELHVFEQL 129

Query: 129  LDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSHPFHNFSTG 188
            +DI ++ FK+P+F+++L NKEIYAI SEH GN S  SK+LYHA RLL+N++HPF +FSTG
Sbjct: 130  IDILAASFKEPVFHDILVNKEIYAIHSEHMGNKSTLSKMLYHATRLLANENHPFSHFSTG 189

Query: 189  NIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALANFGDIKDK 248
            N+ TL+ +  + K NLK  L +YFK ++ +  M +CI+G QSLN L+KLA   FGDI   
Sbjct: 190  NVFTLTNMPRVNKLNLKTELIKYFKEHFRAEKMVVCIRGSQSLNQLSKLAQLKFGDIPGS 249

Query: 249  DELTKFHINSIKPQXXXXXXXXXXXXXXCNSFKTNENL-DLENFKLLDNAWLDKYGDNVC 307
                    + +K                 +S  T+  L  L+  ++L + WL +Y     
Sbjct: 250  AAAGSPTSSPLK------LKSWRSSNSITSSVDTSSTLASLDESRILKDTWLPRYSKEPV 303

Query: 308  FPTSLSHNTIFLSSSKQPILRLLFPISEKLTRFTKRDIKIYSNIWCHIFGDETKGSFCDY 367
            F     +N++ + S K P++R +FP++   TRFT ++I  Y+  WC I GDE  GSFC +
Sbjct: 304  FTPRPKYNSMMIQSKKPPVIRFIFPVNYLSTRFTDKEIATYTKAWCDIIGDEGYGSFCHF 363

Query: 368  LNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIIDILLQQVVKLLVDNFTEN 427
            L +NN+I++  AF S+FA+ +  LIL+L LTN G   +  I+ +  +  V  ++D     
Sbjct: 364  LRQNNYISDLLAFSSSFAVNDDGLILQLHLTNYGWANVSIIVPLFWKYTVNTILDTSLSK 423

Query: 428  LAYFLAENNIISILRFINSDVEINPMDECSELSGLLQENFKLFNPKYLFYGSEFLLLENE 487
            +  +L+E N I +L+F+  DVE +PM+ C+EL   L ++  +  P ++   S  +   N+
Sbjct: 424  IGQYLSELNSIDLLKFLYQDVERSPMERCAELCDQLMQDLSVVPPPFILKTSGLMFDCND 483

Query: 488  SLPQKNNMF--DGNSTTFWIGQAIKFQTFLKEFMNWENIKIVGIGDIDEFKNVLNIVKEM 545
               QK   +    NST +W GQAIKFQTF+KEF   EN+K++ +G + +     N    M
Sbjct: 484  PRIQKIGSYSESQNSTDWWRGQAIKFQTFVKEFTTIENVKMIMLGPLSKCPFYSN---SM 540

Query: 546  SKKTDLYYEFEYQKLKIS-KKSRICPRDYPFTYPIKNEYLPKFGYXXXXXXXXXXXXXES 604
                D +YE++Y K  I   +      +Y F  P  N++L   G+               
Sbjct: 541  QLTADTHYEYDYLKAYIEITELEAIDNEYEFHIPSPNQFLVPVGHKLSYIKKALLAASAQ 600

Query: 605  SRTVS-FYMPQVSEEEDQNKLVSQNDMHKLWVNPKNSKDQLS-ESPCIVSFKLVNNSIQE 662
            S   S F + Q    +    L  +N  ++LW   K     LS +S  IVS ++++ +++ 
Sbjct: 601  SENSSLFIVTQSDLLQTTPSLAGKNAFYELWT--KEEDINLSFKSKSIVSLEVISTTLKP 658

Query: 663  SPESTMHLELMGQLLHTLLINKLYPALNVGYTFEISPSVRGDVSLSFTLSGFSEGIFKII 722
            +PE TM LE++GQLL +++   LYPA   GYT+E+S S +GDV L  TLSGF+EGI  I+
Sbjct: 659  APEYTMQLEILGQLLFSIISPVLYPAERAGYTYELSLSSKGDVRLGITLSGFTEGIMGIL 718

Query: 723  KECINIFGELTSSDL-ITKKEFRRARILVRDKYEDAASDSCVKLASVGLLILLERKMWTL 781
               ++   EL    + I+K  FRRAR++VR KYE+AAS++C  LAS+GLLI+LE  MWTL
Sbjct: 719  NIILDSLLELGEDSVEISKGMFRRARVMVRTKYEEAASENCATLASLGLLIVLEGCMWTL 778

Query: 782  EERIDALELIDLEMFLEFAQKFFQNL-FLSLYIEG-NLEYADLINSYFSDKLVHHLTKRL 839
            E+R++ALE ID+E F++F + F     +L+L ++G +L  AD +N     KL HH++  L
Sbjct: 779  EDRLNALEDIDMESFVQFMKLFINGRNYLNLLVQGSDLSLADKVNDCVDAKLTHHMSS-L 837

Query: 840  DYPKEDTLQSLPSTKLIS-GTNIYYELEGSVDDPNNSIVYFIQTGDLSNKKILSLTSLTA 898
            +  K   ++  P+T  I  G+N+  +  GS DDPNNSIVYFIQTG   N    +LT  T 
Sbjct: 838  ETGKNILVE--PTTHFIPRGSNLCVKKSGSHDDPNNSIVYFIQTGTRDNNYAYTLTVFTE 895

Query: 899  FIISFSLVPELRNKKQIGYVVFGGLRTLSDTVGLHITIMSDGKPLDIEIEIEKYISYLEF 958
            F++S +LVP+LR KKQIGYVV GGLR LSDTVGLHIT MS   P  +E +I++Y+SYLE 
Sbjct: 896  FLMSMTLVPDLRGKKQIGYVVLGGLRVLSDTVGLHITTMSSNPPEYLEKKIDEYLSYLES 955

Query: 959  DLLGNLDDETFQNNYLIKYIDLINGIYKKSTEQTSGPINIMNEIIANVHGGD---SAILN 1015
             +L  L++E F+ NYL K++ L+        E+TSGP N+M++I ANV  G    S  + 
Sbjct: 956  MVLMKLNNEQFKMNYLNKFLRLVESNSLSKIEKTSGPANLMSQIEANVRSGSQNGSMAMK 1015

Query: 1016 SEXXXXXXXXXXELFGDAQMTEELKYVDIEFLKNLNLIKYLQFFKGSISTNSKRRSKLSI 1075
            S             +      EE + ++ + ++NL L +Y+ FF   IS  SK R+K+S+
Sbjct: 1016 SHKRIRNQIS----YRRYNFEEEDEPINAKTIRNLTLREYMAFFHEKISVYSKSRAKMSV 1071

Query: 1076 HIKSPMEERELFNRKLFLQLQTFLKIKGFPIKSNELQQIVERTNGRPTLLFKELFACFKA 1135
             + SPM + E+ ++ +FLQ+++FLK+KGF I S +L+ I+ ++ G+PT+L K LF+ F+ 
Sbjct: 1072 MVTSPMSKDEVQSKMMFLQIESFLKMKGFNIPSEDLKSIIVKSGGKPTVLLKHLFSYFRV 1131

Query: 1136 RDESWKFISIVLKEILKVIS-MSIKQQCKTRGSETRSSIQHSEFHNDHIITPTPLEKVED 1194
            R ES K ++ ++KEI+K  S        KT  + T +S    +  +  +    PL +V D
Sbjct: 1132 RGESIKLLTAIVKEIVKQASNKPPGSAAKTSATPTGTS-GTLQAMSQTVAPAVPLIEVTD 1190

Query: 1195 INKY 1198
            +N Y
Sbjct: 1191 VNSY 1194

>KNAG0A07740 Chr1 complement(1226949..1230542) [3594 bp, 1197 aa] {ON}
            Anc_3.455 YPR122W
          Length = 1197

 Score =  845 bits (2184), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/1201 (40%), Positives = 712/1201 (59%), Gaps = 70/1201 (5%)

Query: 1    MSWINTKTFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDP 60
            M+W   + +DI F +P ++S+R  KLC+LPNG+LALLISD     + CS++VATGSH+DP
Sbjct: 1    MTWAAVQNYDIQFRIPLAFSHRTHKLCKLPNGVLALLISDPEDNASVCSVTVATGSHNDP 60

Query: 61   RDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAI 120
            + +PG+AHLCEHM+ AAGSKKYP    +H+ L+   G+ NA+TTGEQTTF+  +P     
Sbjct: 61   KGVPGLAHLCEHMLFAAGSKKYPDVDKYHQTLSKTGGTHNAYTTGEQTTFHISVPNMNRE 120

Query: 121  EQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSH 180
             +  F  ILD+FSSF K+PLFN    NKEIYAI+SEHD N+S+ SKILY A RL++N +H
Sbjct: 121  GELEFDCILDMFSSFLKEPLFNSTAMNKEIYAIQSEHDSNVSSLSKILYQAIRLMANGNH 180

Query: 181  PFHNFSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALA 240
            PF  FSTGNIHTL  +  +   NL+ +L  YF+ N+  RN+T+CIKG QS+N LTKLAL 
Sbjct: 181  PFSQFSTGNIHTLKNMPLVTGMNLRTLLVNYFETNFQPRNITVCIKGSQSVNILTKLALT 240

Query: 241  NFGDIKDKDELTKFHINSIKPQXXXXXXXXXXXXXXCNSFKTNENL--DLENFKLLDNAW 298
            NFG I+          N I+                 +S ++N      +E+F++L+ AW
Sbjct: 241  NFGYIQSSRAAKG---NVIRRSISKR-----------DSIRSNGKKLKKIESFRILEKAW 286

Query: 299  LDKYGDNVCFPTSLSHNTIFLSSSKQPILRLLFPISEKLTRFTKRDIKIYSNIWCHIFGD 358
              KY D  CF     +N + + S+KQ  +R LFP++E    FT +++KI+S IW  +FGD
Sbjct: 287  KAKYKDIKCFDDR--NNFMIIKSNKQSTMRFLFPVNESGANFTPKELKIFSGIWRELFGD 344

Query: 359  ETKGSFCDYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIIDILLQQVVK 418
            E+KGS   Y  + +WITE   + S F  G   LIL+  LT +G + L+ II  + +  ++
Sbjct: 345  ESKGSLHSYFIEKSWITETTTYISDFTYGVYGLILQFSLTASGWENLREIISKVFKGTLE 404

Query: 419  LLVDNFTENLAYFLAENNIISILRFINSDVEINPMDECSELSGLLQENFKLFNPKYLFYG 478
            L+      +L+  L E+  I  + ++  + E+   D CSEL+ LLQ + +    +YLF  
Sbjct: 405  LVRWENLNSLSRILFEHTTIEYINYLYQEQEVLSSDFCSELTELLQHSLRTPELEYLFK- 463

Query: 479  SEFLLLENESLPQKNNMFDGN---STTFWIGQAIKFQTFLKEFMNWENIKIVGIGDIDEF 535
                  E+ +L + NN    N    T +W  QA+KFQ F+ EFM   N+K+  +G   E 
Sbjct: 464  ------ESPNLIELNNDHSENLMTVTPWWFDQAMKFQNFINEFMKVTNVKLFLLGS--EL 515

Query: 536  KNVLNIVKEMSKK-----TDLYYEFEYQKLKISKKSRI---CP--RDYPFTYPIKNEYLP 585
            K+  N   E+  +     TD YY F+Y K  ++ K  I   C    DY    P KN ++P
Sbjct: 516  KH--NAFFELGSQNKDWSTDAYYGFDYIKSHLNFKQIIDEPCTTVNDYSLALPSKNLFIP 573

Query: 586  KFGYXXXXXXXXXXXXXESSRTVSFYMPQVSEEEDQN---KLVSQNDMHKLWVNPKNSKD 642
            +F                 SR  +   PQV      N   +LV+++  +++W+ P + + 
Sbjct: 574  QFFQNLANLQQIFMEYSLRSR-FAVLQPQVPTSMLPNQKPRLVNRSSHYEMWILPIDKEP 632

Query: 643  QLSESP------CIVSFKLVNNSIQESPESTMHLELMGQLLHTLLINKLYPALNVGYTFE 696
            +   SP        V+F + + ++  S  +TMHLE++G++L+ LL + LYP+L + Y +E
Sbjct: 633  ESVASPDRIPKQSTVTFSIESLTMTPSSMNTMHLEILGEVLNFLLTSDLYPSLQLSYAYE 692

Query: 697  ISPSVRGDVSLSFTLSGFSEGIFKI---IKECINIFGELTSSDLITKKEFRRARILVRDK 753
            I+ S++GDV L  T+ GFS+G+ KI   I   + + G+  +++++T    R+ARI VR K
Sbjct: 693  IATSLKGDVQLCCTICGFSDGVVKITDYILSTLRLIGDPATANIVTNSLLRKARIQVRSK 752

Query: 754  YEDAASDSCVKLASVGLLILLERKMWTLEERIDALELIDLEMFLEFAQKFFQNL---FLS 810
            YE A+S+ CVKLAS+GLLI+LER MWTLE+R++ALE  D+  F +F  +F  N    +L+
Sbjct: 753  YEAASSEICVKLASMGLLIVLERGMWTLEDRLEALEDSDMSSFQQFCHEFVMNDSGNYLN 812

Query: 811  LYIEGNLEYADLINSYFSDKLVHHL-TKRLDYPKEDTLQSLPSTKLISGTNIYYELEGSV 869
            L+++G++ YAD +N     KL HHL + R   P  D  +S  +T L  G N Y E  G  
Sbjct: 813  LFVQGDMRYADEVNCLIHSKLTHHLNSSRCSTPTTDYRRS--TTVLKPGVNYYVEYPGQG 870

Query: 870  DDPNNSIVYFIQTGDLSNKKILSLTSLTAFIISFSLVPELRNKKQIGYVVFGGLRTLSDT 929
            DDPNNSIV+F+Q G  +++   +L   TA+++  +LVP+LR KKQIGYVV GGLR ++DT
Sbjct: 871  DDPNNSIVHFVQVGLRNDRAAFTLAHFTAYLMHLTLVPDLRYKKQIGYVVLGGLRIMTDT 930

Query: 930  VGLHITIMSDGKPLDIEIEIEKYISYLEFDLLGNLDDETFQNNYLIKYIDLINGIYKKST 989
            VGLHIT+MS G+ LD+E +I++Y+ YLE  +L  L +  F+  YL  YI LI        
Sbjct: 931  VGLHITVMSAGQCLDLEDKIDEYMMYLEDTVLNALTESQFEEIYLKPYIRLIGEHTVGEM 990

Query: 990  EQTSGPINIMNEIIANVHGGDSAILNSEXXXXXXXXXXELFGDAQMTEE--LKYVDI--- 1044
            + + GP N+++EI  NV  G S++L             +L+   Q  E   L+  DI   
Sbjct: 991  DTSGGPTNLLSEIYPNVQNGHSSVLEG----IDMKRHKQLWNLIQAKEYDFLQGNDILDR 1046

Query: 1045 EFLKNLNLIKYLQFFKGSISTNSKRRSKLSIHIKSPMEERELFNRKLFLQLQTFLKIKGF 1104
              ++ L L +Y+ FFK  +S  S  RSK+SI I SPM+  E+ NR++FLQ++TFLK+KGF
Sbjct: 1047 TVVQGLTLHRYMTFFKEKLSARSTTRSKISIMIDSPMKREEIMNRQMFLQMETFLKMKGF 1106

Query: 1105 PIKSNELQQIVERTNGRPTLLFKELFACFKARDESWKFISIVLKEILKVISMSIKQQCKT 1164
             IK  EL+ IV ++ G PT L + L A FK R E+WK   ++ KE+ K++++ +++    
Sbjct: 1107 AIKDTELRDIVNKSQGSPTQLLRHLLAHFKTRGENWKLCRVIAKEVGKLLALGVRRSLTL 1166

Query: 1165 R 1165
            R
Sbjct: 1167 R 1167

>AGR251C Chr7 complement(1213371..1216952) [3582 bp, 1193 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YPR122W
            (AXL1)
          Length = 1193

 Score =  845 bits (2182), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/1216 (40%), Positives = 743/1216 (61%), Gaps = 54/1216 (4%)

Query: 4    INTK--TFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDPR 61
            +NTK   FD+  Y P S SNR+ ++ RL N +L  LISD S T  +C++S+ATGSH+DP 
Sbjct: 3    LNTKPAVFDVKLYTPISSSNRSHRIIRLNNNLLTFLISDPSETVASCAVSIATGSHNDPV 62

Query: 62   DIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAIE 121
            +IPG+AH CEHM+L++GSK++P+P  FHE L+ NNGSQNA T+GEQT+FYFELP+S + +
Sbjct: 63   EIPGLAHFCEHMVLSSGSKRHPEPNAFHETLSKNNGSQNAHTSGEQTSFYFELPSSQSSD 122

Query: 122  QNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSHP 181
               F +++ I +   K+P+F++VL NKEIYAI SEH GN S+ +K++YHA RLL++  HP
Sbjct: 123  SLVFDQVVGILADALKEPIFHDVLINKEIYAINSEHVGNKSSLTKMMYHAVRLLASPEHP 182

Query: 182  FHNFSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALAN 241
            FH F TGNI TL+ +  L K +LK  L +YF+ ++F+ NM +C++GPQSLN L+K+A A 
Sbjct: 183  FHQFGTGNIFTLTNMPKLHKLSLKNELVKYFREHFFAENMVLCLRGPQSLNQLSKIAQAR 242

Query: 242  FGDIKDKDELTKFHINSIKPQXXXXXXXXXXXXXXCNSFKTNENLD---LENFKLLDNAW 298
            F DI               P                +SF  N NL    LE+F++L +AW
Sbjct: 243  FSDI---------------PSIPTLQVPRLLRWRSSSSFDKNRNLSVRPLESFQILKDAW 287

Query: 299  LDKYGDNVCFPTSLSHNTIFLSSSKQPILRLLFPISEKLTRFTKRDIKIYSNIWCHIFGD 358
              +Y     F  +  HN+I + SSK P++R +FPI+   TRFT R++  Y+ IWC + GD
Sbjct: 288  SARYAKKPVFDKTPMHNSIMVQSSKSPVIRFVFPINYFSTRFTDRELATYTQIWCELLGD 347

Query: 359  ETKGSFCDYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIIDILLQQVVK 418
            E +GS C YL  +++ITE  A+ S FA+ +T LIL+L LTN G   +Q II I+ + ++ 
Sbjct: 348  ECEGSLCHYLRSHSYITELIAYSSNFAVNDTGLILQLHLTNHGWLNVQKIIPIVWKYLIP 407

Query: 419  LLVDNFTENLAYFLAENNIISILRFINSDVEINPMDECSELSGLLQENFKLFNPKYLFYG 478
             ++D    +LA +++E N + +L+F+  ++E +PMD C++L   L ++    +  +L   
Sbjct: 408  AILDAPLSSLAQYISELNSLDLLKFLYQELERSPMDRCADLCESLLQDLSAIDLSFLL-K 466

Query: 479  SEFLLLENESLPQKN-NMFDGNSTT--FWIGQAIKFQTFLKEFMNWENIKIVGIGDIDEF 535
            S     E  +L   N   +  N T+  +W G+A+KFQ F+ EFM+ + ++I+ +G++ + 
Sbjct: 467  STLTYFECNNLSVANLGTYRENQTSKDWWRGEAVKFQAFVNEFMSQDTVRIILLGNLSKC 526

Query: 536  KNVLNIVKEMSKKTDLYYEFEYQKLKISKKSRICPR-DYPFTYPIKNEYLPKFGYXXX-X 593
                N  K     TD Y+E+EY K+ I  +   C    Y FT P  N ++   G+     
Sbjct: 527  YFNCNPDK---ITTDTYFEYEYVKIFIDLEVLGCDDIHYRFTIPGPNPFMVPVGHKLSFI 583

Query: 594  XXXXXXXXXESSRTVSFYMPQVSEEEDQNKLVSQNDMHKLWVNPKNSKDQLSESPCIVSF 653
                     +S  +    + Q        +L  +N  ++LW+  ++  D    S  I S 
Sbjct: 584  KHALLASSVQSENSALSVVAQSDLVRASPRLAGKNSYYELWLKEEDV-DLSFRSKSIFSM 642

Query: 654  KLVNNSIQESPESTMHLELMGQLLHTLLINKLYPALNVGYTFEISPSVRGDVSLSFTLSG 713
            +L++ S++ +PE TMHLE++GQLL+++L   LYPA   GYT+E+S S +GDV L  T+SG
Sbjct: 643  ELISTSLEPAPEYTMHLEILGQLLYSILGPILYPAERAGYTYELSLSSKGDVRLGLTISG 702

Query: 714  FSEGIFKIIKECINIFGELTSSDL--ITKKEFRRARILVRDKYEDAASDSCVKLASVGLL 771
            F++GI  ++K  ++    L S DL  I K  FR+ARILVR KY++A+S+SCV LAS+GLL
Sbjct: 703  FTDGILNLLKIIVDAIVNL-SQDLNSIPKDIFRKARILVRTKYKEASSESCVTLASLGLL 761

Query: 772  ILLERKMWTLEERIDALELIDLEMFLEFAQKFFQ-NLFLSLYIEG-NLEYADLINSYFSD 829
            ILLE  MW LE+R++ALE I +E F  F +KF   + +L++ I+G ++  AD IN Y S+
Sbjct: 762  ILLENCMWPLEDRLEALEDIYVESFRIFLEKFINGDNYLNILIQGSDMTIADNINEYLSE 821

Query: 830  KLVHHLTKRLDYPKEDTLQSL--PSTKLI-SGTNIYYELEGSVDDPNNSIVYFIQTGDLS 886
            +L HH+++      +D +  L  P+T +I  G+N++++  G  DDPNNSIVYFIQTG+  
Sbjct: 822  RLTHHISR-----ADDNVCRLSEPATYVIPEGSNLFFKRVGFHDDPNNSIVYFIQTGERD 876

Query: 887  NKKILSLTSLTAFIISFSLVPELRNKKQIGYVVFGGLRTLSDTVGLHITIMSDGKPLDIE 946
            N  I +LT LT FI+S +LVP+LR KKQIGY+V GGLR LSDTVGLHIT M+   P  +E
Sbjct: 877  NNYIYTLTVLTEFIMSQTLVPDLRQKKQIGYIVLGGLRVLSDTVGLHITTMAGSPPEFLE 936

Query: 947  IEIEKYISYLEFDLLGNLDDETFQNNYLIKYIDLINGIYKKSTEQTSGPINIMNEIIANV 1006
             +I +Y++YLE  +L  L    F+++Y+ + + L+        E+TSGP N+M++I ANV
Sbjct: 937  EKINEYLAYLEDMVLAKLTAPQFKHDYVDELLSLLTSNSLGKLEKTSGPANLMSQIEANV 996

Query: 1007 HGGD---SAILNSEXXXXXXXXXXELFGDAQMTEELKYVDIEFLKNLNLIKYLQFFKGSI 1063
            H G    S  + S               D    E+ + VD   L+NL L +Y++FF+  I
Sbjct: 997  HSGQRNTSLAMKSHKRLRTQISYRRYNFD----EDDEPVDARTLQNLKLSEYMRFFRQRI 1052

Query: 1064 STNSKRRSKLSIHIKSPMEERELFNRKLFLQLQTFLKIKGFPIKSNELQQIVERTNGRPT 1123
            S  S +R+KLSI + S M + E+  + L+LQ+++FLK+KGF I S +L  IV+++ G+PT
Sbjct: 1053 SIYSGKRAKLSIMVYSAMSKEEVQGKMLYLQIESFLKMKGFNIPSKDLNAIVQKSKGKPT 1112

Query: 1124 LLFKELFACFKARDESWKFISIVLKEILK-VISMSIKQQCKTRGSETRSSIQHSEFHNDH 1182
             L K L + F+++ ES K +S VL+E++K + S +      +  S T  S+Q     + H
Sbjct: 1113 ALLKGLLSYFRSQGESLKLLSTVLREVVKQLFSKATPDSSSSTPSGTHGSLQA---MSQH 1169

Query: 1183 IITPTPLEKVEDINKY 1198
            +     LE+V ++N Y
Sbjct: 1170 VTPAITLEQVPEVNSY 1185

>Kwal_55.20464 s55 complement(414783..418352) [3570 bp, 1189 aa] {ON}
            YPR122W (AXL1) - putative homolog of human
            insulin-degrading endoprotease [contig 148] FULL
          Length = 1189

 Score =  825 bits (2130), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/1220 (39%), Positives = 711/1220 (58%), Gaps = 61/1220 (5%)

Query: 1    MSWINTKTFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDP 60
            MS+ +TK FD+ FY P S S+R  KLC+L NG+L  LISD S T  +CS+SVATGSH+DP
Sbjct: 1    MSFESTKNFDLVFYTPISGSSRGSKLCQLSNGMLVFLISDPSDTVGSCSVSVATGSHNDP 60

Query: 61   RDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAI 120
             +  G+AHLCEH IL+ GSKKYP    +HEVLA N GS NA+TTGE TTFYFELP  +  
Sbjct: 61   DEALGLAHLCEHAILSGGSKKYPGANYYHEVLAQNGGSHNAYTTGETTTFYFELPAISDS 120

Query: 121  EQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSH 180
             +  F + LD+ +S  K PLF+++L NKEIYAIESEH+ N +   K LYHA RLL+N SH
Sbjct: 121  GELHFDKALDVLASSLKAPLFSDILINKEIYAIESEHNINKALVGKQLYHASRLLANPSH 180

Query: 181  PFHNFSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALA 240
            PF  F TGN  TL  + +L K+N+K  L  + K  Y + NM++C++G QSLN+LTKLA+ 
Sbjct: 181  PFSRFCTGNFTTLCTLPSLNKFNIKAALTSFHKRYYKTSNMSLCLRGSQSLNTLTKLAIR 240

Query: 241  NFGDIKDKDELTKFHINSIKPQXXXXXXXXXXXXXXCNSFKTNENL--DLENFKLLDNAW 298
             FGD+    +      N  +P                +S  +N+     +  FK+L   W
Sbjct: 241  FFGDLPASGQ------NIARPSS--------------SSLFSNKGTAQSMPYFKILKYEW 280

Query: 299  LDKYGDNVCFPTSLSHNTIFLSSSKQPILRLLFPISEKLTRFTKRDIKIYSNIWCHIFGD 358
              KY D   F    S N + + SSK P+LRL+FP+S K TR +  DI  +S+ WC  FGD
Sbjct: 281  TPKYKDVRAFSQG-SSNVVAIQSSKCPVLRLIFPVSHKSTRLSSSDITTFSSTWCDFFGD 339

Query: 359  ETKGSFCDYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIIDILLQQVVK 418
            E+ GS  D L     I+   +  S FA     L LEL LT  G K +  I+ IL    + 
Sbjct: 340  ESVGSLADCLKGCGLISGIVSSVSHFATEEDGLTLELTLTQHGWKNIPTIMCILFDDYIP 399

Query: 419  LLVDNFTENLAYFLAENNIISILRFINSDVEINPMDECSELSGLLQENFKLFNPKYLFYG 478
             L+ + TE++A  L+E N I +L+F+    E +PMD C+ LS  L  + +  +PK L  G
Sbjct: 400  KLIHDKTEDIARCLSELNAIELLKFLYQSTEKSPMDMCANLSAYLLLDLETLDPKCLLKG 459

Query: 479  SEFLLLENESLPQKNNMFDGNSTTFWIGQAIKFQTFLKEFMNWENIKIVGIGDIDEFKNV 538
            S  +    E     +   +  S T+WIG+AIKFQ  + EF+N +N++ V +GD  +  N 
Sbjct: 460  SPLIECNQEHSRIGDYSENTESQTWWIGRAIKFQNLVSEFVNRQNLRAVMLGDQSK-SNF 518

Query: 539  LNIVKEMSKKTDLYYEFEYQ-----KLKISKKSRICPRDYPFTYPIKNEYLPKFGYXXXX 593
            L  V+  + KTD YYEF+Y+      L I       P +Y F  P  + +LP        
Sbjct: 519  LASVRSTT-KTDAYYEFDYRIAYVDMLSIQLDDYTAP-NYHFHAPSYDTFLPMVARKLSL 576

Query: 594  XXXXXXXXXESSRTVSFYM-PQVSEEEDQNKLVSQNDMHKLWVNPKNSKDQLS-ESPCIV 651
                       +++ S ++ P+    +   +L  +N  +++WV  K  +  LS  S  IV
Sbjct: 577  IKQALQVSSTRAQSASLHLIPRSDFLQTPPRLAGKNSNYEVWV--KEEELDLSFSSKSIV 634

Query: 652  SFKLVNNSIQESPESTMHLELMGQLLHTLLINKLYPALNVGYTFEISPSVRGDVSLSFTL 711
            SF++++ S+  SP++TM+LE++GQLL   L   LYP+  +GYT+EISPS +GDV L  T+
Sbjct: 635  SFEIISKSVCASPKNTMYLEILGQLLAGTLSATLYPSEKLGYTYEISPSSKGDVRLGLTV 694

Query: 712  SGFSEGIFKIIKECINIFGELTSSDLITKKEFRRARILVRDKYEDAASDSCVKLASVGLL 771
            SGF EG++ +IK  +      +S D+I+ K FR ARI VR KYE+AA+ +C  LAS+GLL
Sbjct: 695  SGFPEGVYNLIKIIVEEIKSFSSRDIISSKVFREARIAVRSKYEEAAAANCTALASLGLL 754

Query: 772  ILLERKMWTLEERIDALELIDLEMFLEFAQKFFQN-LFLSLYIEGNLEYADLINSYFSDK 830
            I+LE  MW +E+R++ALE I  E F  F   F  +  +++L+I+G++   + INS+    
Sbjct: 755  IILEECMWPIEDRLEALEEISQETFTMFCSHFLTSPTYMNLFIQGDMSCMEKINSFLKWS 814

Query: 831  LVHHLTKRLDY--PKEDTLQSLPSTKLI-SGTNIYYELEGSVDDPNNSIVYFIQTGDLSN 887
            L  HL    +Y  P  +     P  K++ +GTNI+ +     DDPNNSIVYFIQTG+  +
Sbjct: 815  LTSHLEDTREYQGPVRE-----PGAKILKAGTNIFVKRNAFSDDPNNSIVYFIQTGERED 869

Query: 888  KKILSLTSLTAFIISFSLVPELRNKKQIGYVVFGGLRTLSDTVGLHITIMSDGKPLDIEI 947
             +  + T L  F +S +LVP+LRNKKQIGY VFGGLR LS ++GLHIT MS+  P  +E+
Sbjct: 870  ARAYTYTCLAEFFLSLTLVPDLRNKKQIGYAVFGGLRLLSTSIGLHITCMSNSPPEHLEV 929

Query: 948  EIEKYISYLEFDLLGNLDDETFQNNYLIKYIDLINGIYKKSTEQTSGPINIMNEIIANVH 1007
            +IE+Y+SYLE  LL  + +E FQ +Y+ KY  ++        ++T+GP ++M +I ANV 
Sbjct: 930  QIEEYLSYLEKCLLDTMTEEEFQEHYIRKYRVMVENNQVNRMQKTAGPADLMGQIEANVR 989

Query: 1008 GGD-----SAILNSEXXXXXXXXXXELFGDAQMTEELKYVDIEFLKNLNLIKYLQFFKGS 1062
             G+     SA+   +            FG   M EE   V+ + L+ + L ++  FF   
Sbjct: 990  SGNLEEQGSAMRLHKNTKNQISNRRYNFG---MEEEP--VNRDILRTITLSEFRSFFSEK 1044

Query: 1063 ISTNSKRRSKLSIHIKSPMEERELFNRKLFLQLQTFLKIKGFPIKSNELQQIVERTNGRP 1122
            IS  S +RSKLS+ I SPM   E+  ++LFLQ+++FLK+KG  I S++L  I+E + GR 
Sbjct: 1045 ISIYSLKRSKLSVMIASPMTAEEISQKRLFLQVESFLKLKGLKISSSDLHDIIETSLGRT 1104

Query: 1123 TLLFKELFACFKARDESWKFISIVLKEILKVISMSIKQQCKTRGSETRSSIQHSEFHNDH 1182
            + + + LF  F A  E+ K  ++++KEI K + +S+K   +      R+ +  +      
Sbjct: 1105 SGILRGLFRYFSANGETMKLCNVIIKEISKALVLSLKNPSQ------RTRVDDALRGLSK 1158

Query: 1183 IITPT-PLEKVEDINKYLHL 1201
            I+T   PL +++D+N++ +L
Sbjct: 1159 IVTSALPLTEIKDVNQFRNL 1178

>KLTH0E05104g Chr5 complement(449481..453038) [3558 bp, 1185 aa] {ON}
            similar to uniprot|P40851 Saccharomyces cerevisiae
            YPR122W AXL1 Haploid specific endoprotease that performs
            one of two N-terminal cleavages during maturation of a-
            factor mating pheromone required for axial budding
            pattern of haploid cells
          Length = 1185

 Score =  802 bits (2072), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 460/1165 (39%), Positives = 680/1165 (58%), Gaps = 41/1165 (3%)

Query: 9    FDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDPRDIPGIAH 68
            FD+ FY P S SN+  +LCRL NGIL LLISD + T+ + S+SVA+GSH+DP ++ G+AH
Sbjct: 11   FDVAFYTPISSSNKGVELCRLANGILVLLISDPADTSVSSSVSVASGSHADPDEVLGLAH 70

Query: 69   LCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAIEQNTFGEI 128
            LCEH IL+AGSKK+P+   +HE++A N GS NA+TTGE TTFYFELP S    +  F ++
Sbjct: 71   LCEHTILSAGSKKFPRSSHYHEIVAQNGGSHNAYTTGENTTFYFELPASNDSGELLFDKV 130

Query: 129  LDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSHPFHNFSTG 188
            LD  +S FK P+F++   NKEIYAIESEH+ N ++T K LYHA RLL+N  HPF  F TG
Sbjct: 131  LDTLASSFKNPVFSDSSINKEIYAIESEHNVNKASTPKQLYHATRLLANPRHPFSRFCTG 190

Query: 189  NIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALANFGDI--- 245
            N  TL    NL K N+K  L +YFK NY +  M +C++GPQSLN+L KLA   FGD+   
Sbjct: 191  NFATLCDEPNLHKVNVKATLCQYFKTNYDATRMALCLRGPQSLNALAKLAKKYFGDLPAS 250

Query: 246  KDKDELTKFHINSIKPQXXXXXXXXXXXXXXCNSFKTNENLDLENFKLLDNAWLDKYGDN 305
            +D+D          +P                +S   +++L +      ++    +  D 
Sbjct: 251  RDRDP--------TRPPLKKRP----------SSGVASQDLHVRPLDFKNSKQQTQVQDA 292

Query: 306  VCFPTSLSHNTIFLSSSKQPILRLLFPISEKLTRFTKRDIKIYSNIWCHIFGDETKGSFC 365
                TS   N + + SSK P+LRL+FP+S K TR T  DI   S  WC  FGDE  GS  
Sbjct: 293  FVPDTS---NLVAIQSSKNPVLRLVFPVSHKSTRLTSNDIVALSENWCDFFGDEGVGSLT 349

Query: 366  DYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIIDILLQQVVKLLVDNFT 425
              L  NN I    A  + F+ GN  L LE  LTN G    Q II +L    +  L+ + T
Sbjct: 350  HCLKTNNLINGVVASVAHFSAGNDGLTLEFTLTNLGWSSAQLIITVLFDLFIPRLIHDKT 409

Query: 426  ENLAYFLAENNIISILRFINSDVEINPMDECSELSGLLQENFKLFNPKYLFYGSEFLLLE 485
            +++A  L+E N   +L F+    E + M+ C+ LS  L   F+  +PK L  GS  +   
Sbjct: 410  KDIAKCLSELNCTDLLTFLYQGAEKSSMEMCAVLSSRLLSVFETLDPKCLLKGSPLIECN 469

Query: 486  NESLPQKNNMFDGNSTTFWIGQAIKFQTFLKEFMNWENIKIVGIGDIDEFKNVLNIVKEM 545
                   +      S T+WIG+AIKFQ F+ EF+N +N++IV +G+  +  ++L+ V  +
Sbjct: 470  QNPSAIGDYSESTESRTWWIGRAIKFQNFVSEFVNRQNLRIVMLGNCPK-SDLLSSVTSV 528

Query: 546  SKKTDLYYEFEYQKLKISKKSRICPRD-------YPFTYPIKNEYLPKFGYXXXXXXXXX 598
            SK TD YYEF YQ   ISK   +  R+       + F  P  + +LP  G          
Sbjct: 529  SK-TDAYYEFTYQ---ISKIDMLSVREELYRIPGFSFRVPCYDMFLPTVGRKLGLIKQAL 584

Query: 599  XXXXESSRTVSF-YMPQVSEEEDQNKLVSQNDMHKLWVNPKNSKDQLSESPCIVSFKLVN 657
                  S+T     + + +  +   +L  +N  H+LWV  ++S D   +S  I+S ++ +
Sbjct: 585  QASSNRSQTSLLTVVARNAYLQTIPRLAGKNSNHELWVKEEDS-DLSFKSKSIISIEVAS 643

Query: 658  NSIQESPESTMHLELMGQLLHTLLINKLYPALNVGYTFEISPSVRGDVSLSFTLSGFSEG 717
             +I+  P  TM LE++ QLL   L   LYP+  +GYT+EISPS +G   LSFT+SGF EG
Sbjct: 644  KTIEACPSYTMCLEVLAQLLGDSLSTVLYPSEKLGYTYEISPSAKGHARLSFTISGFPEG 703

Query: 718  IFKIIKECINIFGELTSSDLITKKEFRRARILVRDKYEDAASDSCVKLASVGLLILLERK 777
            +  +++  I+    L +SD +T   FR+AR+ VR+KYE+AAS +   LA++GLLI+LE  
Sbjct: 704  VCAMVRVIIDQTKSLINSDTVTPAMFRKARVAVRNKYEEAASANSTTLATLGLLIVLEEC 763

Query: 778  MWTLEERIDALELIDLEMFLEFAQKFF-QNLFLSLYIEGNLEYADLINSYFSDKLVHHLT 836
            MW +E+R+DALE ID+E F  F   F  +  +L+++ +G+L Y + I+++    L  HL+
Sbjct: 764  MWPVEDRLDALEEIDIESFRTFCSGFISKPTYLNVFSQGDLSYTEEISTFLDSGLTSHLS 823

Query: 837  KRLDYPKEDTLQSLPSTKLISGTNIYYELEGSVDDPNNSIVYFIQTGDLSNKKILSLTSL 896
            +R  +  E  ++   +  L  GTN++      V+DP++SIVYFIQTGD  + ++LSLT L
Sbjct: 824  RRTWH--EPAVREPVTHALKPGTNMFIRRSAFVEDPSSSIVYFIQTGDRDDAQMLSLTCL 881

Query: 897  TAFIISFSLVPELRNKKQIGYVVFGGLRTLSDTVGLHITIMSDGKPLDIEIEIEKYISYL 956
            T F++S +LVP+LR KKQIGY VF GLR LS T+GLHIT MS   P  +E +I++Y++Y+
Sbjct: 882  TEFLMSMTLVPDLRTKKQIGYAVFSGLRLLSTTMGLHITCMSSSPPEHLESQIDQYLAYM 941

Query: 957  EFDLLGNLDDETFQNNYLIKYIDLINGIYKKSTEQTSGPINIMNEIIANVHGGDSAILNS 1016
            E D+L  + +E FQ  Y+ K+  +       ST   +GP +++ +I ANVH G+     +
Sbjct: 942  EHDVLSAMSEEEFQERYIRKFRAMFERENVTSTSDAAGPADLLAQIEANVHSGNLPEQGA 1001

Query: 1017 EXXXXXXXXXXELFGDAQMTEELKYVDIEFLKNLNLIKYLQFFKGSISTNSKRRSKLSIH 1076
                               T +L+  D+  L+ L L ++ +FF+  IS  S  RSKLS+ 
Sbjct: 1002 AMRQHKRIRNQISIHRYNFTSDLEPADLGLLRALTLGQFRRFFQEKISICSTTRSKLSVM 1061

Query: 1077 IKSPMEERELFNRKLFLQLQTFLKIKGFPIKSNELQQIVERTNGRPTLLFKELFACFKAR 1136
            + SP+   E+  ++LFLQ++++LK+KG  I S+EL+ IVE + G+P+ L + LF  F AR
Sbjct: 1062 VASPVSADEIAEKRLFLQIESYLKLKGLKIPSSELRAIVESSQGKPSTLMRGLFKFFLAR 1121

Query: 1137 DESWKFISIVLKEILKVISMSIKQQ 1161
             E+ +  +++LKE+ K + +S+K +
Sbjct: 1122 GETLRLCNVILKELSKAVVLSLKPR 1146

>KLLA0D15631g Chr4 (1319185..1322697) [3513 bp, 1170 aa] {ON} similar
            to uniprot|P40851 Saccharomyces cerevisiae YPR122W AXL1
            Haploid specific endoprotease that performs one of two
            N-terminal cleavages during maturation of a- factor
            mating pheromone required for axial budding pattern of
            haploid cells
          Length = 1170

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/1171 (35%), Positives = 676/1171 (57%), Gaps = 59/1171 (5%)

Query: 1    MSWINTKTFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDP 60
            M+    +T D+  Y P S SNR  +  +L NGI ALLISD   +  +   SVATGSH+DP
Sbjct: 1    MTAATVQTIDVPIYTPISNSNRAHQFVQLSNGITALLISDPGESFASLCASVATGSHNDP 60

Query: 61   RDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTST-A 119
             ++PG+AHLCEHMI+++ SKK+PK   +H++L   NG+QNAFTTGEQT+FYFE+P S   
Sbjct: 61   DEVPGLAHLCEHMIISSESKKFPKRSHYHDLLIEYNGNQNAFTTGEQTSFYFEIPNSNNK 120

Query: 120  IEQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKS 179
              +  F E++ + +     P+F     NKEI AI++EH+ N +  SK LYH  + L+ + 
Sbjct: 121  TGKPIFDELVGVIADKLGSPIFQSADINKEIQAIDNEHENNKNLVSKALYHGTKKLATQR 180

Query: 180  HPFHNFSTGNIHTLSK--VVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKL 237
              F  FSTGNI+TL++  +V  K  NLK +L +++ +N+ + N++I I+G QSL+ L KL
Sbjct: 181  SKFSRFSTGNIYTLTQFPIVAGKIINLKNVLQKHYADNFVAENISIVIRGSQSLHYLKKL 240

Query: 238  ALANFGDIKDKDELTKFHINSIKPQXXXXXXXXXXXXXXCNSFKTNENLDLENFKLLDNA 297
                FGD + K        ++IK Q                      +  +E+FK L   
Sbjct: 241  VQTTFGDFRTK--------STIKSQ----------------------SFSIESFKKLQKV 270

Query: 298  WLDKYGDNVCFPTSL-SHNTIFLSSSKQPILRLLFPISEKLTRFTKRDIKIYSNIWCHIF 356
            W  +Y + +       + N+I + SSK PILRL+FP+S +   F++ ++KI+S +W  +F
Sbjct: 271  WAARYTEPLFSKQEPETPNSILIQSSKAPILRLVFPVSHQEALFSRSELKIFSKVWSDLF 330

Query: 357  GDETKGSFCDYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKK-LQNIIDILLQQ 415
            GDE+ GS     +  N +T      S F I +  L+L+ +LTN+G K  +++++  L Q 
Sbjct: 331  GDESSGSIHSKFSARNILTRQVTQLSKFTIDDEGLVLQFELTNSGWKTGVESLLTDLFQG 390

Query: 416  VVKLLVDNFTENLAYFLAENNIISILRFINSDVEINPMDECSEL-SGLLQENFKLFNPKY 474
             +        + +A +L E N I++L+F+  D++ + MD+CS+L S LLQ      +P++
Sbjct: 391  FLPFFQSIDPDEIAQYLNEWNTINLLQFMYQDLDNSTMDKCSDLCSELLQCE----DPQF 446

Query: 475  LFYGSEFLLLENESLPQKNNMFDGNSTTFWIGQAIKFQTFLKEFMNWENIKIVGIGDIDE 534
            +   S       +     +      S  +W  QA KF +F+K +M+W N K++ +GD+  
Sbjct: 447  ILNNSIAFSCNRKGSDIGSYYESPKSKEWWNSQAKKFLSFVKTYMSWNNCKLIFLGDLQS 506

Query: 535  FKNVLNIVKEMSKKTDLYYEFEYQKLKIS-KKSRICPRDYPFTYPIKNEYLPKFGYXXXX 593
               + +     + K D +Y F+Y+   I     ++ P+D  F  P    +L  FG     
Sbjct: 507  NDFLKSRQVPTNVKFDEHYRFQYELSLIKLNHVKMSPKD--FRLPSSTAFL--FGLEKNL 562

Query: 594  XXXXXXXXXESSRTVSFYMPQVSEE---EDQNKLVSQNDMHKLWVNPKNSKDQLSESPCI 650
                        ++    +  +++    +   +L+S+N+ ++LWV  +NS +  S S  +
Sbjct: 563  SALKQSLTAVLRKSQGSALSIITQSKLLQTTPRLMSKNENYELWVKEENSLEYSSRS--V 620

Query: 651  VSFKLVNNSIQESPESTMHLELMGQLLHTLLINKLYPALNVGYTFEISPSVRGDVSLSFT 710
            ++ +L+N  ++ S ++TM+LE++ QLL+  +   LYP+  VGY ++I+ + RGDV L+ T
Sbjct: 621  ITIELINMGMEPSAKNTMNLEILTQLLYFYINESLYPSERVGYMYQIAANNRGDVRLAVT 680

Query: 711  LSGFSEGIFKIIKECINIFGELTSSDL-ITKKEFRRARILVRDKYEDAASDSCVKLASVG 769
            ++GF +G+  I++  ++   ++   D  IT   FR +RILVR KYE+AA  +   LAS+G
Sbjct: 681  INGFPQGVAMILQIIMDKMVDIGKPDFDITNSMFRHSRILVRTKYEEAARANSCTLASLG 740

Query: 770  LLILLERKMWTLEERIDALELIDLEMFLEFAQKFF--QNLFLSLYIEGNLEYADLINSYF 827
            +LILLE+++ TLEER+DALE ID+E F  F +  +  ++ +++L I+G+L  A+ +N Y 
Sbjct: 741  VLILLEKELTTLEERLDALEDIDIESFKMFCKDLWIPKSNYMNLVIQGDLSIAETVNQYM 800

Query: 828  SDKLVHHLT-KRLDYPKEDTLQSLPSTKLISGTNIYYELEGSVDDPNNSIVYFIQTGDLS 886
             D ++HHL+   ++      L+   + KL  G+N + E+    +DP NS+VYFI+TGD +
Sbjct: 801  -DGIIHHLSGPNVNQTSVFRLREPETIKLAQGSNFFIEMTSFKEDPTNSVVYFIETGDRT 859

Query: 887  NKKILSLTSLTAFIISFSLVPELRNKKQIGYVVFGGLRTLSDTVGLHITIMSDGKPLDIE 946
            N    +++SL  + +S +LVP+LRNKKQIGYVV GGLR L+DT+G+HI++MS+  P  IE
Sbjct: 860  NPVDYTMSSLFEYFMSMTLVPDLRNKKQIGYVVLGGLRLLTDTLGIHISVMSNLPPHTIE 919

Query: 947  IEIEKYISYLEFDLLGNLDDETFQNNYLIKYIDLINGIYKKSTEQTSGPINIMNEIIANV 1006
              IE+Y+ YLE ++LG + +  FQ+N L KY+ LI     +   + +GP N+M +I A+V
Sbjct: 920  DRIEEYLYYLETNVLGAMTEAEFQDNILQKYMQLIKSNSLEKLIKNAGPANLMAQIEASV 979

Query: 1007 HGGD-SAILNSE--XXXXXXXXXXELFGDAQMTEELKYVDIEFLKNLNLIKYLQFFKGSI 1063
            H G+  + L S+            E+        E K VD+  L  L L ++ + F   I
Sbjct: 980  HSGNYPSNLQSQGYTVGQHKKLKDEISFRTYAFSETK-VDVCLLSKLTLQEFKRLFMEKI 1038

Query: 1064 STNSKRRSKLSIHIKSPMEERELFNRKLFLQLQTFLKIKGFPIKSNELQQIVERTNGRPT 1123
            S  S +R KLS+  K+PM + ++    + +QL  FLK KGF I  +ELQ+IV +T G+PT
Sbjct: 1039 SILSLQRRKLSVRFKTPMTKPDIGISMMTMQLDGFLKSKGFHITRDELQEIVTKTAGKPT 1098

Query: 1124 LLFKELFACFKARDESWKFISIVLKEILKVI 1154
             LFKELF  F+ + +S +  ++VLKEI+K I
Sbjct: 1099 SLFKELFHHFRTQGQSLRLCTLVLKEIVKQI 1129

>CAGL0D04686g Chr4 (457938..461483) [3546 bp, 1181 aa] {ON} similar to
            uniprot|P40851 Saccharomyces cerevisiae YPR122w AXL1
            protease
          Length = 1181

 Score =  595 bits (1535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/1199 (31%), Positives = 628/1199 (52%), Gaps = 106/1199 (8%)

Query: 5    NTKTFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDPRDIP 64
            + K F + FY+P  + NR  KL +LPNGI  ++ISD      +CS++VA GSH+DP  +P
Sbjct: 4    DVKKFWVPFYVPLLHMNRAYKLIQLPNGINVVIISDAEENYNSCSLTVAAGSHNDPATVP 63

Query: 65   GIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAIEQN- 123
            G+AHLCEHMILAAGS  +P PGLFH ++A  NG  NA+TTGEQT+FYF++P     E   
Sbjct: 64   GLAHLCEHMILAAGSSNHPTPGLFHSLIAKYNGDMNAYTTGEQTSFYFQVPQVANSEGTL 123

Query: 124  TFGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSHPFH 183
             F E+L +FSS FK PLF   + NKEIYAI+SEH+ N +N  K+LY A RLL+NK+HPF 
Sbjct: 124  AFEELLSVFSSAFKFPLFTSSVLNKEIYAIQSEHENNKTNPGKVLYQATRLLANKNHPFS 183

Query: 184  NFSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALANFG 243
             F TG+++TL    + +  N+++ L  YF +N++  N+T+C++GPQSLN L KL + NF 
Sbjct: 184  RFCTGDMNTLKTFPSTENINIRKELISYFNDNFYGENITLCVRGPQSLNHLVKLCMQNFN 243

Query: 244  DIKDKDELTKFHINSIKPQXXXXXXXXXXXXXXCNSFKTNENLDLENFK-------LLDN 296
            DIK    L                           +   N + D E F+       +L +
Sbjct: 244  DIKPLPVLP-------------------------TAIGNNRDSDTELFEETLKRLNILYD 278

Query: 297  AWLDKYGDNVCFPTSLSHNTIFLSSSKQPILRLLFPISEKLTRFTKRDIKIYSNIWCHIF 356
             W  +Y    CF     +N I ++S  +   R++ P+    TR      ++++NI   + 
Sbjct: 279  VWAPRYTSLPCFHIGYKNNVILVNSDMEQSFRIVIPLITNDTREDAIFTEVFTNICVELL 338

Query: 357  GDETKGSFCDYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIIDILLQQV 416
            G+E  GSFC +L + +W+ ECY ++S FA+G   ++LE K  +TG  +++NI+++L Q +
Sbjct: 339  GNEEVGSFCHFLKEISWVRECYVYRSEFAVGAAGIVLEFKCFDTGFSQIENIVNVLFQTL 398

Query: 417  VKLLVDNFTENLAYFLAENNIISILRFINSDVEINPMDECSELSGLLQENFKLFNPKYLF 476
            + + ++  +++LA F+ E  II  + F+ +   ++PM+E S+LS  LQ++      KYL 
Sbjct: 399  IPMYLNMPSDDLARFIKEQTIIETIDFMYTWKHLSPMEESSDLSMQLQKDLHNRGIKYLL 458

Query: 477  YGSEFLLLENESLPQKNNMFDGNSTTFWIGQAIKFQTFLKEFMNWENIKIVGIGDIDEF- 535
              S   L   E + +   +       +W     KF+ FL+  M   N K++ I   + F 
Sbjct: 459  MKSPSFLHNYEEMSKTEKLH------YWPLIVEKFKVFLRRHMILPNAKVI-IPTSEPFT 511

Query: 536  KNVLNIVK-----EMSKKTDLYYEFEYQKLKIS-KKSRICPRDYPFTYPIKNEYLPKFGY 589
            K V N+ K     E++ +TD YYEF Y    +S  +SR+    Y F++P  NE++P   Y
Sbjct: 512  KTVRNLFKNAQQMEVTSETDPYYEFNYSVYSVSFPESRVI-FPYQFSFPGPNEFIPP-KY 569

Query: 590  XXXXXXXXXXXXXESSRTVSFYMPQV----SEEEDQNKLVSQNDMHKLW----VNPKNSK 641
                               S   P V    S      KLV Q +  ++W    V+   SK
Sbjct: 570  RNLDTLLEMLFGISERANFSPLRPIVRLKNSRARSAPKLVHQTEDVEIWTANIVDGIFSK 629

Query: 642  DQLSESPCIVSFKLVNNSIQESPESTMHLELMGQLLHTLLINKLYPALNVGYTFEISPSV 701
               ++    V+ K+VN  I+ +P S++HL +M ++++  L+ +LY    +G++F +  ++
Sbjct: 630  VVNADIKSYVTIKIVNQCIRPTPISSLHLGMMVEIMNMFLLPRLYSCTKLGFSFHLQAAL 689

Query: 702  RGDVSLSFTLSGFSEGIFKIIKECINIFGELTSSD--LITKKEFRRARILVRDKYEDAAS 759
             G +S    ++G   GI KI+++  ++   + +    ++T    R+AR+ +R +YE A  
Sbjct: 690  DGSMSFDIVVTGIMAGIIKILEKVTDLIEIIVTKPGYILTNAFIRKARVAIRSRYEAATK 749

Query: 760  DSCVKLASVGLLILLERKMWTLEERIDALELIDLEMFLEFAQKFFQNLFLSLYIEGNLEY 819
             S VK+ + GLL+ LE  +W+ EER+DALE  D+E+F +F   FF+        +    +
Sbjct: 750  GSSVKIGTTGLLVDLEPHVWSFEERVDALEESDIEVFFQFINTFFRTH------KHTKVF 803

Query: 820  ADLINSYFSDKLVHHLTKRLDYPK--------EDTLQSLPSTKLI-SGTNIYYELEGSVD 870
            A   ++   DK+  ++ +R+  P          + ++    T+++  G   + +L G  +
Sbjct: 804  AQSSSTSNIDKIARYVVQRIVTPGIPEGNDALVECVRDDGHTRMLKPGEERHIKLIGRDN 863

Query: 871  DPNNSIVYFIQTGDLS--NKKILSLTSLTAFIISFSLVPELRNKKQIGYVVFGGLRTLSD 928
            DPNN +  +++   L   + K   +   T ++   +LVPELRNK+Q+GY V GGL  L++
Sbjct: 864  DPNNCVFSYLEMAPLEGISLKQYRMIEFTDYLFQLTLVPELRNKRQVGYAVDGGLVILNN 923

Query: 929  TVGLHITIMSDGKPLDIEIEIEKYISYLEFDLLGNLDDETFQNNYLIKYIDLINGIYKKS 988
             VG+++ ++S   P  IE EIE Y +++                YL   +D I   Y K 
Sbjct: 924  VVGVNVVVVSSTSPEHIEQEIESYYAHVR--------------QYLSDNVDQIWRDYSKI 969

Query: 989  TEQTSGPINIMN-EIIANVHGGDSAILNSEXXXXXXXXXXELFGDAQMTEELKYVDI--- 1044
                   + +++ ++  N+   +S I   E           +F    +  EL  VD    
Sbjct: 970  INDRDPLMYLLDHDVWYNIERENSDI--PEYSRDHVANCQRVFKYKDLI-ELLVVDTPIS 1026

Query: 1045 ----EFLKNLNLIKYLQFFKGSISTNSKRR-----SKLSIHIKSPMEERELFNRKLFLQL 1095
                ++    ++ +YLQF   SI T   +R       +S+ + SPM++R++F R++  QL
Sbjct: 1027 GRHPDYTPPFSMQEYLQFLDSSIGTYKHKRHHNGTRSVSVWVYSPMDKRDVFQRQVKYQL 1086

Query: 1096 QTFLKIKGFPIKSNELQQIVERTNGRPTLLFKELFACFKARDESWKFISIVLKEILKVI 1154
            ++FLK+KG  I   +L  I+    G+ T +FK L+  FK ++E+ KF++ V  E  K I
Sbjct: 1087 ESFLKLKGLVIPERDLADIIREAGGKQTTMFKLLYRRFKRQNEAGKFVNSVATETFKSI 1145

>Skud_12.474 Chr12 complement(839782..842850) [3069 bp, 1022 aa]
           {ON} YLR389C (REAL)
          Length = 1022

 Score =  169 bits (427), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 95/246 (38%), Positives = 141/246 (57%), Gaps = 10/246 (4%)

Query: 5   NTKTFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDPRDIP 64
           N KTFD+DF  P     R+ +   LPN + ALLI D      A S+ V  G+  DP  +P
Sbjct: 56  NFKTFDLDFLKPD-LDERSYRFIELPNKLKALLIQDPKADKAAASLDVNIGAFEDPESLP 114

Query: 65  GIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAIEQNT 124
           G+AH CEH++   GS+K+P    +   L+ + GS NA+T  + T ++FE+       Q+ 
Sbjct: 115 GLAHFCEHLLFM-GSEKFPDENEYSSYLSKHGGSSNAYTASQNTNYFFEIN-----HQHL 168

Query: 125 FGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSHPFHN 184
           FG  LD F+ FF  PLFN+  T+KEI A+ SE+  N+ N    +Y  ++ L+N +HP+H 
Sbjct: 169 FG-ALDRFAGFFSCPLFNKDSTDKEINAVNSENKKNLQNDIWRIYQLDKSLTNPNHPYHK 227

Query: 185 FSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRN-MTICIKGPQSLNSLTKLALANFG 243
           FSTGNI TL  +      N+++ L + F NN++S N M +CI G + L++L+      F 
Sbjct: 228 FSTGNIETLGTLPKENGQNVRDELLQ-FHNNFYSANLMKLCILGREDLDTLSDWTYNLFK 286

Query: 244 DIKDKD 249
           DI + D
Sbjct: 287 DISNND 292

 Score = 59.7 bits (143), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 118/613 (19%), Positives = 231/613 (37%), Gaps = 117/613 (19%)

Query: 351 IWCHIFGDETKGSFCDYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIID 410
           I  H+ G E  GS   +L    W  E  A   T + GN    +++ LT+ G+   +++I 
Sbjct: 343 ILSHLIGHEGSGSLLAHLKNVGWANELSAGGHTVSKGNAFFAVDIDLTDNGLTHYRDVI- 401

Query: 411 ILLQQVVKLLVDNFTENLAYFLAENNIISILRFINSDVEINPMDECSELSGLLQENF--- 467
           +L+ Q +++L ++  +   +   ++   +  +F  +    +P    S L+  L++ +   
Sbjct: 402 VLVFQYIEMLKNSLPQKWIFSELQDICNASFKFKQAG---SPSSTVSSLAKFLEKEYIPV 458

Query: 468 ---------KLFNPKYLFYGSEFLLLENESLPQKNNMFDGNSTTFWIGQAIKFQTFLKEF 518
                      + P  L   ++ L+ EN  +   +   + NS+  W G A K   +  + 
Sbjct: 459 DRILAMGLLTKYEPDLLTQYTDALIPENSRVTLISKSLETNSSEKWYGTAFKVLDYPADL 518

Query: 519 MNWENIKIVGIGDIDEFKNVLNIVKEMSKKTDLYYEFEYQKLKISKKSRICPRDYPFTYP 578
           +   +IK  G+         LN+ +          EF     K+ K   + P + P    
Sbjct: 519 V--RDIKSPGLNP------ALNLPRPN--------EFVSTNFKVDKIDGVKPLEEPM--- 559

Query: 579 IKNEYLPKFGYXXXXXXXXXXXXXESSRTVSFYMPQVSEEEDQNKLVSQNDMHKLWVNPK 638
                                                        L+  + + +LW   K
Sbjct: 560 ---------------------------------------------LLLSDGVSRLWYK-K 573

Query: 639 NSKDQLSESPCIVSFKL--VNNSIQESPESTMHLELMGQLLHTLLINKLYPALNVGYTFE 696
           + +         +SFKL   + SI  S  ST++++++   L  L  +     L + +   
Sbjct: 574 DDRFWQPRGYIYLSFKLPHTHASIINSMLSTLYIQMVNDALKDLQYDADCAGLRISFN-- 631

Query: 697 ISPSVRGDVSLSFTLSGFSEGIF----KIIKECINIFGELTSSDLITKKEFRRARILVRD 752
                + +  L  T SG++E +     + ++  I+   +    +++  K  R  + L+  
Sbjct: 632 -----KTNQGLDITASGYNEKLIILLTRFLQGVISFEPKKNRFEILKDKTIRHLKNLL-- 684

Query: 753 KYEDAASDSCVKLASVGLLILLERKMWTLEERIDALELIDLEMFLEFAQKFFQNLFLSLY 812
            YE   S       S     L+  + W+  E++   E +  E  + F    ++  F    
Sbjct: 685 -YEVPYSQMSNYYNS-----LINERSWSTAEKLQVFEKLSYEQLINFIPTIYEGAFFETL 738

Query: 813 IEGNLEYADLINSYFSDKLVHHLTKRLDYPKEDTLQ----SLPSTKLISGTNIYYE--LE 866
           I GN++  + +        V  L K +     + LQ     L S  L  G +  YE  L+
Sbjct: 739 IHGNIKREEAME-------VDSLIKSMITVNINNLQVSNNRLRSYLLPKGKSFRYETALK 791

Query: 867 GSVDDPNNSIVYFIQTGDLSNKKILSLTSLTAFIISFSLVPELRNKKQIGYVVFGGLRTL 926
            S++   NS +  +   D+ ++++ +L+ L   +I       LR K+Q+GYVVF      
Sbjct: 792 DSLN--VNSCIQHVTQLDVYSEELSALSGLFTQLIHEPCFDTLRTKEQLGYVVFSSSLNN 849

Query: 927 SDTVGLHITIMSD 939
             T  + I I S+
Sbjct: 850 HGTANIRILIQSE 862

>TPHA0B02260 Chr2 (517138..520263) [3126 bp, 1041 aa] {ON} Anc_4.246
           YLR389C
          Length = 1041

 Score =  168 bits (426), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 137/531 (25%), Positives = 225/531 (42%), Gaps = 85/531 (16%)

Query: 7   KTFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDPRDIPGI 66
           KT + DF  P    +R+ +  +LPN + ALLISD      A SI V  G+  DP ++PG+
Sbjct: 77  KTLNSDFLKPD-LDDRSYRYIQLPNSLKALLISDPQTDKAAASIDVNVGAFEDPENLPGL 135

Query: 67  AHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAIEQNTFG 126
           AH CEH++   GS+K+P    +   L+ + G  NA+T    T ++FE      +      
Sbjct: 136 AHFCEHLLFM-GSEKFPDQNEYSSYLSKHGGHSNAYTAALNTNYFFE------VNHEHLH 188

Query: 127 EILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSHPFHNFS 186
             LD FS FF  PL N   T KEI A++SE+  N+ N     Y  ++ +SN +HP+H FS
Sbjct: 189 GALDRFSGFFTGPLMNADSTEKEINAVDSENKKNLQNDDWRRYQMDKTISNYNHPYHKFS 248

Query: 187 TGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALANFGDIK 246
           TGNI TL +       N +  L +++ ++Y +  M +CI G Q L++L+  A   F D+K
Sbjct: 249 TGNIKTLMEEPTKLGLNTRNELLKFYNSSYSANIMKLCILGRQDLDTLSNWATEFFKDVK 308

Query: 247 DKDELTKFHINSIKPQXXXXXXXXXXXXXXCNSFKTNENLDLENFKLLDNAWLDKYGDNV 306
           +        +N   PQ                                       Y +N+
Sbjct: 309 N--------LNKALPQ---------------------------------------YNENI 321

Query: 307 CFPTSLSHNTIFLSSSKQPILRLLFPISEKLTRFTKRDIKIYSNIWCHIFGDETKGSFCD 366
                L      +       L + F + +    +  R   + S    H+ G E  GS   
Sbjct: 322 LEEEHLKKIIKIIPVKDLKKLEINFVVPDMDLHWESRPHHVLS----HLIGHEGSGSILS 377

Query: 367 YLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIIDILLQQVVKLLVDNFTE 426
           YL K  W  +  A   T +  N    + + LT+ G++  Q I          LL+  + E
Sbjct: 378 YLKKLGWANDLSAGAHTVSKDNAFFGINVDLTDKGLENYQEIA---------LLIFQYIE 428

Query: 427 NLAYFLAENNIISILRFINSDV-----EINPMDECSELSGLLQENF------------KL 469
            L + L +  I S L+ ++        + +P    SELS LL++ +            + 
Sbjct: 429 MLKHSLPQEWIFSELQDVSKSSFKFKQKSSPSGTVSELSKLLEKEYINPDLILSTTLLRK 488

Query: 470 FNPKYLFYGSEFLLLENESLPQKNNMFDGNSTTFWIGQAIKFQTFLKEFMN 520
           + P+ +    + L ++N  +   +   + +S   W G   +   + K F++
Sbjct: 489 YEPEMIKQYVDSLTVDNSRITLISKTVETDSKEKWYGTEYQVVDYPKSFID 539

 Score = 60.8 bits (146), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/241 (24%), Positives = 110/241 (45%), Gaps = 23/241 (9%)

Query: 763 VKLASVGLL--ILLERKMWTLEERIDALELIDLEMFLEFAQKFFQNLFLSLYIEGNLEYA 820
           V  + +G L   ++    W ++E++D LE +  + F+ F    +   +    + GN+ Y 
Sbjct: 707 VPYSQMGTLYNTIMNESTWPIKEKLDVLEALTFDQFVSFVPSIYNEFYFDALVHGNIRYE 766

Query: 821 ------DLINSYFSDKLVHHLTKRLDYPKEDTLQSLPSTKLISGTNIYYELE-GSVDDPN 873
                 DL+ S  S K+++   +            L S  L  G +  YE++    D+ N
Sbjct: 767 EAMEANDLLKSLASFKILNLHVRN---------SRLRSYILPEGESYRYEIDMEDKDNLN 817

Query: 874 NSIVYFIQTGDLSNKKILSLTSLTAFIISFSLVPELRNKKQIGYVVFGGLRTLSDTVGLH 933
           + I + +Q G L  +++ +L+ L A +I       LR K+Q+GYVVF        T  + 
Sbjct: 818 SCIQHVVQLG-LYTEELSALSGLFAQMIREPCFDTLRTKEQLGYVVFSSNLNNHGTANMR 876

Query: 934 ITIMSDGKPLDIEIEIEKYISYLEF-DLLGNLDDETFQNNYLIKYIDLINGIYKKSTEQT 992
           I + S+     +E  I+++  Y +F + L N+ +E F+ +    Y  L    YK   E++
Sbjct: 877 ILVQSEHSTSYLEWRIDEF--YKKFGESLNNMSEEDFEKHKDALYKSLTQK-YKNMREES 933

Query: 993 S 993
           S
Sbjct: 934 S 934

>Suva_10.506 Chr10 complement(865239..868310) [3072 bp, 1023 aa]
           {ON} YLR389C (REAL)
          Length = 1023

 Score =  167 bits (423), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 92/255 (36%), Positives = 142/255 (55%), Gaps = 8/255 (3%)

Query: 5   NTKTFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDPRDIP 64
           N KTFD+DF  P     R+ +   LPN + ALLI D      A S+ V  G+  DP ++P
Sbjct: 57  NFKTFDLDFLKPD-LDERSYRFIELPNKLKALLIQDPKADKAAASLDVNVGAFEDPENLP 115

Query: 65  GIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAIEQNT 124
           G+AH CEH++   GS+K+P    +   L+ + GS NA+T  + T ++FE+       Q+ 
Sbjct: 116 GLAHFCEHLLFM-GSEKFPDENEYSSYLSKHGGSSNAYTASQNTNYFFEVN-----HQHL 169

Query: 125 FGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSHPFHN 184
            G  LD FS FF  PLF +  T+KEI A+ SE+  N+ N    +Y  ++ L+N  HP+H 
Sbjct: 170 LG-ALDRFSGFFSCPLFQKDSTDKEINAVNSENKKNLQNDIWRIYQLDKSLTNSKHPYHK 228

Query: 185 FSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALANFGD 244
           FSTGNI TL +       N+++ L ++ K+ Y +  M +CI G + L++L++     F D
Sbjct: 229 FSTGNIETLGESPKENGLNIRDELLKFHKHFYSANIMKLCILGREDLDTLSEWTYDLFKD 288

Query: 245 IKDKDELTKFHINSI 259
           + + D    ++  SI
Sbjct: 289 VSNNDREVPYYPESI 303

 Score = 71.6 bits (174), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 122/613 (19%), Positives = 235/613 (38%), Gaps = 117/613 (19%)

Query: 351 IWCHIFGDETKGSFCDYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIID 410
           I  H+ G E  GS   +L +  W  E  A   T + GN    +++ LT+ G+   +++I 
Sbjct: 344 ILSHLIGHEGSGSLLAHLKELGWANELSAGGHTVSKGNAFFAVDIDLTDNGLTHYRDVI- 402

Query: 411 ILLQQVVKLLVDNFTENLAYFLAENNIISILRFINSDVEINPMDECSELSGLLQENF--- 467
           +L+ Q + +L ++  +   +   ++   +  +F  +    NP    S L+ LL+ ++   
Sbjct: 403 VLIFQYIGMLKNSLPQKWIFTELQDISNATFKFKQAG---NPSSTVSSLAKLLERDYIPV 459

Query: 468 ---------KLFNPKYLFYGSEFLLLENESLPQKNNMFDGNSTTFWIGQAIKFQTFLKEF 518
                      + P  +   +E L+ EN  +   +   + +S+  W     K   + ++ 
Sbjct: 460 DKILAMGLLTEYEPDLITKYTEALIPENSRVTLISRGLETDSSEKWYETKYKILDYPEDL 519

Query: 519 MNWENIKIVGIGDIDEFKNVLNIVKEMSKKTDLYYEFEYQKLKISKKSRICPRDYPFTYP 578
           +  ++IK  G+         LN+ +          EF     K++K   + P D P    
Sbjct: 520 L--KDIKSPGLNP------ALNLPRPN--------EFVSTNFKVNKIDGVKPTDEPM--- 560

Query: 579 IKNEYLPKFGYXXXXXXXXXXXXXESSRTVSFYMPQVSEEEDQNKLVSQNDMHKLWVNPK 638
                                                        L+  + M +LW   K
Sbjct: 561 ---------------------------------------------LLLSSGMSRLWYK-K 574

Query: 639 NSKDQLSESPCIVSFKL--VNNSIQESPESTMHLELMGQLLHTLLINKLYPALNVGYTFE 696
           + +         +SFKL   + S+  S  ST++++++   L  L  +     L + +   
Sbjct: 575 DDRFWQPRGYIYLSFKLPHTHASVINSMLSTLYIQMINDALKDLQYDAACADLRISF--- 631

Query: 697 ISPSVRGDVSLSFTLSGFSEGIF----KIIKECINIFGELTSSDLITKKEFRRARILVRD 752
               V+ +  L  T SGF+E +     + ++  ++   +    +++  K  R  + L+  
Sbjct: 632 ----VKTNQGLDITASGFNEKLIVLLTRFLQGVVSFEPKKDRFEILKDKTIRHLKNLL-- 685

Query: 753 KYEDAASDSCVKLASVGLLILLERKMWTLEERIDALELIDLEMFLEFAQKFFQNLFLSLY 812
            YE   S       S     L+  + W+  E++   E +  E    F    ++ +F    
Sbjct: 686 -YEVPYSQMSNYYNS-----LINERSWSTAEKLQVFEKLTFEQLNSFIPTIYEGVFFETL 739

Query: 813 IEGNLEYADLINSYFSDKLVHHLTKRLDYPKEDTLQ----SLPSTKLISGTNIYYELEGS 868
           + GN+++ + I        V  L K L     D LQ     L S  L  G +  YE +  
Sbjct: 740 VHGNIKHEEAIE-------VDSLIKSLIANNIDNLQVSNNRLRSYLLPKGKSFRYETD-- 790

Query: 869 VDDPNN--SIVYFIQTGDLSNKKILSLTSLTAFIISFSLVPELRNKKQIGYVVFGGLRTL 926
           + DP N  S +  +   D+ ++++ +L+ L A +I       LR K+Q+GYVVF      
Sbjct: 791 LKDPKNVNSCIQHVTQLDVYSEELSALSGLFAQLIHEPCFDTLRTKEQLGYVVFSSSLNN 850

Query: 927 SDTVGLHITIMSD 939
             T  + I I S+
Sbjct: 851 HGTANIRILIQSE 863

>TBLA0I02940 Chr9 complement(699857..702754) [2898 bp, 965 aa] {ON}
           Anc_4.246 YLR389C
          Length = 965

 Score =  166 bits (421), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 87/241 (36%), Positives = 138/241 (57%), Gaps = 8/241 (3%)

Query: 7   KTFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDPRDIPGI 66
           KT++++F  P    +RN +   LPN +  LLI D +    A S+ V  G+  DP  +PG+
Sbjct: 6   KTYNLNFAKPD-LDDRNYRFIELPNSLKVLLIQDATTDKAAASLDVNIGAFEDPEGLPGL 64

Query: 67  AHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAIEQNTFG 126
           AH CEH++   GS+KYP    +   L+ N GS NA+T    T ++FE      I      
Sbjct: 65  AHFCEHLLFM-GSEKYPDENEYSSFLSTNGGSYNAYTGALNTNYFFE------INYEHLE 117

Query: 127 EILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSHPFHNFS 186
             LD FS FF +PLF++  T+KEI A++SE+  N+ +    +Y  ++ LSN+ HP+H FS
Sbjct: 118 GALDRFSGFFSRPLFSKDSTDKEINAVDSENKKNLQSDVWRMYQLDKSLSNRKHPYHKFS 177

Query: 187 TGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALANFGDIK 246
           TGNI TL  + N +  ++++ L +++ N+Y +  M + I G + L+ L   A + F D+K
Sbjct: 178 TGNIQTLGTIPNEQGLDIRDELLKFYNNSYSANLMKLTILGREDLDILGDWAYSMFKDVK 237

Query: 247 D 247
           +
Sbjct: 238 N 238

 Score = 57.0 bits (136), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 52/209 (24%), Positives = 97/209 (46%), Gaps = 22/209 (10%)

Query: 773 LLERKMWTLEERIDALELIDLEMFLEFAQKFFQNLFLSLYIEGNLEYAD------LINSY 826
           +++ + W+++E++  ++ +  E    F    F  ++    + GN E +D      L+  Y
Sbjct: 647 VIDDRAWSIKEKLSTMQKLTFEDLENFLPTIFNEVYFESLVHGNFEKSDAAEVNQLVEKY 706

Query: 827 FSDKLVHHLTKRLDYPKEDTLQSLPSTKLISGTNIYYELEGSVDDP---NNSIVYFIQTG 883
            S   +H+   R D  +   LQ   +          Y  E  ++DP   N+ I +  Q G
Sbjct: 707 ISGS-IHNPQIRNDRLRSYVLQKGET----------YRYETLLEDPENVNSCIQHVTQIG 755

Query: 884 DLSNKKILSLTSLTAFIISFSLVPELRNKKQIGYVVFGGLRTLSDTVGLHITIMSDGKPL 943
            L N ++ +L+SL A II+      LR K+Q+GYVVF        T  + I + S+    
Sbjct: 756 -LYNDRLAALSSLFAQIINEPCFNILRTKEQLGYVVFSSSLNNYGTTNIRILVQSEHTTE 814

Query: 944 DIEIEIEKYISYLEFDLLGNLDDETFQNN 972
            +E  I+++   ++  +L  +  ETF+N+
Sbjct: 815 YLEWRIDEFYKSVK-TILTQMAPETFENH 842

>YLR389C Chr12 complement(899577..902660) [3084 bp, 1027 aa] {ON}
           STE23Metalloprotease involved, with homolog Axl1p, in
           N-terminal processing of pro-a-factor to the mature
           form; expressed in both haploids and diploids; member of
           the insulin-degrading enzyme family
          Length = 1027

 Score =  166 bits (420), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 91/243 (37%), Positives = 139/243 (57%), Gaps = 8/243 (3%)

Query: 5   NTKTFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDPRDIP 64
           N KTF++DF  P     R+ +   LPN + ALLI D      A S+ V  G+  DP+++P
Sbjct: 56  NFKTFNLDFLKPD-LDERSYRFIELPNKLKALLIQDPKADKAAASLDVNIGAFEDPKNLP 114

Query: 65  GIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAIEQNT 124
           G+AH CEH++   GS+K+P    +   L+ + GS NA+T  + T ++FE+       Q+ 
Sbjct: 115 GLAHFCEHLLFM-GSEKFPDENEYSSYLSKHGGSSNAYTASQNTNYFFEVN-----HQHL 168

Query: 125 FGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSHPFHN 184
           FG  LD FS FF  PLFN+  T+KEI A+ SE+  N+ N    +Y  ++ L+N  HP+H 
Sbjct: 169 FG-ALDRFSGFFSCPLFNKDSTDKEINAVNSENKKNLQNDIWRIYQLDKSLTNTKHPYHK 227

Query: 185 FSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALANFGD 244
           FSTGNI TL  +      N+++ L ++ KN Y +  M +CI G + L++L+      F D
Sbjct: 228 FSTGNIETLGTLPKENGLNVRDELLKFHKNFYSANLMKLCILGREDLDTLSDWTYDLFKD 287

Query: 245 IKD 247
           + +
Sbjct: 288 VAN 290

 Score = 68.9 bits (167), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 128/639 (20%), Positives = 246/639 (38%), Gaps = 108/639 (16%)

Query: 351 IWCHIFGDETKGSFCDYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIID 410
           I  H+ G E  GS   +L K  W  E  A   T + GN    +++ LT+ G+   +++I 
Sbjct: 343 ILSHLIGHEGSGSLLAHLKKLGWANELSAGGHTVSKGNAFFAVDIDLTDNGLTHYRDVI- 401

Query: 411 ILLQQVVKLLVDNFTENLAYFLAENNIISILRFINSDVEINPMDECSELSGLLQENF--- 467
           +L+ Q +++L ++  +   +   ++   +  +F  +    +P    S L+  L++++   
Sbjct: 402 VLIFQYIEMLKNSLPQKWIFNELQDISNATFKFKQAG---SPSSTVSSLAKCLEKDYIPV 458

Query: 468 ---------KLFNPKYLFYGSEFLLLENESLPQKNNMFDGNSTTFWIGQAIKFQTFLKEF 518
                      + P  L   ++ L+ EN  +   +   + +S   W G A K   +  + 
Sbjct: 459 SRILAMGLLTKYEPDLLTQYTDALVPENSRVTLISRSLETDSAEKWYGTAYKVVDYPADL 518

Query: 519 MNWENIKIVGIGDIDEFKNVLNIVKEMSKKTDLYYEFEYQKLKISKKSRICPRDYPFTYP 578
           +  +N+K  G          LN    + +      EF     K+ K   I P D P    
Sbjct: 519 I--KNMKSPG----------LNPALTLPRPN----EFVSTNFKVDKIDGIKPLDEPV--- 559

Query: 579 IKNEYLPKFGYXXXXXXXXXXXXXESSRTVSFYMPQVSEEEDQNKLVSQNDMHKLWVNPK 638
                                                        L+  +D+ KLW   K
Sbjct: 560 ---------------------------------------------LLLSDDVSKLWYK-K 573

Query: 639 NSKDQLSESPCIVSFKL--VNNSIQESPESTMHLELMGQLLHTLLINKLYPALNVGYTFE 696
           + +         +SFKL   + SI  S  ST++ +L    L  +  +     L + +   
Sbjct: 574 DDRFWQPRGYIYLSFKLPHTHASIINSMLSTLYTQLANDALKDVQYDAACADLRISFN-- 631

Query: 697 ISPSVRGDVSLSFTLSGFSEGIFKIIK---ECINIFGELTSS-DLITKKEFRRARILVRD 752
                + +  L+ T SGF+E +  ++    + +N F       +++  K  R  + L+  
Sbjct: 632 -----KTNQGLAITASGFNEKLIILLTRFLQGVNSFEPKKDRFEILKDKTIRHLKNLL-- 684

Query: 753 KYEDAASDSCVKLASVGLLILLERKMWTLEERIDALELIDLEMFLEFAQKFFQNLFLSLY 812
            YE   S    ++++    I+ ER  W+  E++   E +  E  + F    ++ ++    
Sbjct: 685 -YEVPYS----QMSNYYNAIINERS-WSTAEKLQVFEKLTFEQLINFIPTIYEGVYFETL 738

Query: 813 IEGNLEYADLINSYFSDKLVHHLTKRLDYPKEDTLQSLPSTKLISGTNIYYELEGSVDDP 872
           I GN+++ + +     D L+  L     +  + +   L S  L  G    YE        
Sbjct: 739 IHGNIKHEEALEV---DSLIKSLIPNNIHNLQVSNNRLRSYLLPKGKTFRYETALKDSQN 795

Query: 873 NNSIVYFIQTGDLSNKKILSLTSLTAFIISFSLVPELRNKKQIGYVVFGGLRTLSDTVGL 932
            NS +  +   D+ ++ + +L+ L A +I       LR K+Q+GYVVF        T  +
Sbjct: 796 VNSCIQHVTQLDVYSEDLSALSGLFAQLIHEPCFDTLRTKEQLGYVVFSSSLNNHGTANI 855

Query: 933 HITIMSDGKPLDIEIEIEKYISYLEF-DLLGNLDDETFQ 970
            I I S+     +E  I  +  Y  F  +L ++ +E F+
Sbjct: 856 RILIQSEHTTPYLEWRINNF--YETFGQVLRDMPEEDFE 892

>NCAS0J01470 Chr10 complement(261880..264867) [2988 bp, 995 aa] {ON}
           Anc_4.246
          Length = 995

 Score =  166 bits (420), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 89/250 (35%), Positives = 144/250 (57%), Gaps = 8/250 (3%)

Query: 1   MSWINTKTFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDP 60
           M+  + K  ++ F  P     R+ +   LPN + ALLI+D      A S+ V  GS +DP
Sbjct: 25  MTAASYKNHNLSFQKPD-LDERSYRFIELPNKLKALLITDPKTDKAAASLDVNIGSFNDP 83

Query: 61  RDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAI 120
             +PG+AH CEH++   GS+K+P    +   L+ + G  NA+T    T ++FE+      
Sbjct: 84  EPLPGLAHFCEHLLFM-GSRKFPDENDYSSFLSKHGGHSNAYTGSSNTNYFFEINA---- 138

Query: 121 EQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSH 180
            ++ FG  LD FS FF  PLFN+  T+KEI A++SE+  N+ N    +Y  ++ LSN  H
Sbjct: 139 -EHLFGA-LDRFSGFFTGPLFNKNATDKEINAVDSENKKNLQNDLWRIYQLDKSLSNLKH 196

Query: 181 PFHNFSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALA 240
           P+H FSTGNI TL ++   +  N+++ L +++ ++Y +  M +CI G + L++L +    
Sbjct: 197 PYHKFSTGNIQTLKQLPESQGLNIRDELLKFYDDSYSANLMKLCIIGREDLDTLAQWTAD 256

Query: 241 NFGDIKDKDE 250
            F D+K+KD+
Sbjct: 257 LFNDVKNKDK 266

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 76/338 (22%), Positives = 143/338 (42%), Gaps = 22/338 (6%)

Query: 620 DQNKLVSQNDMHKLWVNPKNSKDQLSESPCIVSFKLVNN--SIQESPESTMHLELMGQLL 677
           ++  L+ + ++ KLW   K+ +         +SFKL +   S+  S  +T++++L+   L
Sbjct: 530 EEPHLLKETELGKLWYK-KDDRFWQPRGHIYISFKLPHTHLSLLNSMLTTLYVQLINDSL 588

Query: 678 HTLLINKLYPALNVGYTFEISPSVRGDVSLSFTLSGFSEGIFKIIKECINIFGEL-TSSD 736
             L  +     L+   T       + +  L  T+SGF++ +  ++   +        +SD
Sbjct: 589 KDLQYDASCANLHASLT-------KTNQGLDITVSGFNDKLIILLTRFLQGIKSFKPNSD 641

Query: 737 LITKKEFRRARILVRDKYEDAASDSCVKLASVGLLILLERKMWTLEERIDALELIDLEMF 796
                + +  + L    YE   S       S     L+  + WT  E++ AL+ I  +  
Sbjct: 642 RFQIFKDKTIQHLQNSLYEVPYSQMSTLYNS-----LINERTWTTTEKLSALDKISYDQL 696

Query: 797 LEFAQKFFQNLFLSLYIEGNLEYADLINSYFSDKLVHHLTKRLDYPKEDTLQSLPSTKLI 856
           L F    F+ L+    I GNL+Y + +      KL+      L+   ++    L S  L 
Sbjct: 697 LTFIPTIFEELYFESLIHGNLKYDEAMEIDSLVKLLLTENNILNLQIQN--DKLRSYILP 754

Query: 857 SGTNIYYELEGSVDDPN--NSIVYFIQTGDLSNKKILSLTSLTAFIISFSLVPELRNKKQ 914
            G    YE +  + DP   NS +  +   D+ ++++ +  +L A +I       LR K+Q
Sbjct: 755 KGKTFRYETD--LKDPKNVNSCIQHVTQIDIYSEELSAKCALFAQMIHEPCFDTLRTKEQ 812

Query: 915 IGYVVFGGLRTLSDTVGLHITIMSDGKPLDIEIEIEKY 952
           +GYVVF        T  + I + S+     +E  I+ +
Sbjct: 813 LGYVVFSSTLNNHGTANIRILVQSEKSTPYLEWRIDNF 850

>TDEL0E01250 Chr5 (243919..246906) [2988 bp, 995 aa] {ON} Anc_4.246
           YLR389C
          Length = 995

 Score =  165 bits (418), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 116/430 (26%), Positives = 201/430 (46%), Gaps = 62/430 (14%)

Query: 7   KTFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDPRDIPGI 66
           K  + DF  P    +R+ +  +LPN + AL+I D +   +A ++ V  G+ SDP ++PG+
Sbjct: 34  KQLESDFIKPD-LDDRSYRFIQLPNDLKALIIQDPTTDKSAAALDVNIGAFSDPEELPGL 92

Query: 67  AHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAIEQNTFG 126
           AH CEH++   GS+K+P    +   L+ + GS NA+T  + T +YF+      +      
Sbjct: 93  AHFCEHLLFM-GSRKFPDENEYSSFLSKHGGSSNAYTGAQNTNYYFQ------VNHEHLK 145

Query: 127 EILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSHPFHNFS 186
             LD FS FF  PLF++  T+KEI A++SE+  N+ N    LY  ++ LSN SHP+H FS
Sbjct: 146 GALDRFSGFFTGPLFSKDSTDKEINAVDSENKKNLQNDIWRLYQLDKSLSNPSHPYHKFS 205

Query: 187 TGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALANFGDIK 246
           TGN+ TL+++   K  +++  L  ++   Y +  M +C+ G + L++L+  A   F D+ 
Sbjct: 206 TGNLKTLNEIPKSKGVDVRNELLNFYSKYYSANLMKLCVLGREDLDTLSDWAYELFSDVP 265

Query: 247 DKDELTKFHINSIKPQXXXXXXXXXXXXXXCNSFKTNENLDLENFKLLDNAWLDKYGDNV 306
                     N  +P                  F+ +         +LD A+L K+    
Sbjct: 266 ----------NLPRP---------------APEFEAS---------ILDGAYLKKF---- 287

Query: 307 CFPTSLSHNTIFLSSSKQPI-LRLLFPISEKLTRFTKRDIKIYSNIWCHIFGDETKGSFC 365
                     I +   K    L + F + +    +  +   I S++     G E  GS  
Sbjct: 288 ----------IHVKPVKDLTKLEVTFVVPDVEDHWESKPNHILSHL----IGHEGSGSLL 333

Query: 366 DYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIIDILLQQVVKLLVDNFT 425
            +L    W  E  A   T +  N    +++ LT+ G+K  +++   +  Q +++L ++  
Sbjct: 334 AHLKSLGWANELSAGGHTVSKSNAFFCIDIDLTDEGLKHHEDVTHTIF-QYIEMLKNSLP 392

Query: 426 ENLAYFLAEN 435
           E   Y   E+
Sbjct: 393 EEWIYLELED 402

 Score = 55.8 bits (133), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 88/203 (43%), Gaps = 10/203 (4%)

Query: 773 LLERKMWTLEERIDALELIDLEMFLEFAQKFFQNLFLSLYIEGNLEY--ADLINSYFSDK 830
           L+  + WT EE+++ +E +  E    F    F+ +F    + GN++Y  AD I     D 
Sbjct: 675 LVNERSWTAEEKLEVVEQLTFEQLEAFIPTIFEEMFFETLVHGNIKYEEADQI-----DS 729

Query: 831 LVHHLTKRLDYPKEDTLQSLPSTKLISGTNIYYELE-GSVDDPNNSIVYFIQTGDLSNKK 889
           L+  L        +     + S  L  G    YE +     + N+ I Y IQ G + ++ 
Sbjct: 730 LIQMLRSNSVSNSQIKNARIRSYVLPLGKTHRYEAKLADTQNVNSCIQYVIQLG-VYDEA 788

Query: 890 ILSLTSLTAFIISFSLVPELRNKKQIGYVVFGGLRTLSDTVGLHITIMSDGKPLDIEIEI 949
           + ++  L A ++       LR K+Q+GYVVF        T  + I I S+     +E  I
Sbjct: 789 LSAIGRLFAQMLHEPCFDTLRTKEQLGYVVFSSSLNNHGTANIRILIQSEHTTPYLEWRI 848

Query: 950 EKYISYLEFDLLGNLDDETFQNN 972
           E ++       L  + D  F+N+
Sbjct: 849 ESFLEQFG-KTLKEMSDRDFENH 870

>KNAG0B06080 Chr2 complement(1197765..1200755) [2991 bp, 996 aa]
           {ON} Anc_4.246 YLR389C
          Length = 996

 Score =  162 bits (409), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 84/238 (35%), Positives = 137/238 (57%), Gaps = 7/238 (2%)

Query: 12  DFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDPRDIPGIAHLCE 71
           D +L     +R+ +  +LPN + ALLISD +    A ++ V  G+  DP ++PG+AH CE
Sbjct: 35  DTFLQPDLDDRSYRYVQLPNNLKALLISDPTTDKAAAALDVNIGAFEDPEELPGLAHFCE 94

Query: 72  HMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAIEQNTFGEILDI 131
           H++   GS K+P    +   L+ + GS NA+T  + T +YF++       ++ +G  LD 
Sbjct: 95  HLLFM-GSSKFPNENEYSSYLSKHGGSSNAYTGAQNTNYYFQVNY-----EHLYG-ALDR 147

Query: 132 FSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSHPFHNFSTGNIH 191
           FS FF  PLFN+  T+KEI A++SE+  N+ N    LY  ++ L+N  HP+H FSTGN+ 
Sbjct: 148 FSGFFTGPLFNKESTDKEINAVDSENKKNLQNDLWRLYQLDKSLTNGGHPYHKFSTGNLE 207

Query: 192 TLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALANFGDIKDKD 249
           TL         ++++ L +++  +Y +  M +CI G + L+++TK     F D+K  D
Sbjct: 208 TLGTTPKELGLDIRDELLKFYNKSYSANLMKLCILGREDLDTMTKWVEELFQDVKTLD 265

 Score = 64.7 bits (156), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 88/357 (24%), Positives = 157/357 (43%), Gaps = 36/357 (10%)

Query: 624 LVSQNDMHKLWVNPKNSKDQLSESPCIVSFKL--VNNSIQESPESTMHLELMGQLLHTLL 681
           L+S+N+  K+W   K+ +         ++FKL   + S   S  ST++++L+   L  L 
Sbjct: 538 LISENETGKVWFK-KDDRFWQPRGYIYLTFKLPHTHASALNSMLSTLYVQLINDSLKDLQ 596

Query: 682 INKLYPALNVGYTFEISPSVRGDVSLSFTLSGFSEGIFKIIK---ECINIFG-ELTSSDL 737
            N     L   +       V+ +  L  TL GF++ +  ++    E I  F  E     +
Sbjct: 597 YNANCANLRASF-------VKTNQGLDLTLYGFNDKLIILLTRLLEGIKSFKLEQPQFKI 649

Query: 738 ITKKEFRRARILVRDKYEDAASDSCVKLASVGLLILLERKMWTLEERIDALELIDLEMFL 797
              K  +  + L+   YE   S    ++++V   ++ ER  W++EE++D +E I  E  +
Sbjct: 650 FKDKSVQHLKNLM---YEVPYS----QISTVYNYLINERS-WSVEEKLDVMEKITYEELI 701

Query: 798 EFAQKFFQNLFLSLYIEGNLEYADLINSYFSDKLVHHLTKRLDYPKEDTLQS----LPST 853
            F    F+ L+    I GNL+Y + +        +  L K L       LQ+    + S 
Sbjct: 702 NFIPTIFEELYFEALIHGNLKYEEAME-------IASLVKILQPSDVTRLQTKNSRMRSY 754

Query: 854 KLISGTNIYYELEGSVDDPNNSIVYFIQTGDLSNKKILSLTSLTAFIISFSLVPELRNKK 913
            +  G    YE +       NS + ++   D+ ++K+ + + L A +I       LR K+
Sbjct: 755 LIPRGETYRYETKLKDAKNVNSCIQYVTQLDVYDEKLSAKSGLFAQMIHEPCFDTLRTKE 814

Query: 914 QIGYVVFGGLRTLSDTVGLHITIMSDGKPLDIEIEIEKYISYLEF-DLLGNLDDETF 969
           Q+GYVVF        T  + I I S+     +E  I+ +  Y +F +LL  + +E F
Sbjct: 815 QLGYVVFSSSLNNHGTANMRILIQSEHTTPYLEFRIDTF--YQKFGELLNAMSEEDF 869

 Score = 40.4 bits (93), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 38/81 (46%), Gaps = 1/81 (1%)

Query: 350 NIWCHIFGDETKGSFCDYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNII 409
           +I  H+ G E  GS   YL    W  E  A   T + GN    +++ LT+ G+   + ++
Sbjct: 315 HILSHLIGHEGTGSLLAYLKTKGWANELSAGGHTVSKGNAFFSVDIDLTDDGLAHYEEVV 374

Query: 410 DILLQQVVKLLVDNFTENLAY 430
             +  Q +K+L +   +N  +
Sbjct: 375 HNVF-QYIKMLQNCLPQNWVF 394

>AER053C Chr5 complement(735402..738443) [3042 bp, 1013 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR389C
           (STE23)
          Length = 1013

 Score =  159 bits (403), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 82/243 (33%), Positives = 133/243 (54%), Gaps = 8/243 (3%)

Query: 21  NRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDPRDIPGIAHLCEHMILAAGSK 80
           +R  +   LPN +  LL+ D +   +A S+ V  G+  DP D+PG+AH CEH++   GSK
Sbjct: 66  DRKYRYIELPNHLRVLLVHDKNTDKSAASLDVNVGAFEDPEDLPGLAHFCEHLLFM-GSK 124

Query: 81  KYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAIEQNTFGEILDIFSSFFKKPL 140
           K+P    +   L+ + G+ NA+T  + T +YF       +      + LD FS FF  PL
Sbjct: 125 KFPNENEYASFLSKHGGASNAYTASQNTNYYFH------VNHENLYDALDRFSGFFSCPL 178

Query: 141 FNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSHPFHNFSTGNIHTLSKVVNLK 200
           FNE  T KEI A++SE+  N+ N    LY   + L+N  HP+H FSTGN  TL  +   K
Sbjct: 179 FNESSTEKEIKAVDSENKKNLQNDMWRLYQLGKSLTNPIHPYHKFSTGNFETLWSIPRSK 238

Query: 201 KYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALANFGDIKDKD-ELTKFHINSI 259
             N+++ L +++  +Y +  M + I G + L++L + A   F D+ +   ++ ++H  + 
Sbjct: 239 GVNVRDELLKFYNRSYSANLMKLVILGREDLDTLAQWAYELFKDVPNHGTKVPEYHAQAF 298

Query: 260 KPQ 262
            P+
Sbjct: 299 TPE 301

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 79/180 (43%), Gaps = 7/180 (3%)

Query: 773 LLERKMWTLEERIDALELIDLEMFLEFAQKFFQNLFLSLYIEGNLEYADLINSYFSDKLV 832
           L+  + WT +E++D  E +  +    F    ++ ++  L + GN  + + +  Y    LV
Sbjct: 695 LINERSWTTQEKLDITEQLTFDHLANFVPTIYEQMYFELLVHGNFSHEEALEVY---DLV 751

Query: 833 HHLTKRLDYPKEDTLQSLPSTKLISGTNIYYELE-GSVDDPNNSIVYFIQTGDLSNKKIL 891
             L        E     L S  + +G   +YE      ++ N+ I   IQ G  S  ++L
Sbjct: 752 SSLVPNEIRNSEGRNSKLRSYFIPAGGAYHYETALADKENVNSCIQKVIQLGAYS--ELL 809

Query: 892 SLT-SLTAFIISFSLVPELRNKKQIGYVVFGGLRTLSDTVGLHITIMSDGKPLDIEIEIE 950
           S   SL A +++      LR ++Q+GYVVF        TV L I + S+     +E  I+
Sbjct: 810 SAKGSLLAQMVNEPCFNTLRTEEQLGYVVFSSKLNTHGTVNLRILVQSERSSSYLESRID 869

 Score = 37.7 bits (86), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 40/189 (21%), Positives = 75/189 (39%), Gaps = 20/189 (10%)

Query: 354 HIFGDETKGSFCDYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIIDILL 413
           H+ G E   S   YL  N+W  +  A  +T + GN    + + LT+ GV + + +I  + 
Sbjct: 341 HLIGHEGTDSLLAYLKNNSWAIDLSAGATTVSEGNAYFSVNVDLTDEGVVQYEAVICAVF 400

Query: 414 QQVVKLLVDNFTENLAYFLAENNIISILRFINSDVEINPMDECSELSGLLQENF------ 467
            Q + +L +   +   +   ++   +  +F       NP    S LS  LQ+ +      
Sbjct: 401 -QYINMLKEVLPQEWVFTELKDIGEAHFKFKQKG---NPAATVSSLSKNLQKAYLPVQVI 456

Query: 468 ------KLFNPKYLFYGSEFLLLENESLPQKNNMFDGNSTTFWIGQAIKFQTFLKEFMNW 521
                 + + P  +      L LEN  +   +   + N +  W G       + K+F++ 
Sbjct: 457 LNTSLMRQYEPGLIMEYLNSLTLENSRVMLISQKVETNLSERWYGTEYSVADYTKDFVS- 515

Query: 522 ENIKIVGIG 530
              KI  +G
Sbjct: 516 ---KIRSLG 521

>KLTH0D14278g Chr4 complement(1172523..1175528) [3006 bp, 1001 aa]
           {ON} similar to uniprot|Q06010 Saccharomyces cerevisiae
           YLR389C STE23 Metalloprotease involved with homolog
           Axl1p in N-terminal processing of pro-a-factor to the
           mature form member of the insulin-degrading enzyme
           family
          Length = 1001

 Score =  159 bits (401), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 80/243 (32%), Positives = 135/243 (55%), Gaps = 8/243 (3%)

Query: 21  NRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDPRDIPGIAHLCEHMILAAGSK 80
           +RN +   LPN + ALLI D +    A ++ V  GS  DP D+PG+AH CEH++   GS 
Sbjct: 55  DRNYRFIELPNKLKALLIQDPTTDKAAAALDVNVGSFEDPEDLPGLAHFCEHLLFM-GSS 113

Query: 81  KYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAIEQNTFGEILDIFSSFFKKPL 140
           K+P    +   L+ + G  NA+T+   T ++F+      + Q +    L  FS FF  PL
Sbjct: 114 KFPNENEYSSYLSKHGGGSNAYTSARNTNYFFQ------VNQESLHGALLRFSGFFSCPL 167

Query: 141 FNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSHPFHNFSTGNIHTLSKVVNLK 200
           FN+  T+KEI A++SE+  N+ +    LY  ++  SN  HPFH FSTGN+ TL  +   K
Sbjct: 168 FNKESTDKEINAVDSENKKNLQSDLWRLYQLDKSQSNPEHPFHKFSTGNLKTLGDIPKSK 227

Query: 201 KYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALANFGDIKDKDE-LTKFHINSI 259
             ++++ L +++ ++Y +  M +C+ G + L+++++     F D+ + D  +  +    +
Sbjct: 228 DVDIRDELLKFYDSSYSANLMKLCVLGREDLDTMSQWVYDLFKDVPNSDRPVPTYEAKML 287

Query: 260 KPQ 262
            PQ
Sbjct: 288 PPQ 290

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 99/461 (21%), Positives = 186/461 (40%), Gaps = 58/461 (12%)

Query: 624  LVSQNDMHKLWVNPKNSKDQLSESPCIVSFKLVN--NSIQESPESTMHLELMGQLLHTLL 681
            L+ Q+   K+W   K+ +  + +    VS KL +  +S+  S  +T+++EL+   L  L 
Sbjct: 544  LLKQDRQSKVWYK-KDDRFWVPKGHIYVSMKLAHTYSSVVNSMLTTLYVELINDYLKDLE 602

Query: 682  INKLYPALNVGYTFEISPSVRGDVSLSFTLSGFSEGIFKIIKECINIFGELT-SSDLITK 740
             +    +L++ +        + +  L  +LSG++E +  ++K  +        + D    
Sbjct: 603  YDAQVASLHISFR-------KTNQGLDLSLSGYNEKMAILLKRYLEGIANFQPAEDRFKI 655

Query: 741  KEFRRARILVRDKYEDAASDSCVKLASVGLLILLERKMWTLEERIDALELIDLEMFLEFA 800
             + +  + L    YE   S       SV     +  + WT+  +++ ++ +  E    F 
Sbjct: 656  YQDKLLQKLNNHLYEVPYSQVSDVFNSV-----INERAWTIANKLEVVKQLKFEHLKLFI 710

Query: 801  QKFFQNLFLSLYIEGNLEYADLINSYFSDKLVHHLTKRLDYPKEDTLQSLPSTKLISGTN 860
               F+     + + GN      + +   D LV  L  R D        S P + L+    
Sbjct: 711  PAIFEQFSFEILVHGNFSCEAALEA---DNLVRALAPR-DVQNFQLKSSKPRSVLLPQGK 766

Query: 861  IYYELEGSVDDPN--NSIVYFIQTGDLSNKKILSLTSLTAFIISFSLVPELRNKKQIGYV 918
             +   +   DD N  + I +  Q G  S +++ +  SL A +I       LR K+Q+GYV
Sbjct: 767  TFCYQQMLADDKNINSCIQHVTQFGSYS-EELSAKASLFAQLIDEPAFDTLRTKEQLGYV 825

Query: 919  VFGGLRTLSDTVGLHITIMSDGKPLDIEIEIEKYISYLEFDLLGNLDDETFQNNYLIKYI 978
            VF        TV L + I S+     +E  I+ ++  +   +L  + DE F+ + +    
Sbjct: 826  VFSSALNTHGTVNLRLLIQSERDTAYLESRIDAFLVKMG-QVLQEMSDEEFERHKVALCK 884

Query: 979  DLINGIYKKSTEQTSGPINIMNEIIANVHGGDSAILNSEXXXXXXXXXXELFGDAQMTEE 1038
             L+   YK  +E+ +            ++ GD   +N E               A + E+
Sbjct: 885  TLLQR-YKNLSEENT-------RFTTAIYIGDYNFINKERK-------------ASLVEK 923

Query: 1039 LKYVDIEFLKNLNLIKYLQFFKGSISTNSKRRSKLSIHIKS 1079
            L   D+           L+F+   + T  +  SKL IH+KS
Sbjct: 924  LSKQDM-----------LEFYSQYVVT--EEASKLVIHLKS 951

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 49/114 (42%), Gaps = 4/114 (3%)

Query: 354 HIFGDETKGSFCDYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIIDILL 413
           H+ G E  GS   YL    W  E  A   T +  N    +++ LT+ GVK  +++I  + 
Sbjct: 330 HLIGHEGSGSLLAYLKLKGWANELSAGSHTVSEDNAFFSVDIDLTDEGVKNYESVIQSVF 389

Query: 414 QQVVKLLVDNFTENLAYFLAENNIISILRFINSDVEINPMDECSELSGLLQENF 467
            Q ++LL     +   Y    +   +  +F       NP    S LS  L++++
Sbjct: 390 -QYIELLKKELPQEWIYEELRDTAEASFKFKQKG---NPASTVSSLSKALEKDY 439

>CAGL0H06457g Chr8 (633721..636747) [3027 bp, 1008 aa] {ON} highly
           similar to uniprot|Q06010 Saccharomyces cerevisiae
           YLR389c STE23
          Length = 1008

 Score =  159 bits (401), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 82/236 (34%), Positives = 135/236 (57%), Gaps = 7/236 (2%)

Query: 14  YLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDPRDIPGIAHLCEHM 73
           +L     +R  +  +LPN + AL+I D +    A ++ V  G+  DP ++PG+AH CEH+
Sbjct: 53  FLKPDLDDRQYRYIQLPNNLKALIIQDATTDKAAAALDVNIGAFQDPENLPGLAHFCEHL 112

Query: 74  ILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAIEQNTFGEILDIFS 133
           +   GS+K+P    +   L+ + GS NA+T  + T ++FE      +  +     LD FS
Sbjct: 113 LFM-GSEKFPDENEYSSYLSKHGGSSNAYTGSQNTNYFFE------VNADHLHGALDRFS 165

Query: 134 SFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSHPFHNFSTGNIHTL 193
            FF  PLFN+  T+KEI A++SE+  N+ N    +Y  ++ LSN+ HP+H FSTGN+ TL
Sbjct: 166 GFFSCPLFNQNSTDKEINAVDSENKKNLQNDIWRMYQLDKSLSNQDHPYHKFSTGNLETL 225

Query: 194 SKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALANFGDIKDKD 249
                    +++E L +++  NY +  M +CI G + L++L++ A   F D+K+ D
Sbjct: 226 GDKPKAAGLDIREELLKFYNENYSANLMKLCILGKEDLDTLSEWAWELFKDVKNSD 281

 Score = 65.1 bits (157), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 82/364 (22%), Positives = 163/364 (44%), Gaps = 31/364 (8%)

Query: 615 VSEEEDQNKLVSQNDMHKLWVNPKNSKDQLSESPCIVSFKLVN--NSIQESPESTMHLEL 672
           V E  ++  L+  +D+ KLW   K+ +         V+ KL N  +SI  S  +T+++++
Sbjct: 541 VKEPLNEPLLLKDDDVSKLWYK-KDDRFWQPRGYIYVTLKLPNTHSSIISSMLTTLYVQM 599

Query: 673 MGQLLHTLLINKLYPALNVGYTFEISPSVRGDVSLSFTLSGFSEGIFKIIKECINIFGEL 732
           +   L  L  +     +N+ +       V+ +  L  T+SGF+E +  ++K  +      
Sbjct: 600 VNDALKDLQYDAACANINLSF-------VKTNQGLDITISGFNEKLLILLKRFV------ 646

Query: 733 TSSDLITKKEFRRARILV-RDKYEDAASDSCVKLASVGLLIL----LERKMWTLEERIDA 787
              + +   E ++ R  V +DK      +  +++    +  L    +  + W  +E+++ 
Sbjct: 647 ---EGVQGFEPKKERFEVFKDKTVHHLKNQMMEVPYSQISGLYNSVVNERTWPTKEKLEV 703

Query: 788 LELIDLEMFLEFAQKFFQNLFLSLYIEGNLEYADLINSYFSDKLVHHLTKRLDYPKEDTL 847
            E +  E    F +  +  ++   ++ GNLE  +   +   D LV    K+ D    D  
Sbjct: 704 AEKLKFEQLDNFVRAIYDGMYYESFVHGNLESKE---AREVDSLVSTFLKKDDIKNIDVQ 760

Query: 848 QS-LPSTKLISGTNIYYELEGSVDDPNNSIVYFIQTGDLSNKKILSLTSLTAFIISFSLV 906
            + L S  +  G +  YE +   ++  NS +  +   D+ N+K+ +L+ L A ++     
Sbjct: 761 SNRLRSYIIPKGKSYAYETDLYDENNVNSCIQHVVQLDVYNEKLSALSGLFAQMLHEPCF 820

Query: 907 PELRNKKQIGYVVFGGLRTLSDTVGLHITIMSDGKPLDIEIEIEKYISYLEF-DLLGNLD 965
             LR K+Q+GYVVF        T  + I + S+     +E  I+++  Y  F + L N+D
Sbjct: 821 DILRTKEQLGYVVFSSSLNNHGTANIRILVQSEHTTPYLEWRIDEF--YKTFGEKLRNMD 878

Query: 966 DETF 969
           +E F
Sbjct: 879 EEDF 882

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 36/66 (54%)

Query: 349 SNIWCHIFGDETKGSFCDYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNI 408
           S+I+ H+ G E  GS   +L    W  E  A   T + GN    ++++LTN G+K  ++I
Sbjct: 330 SHIFSHLIGHEGSGSLLAHLKSLGWANELGAGGHTVSDGNAFFNVDIELTNEGLKHYKDI 389

Query: 409 IDILLQ 414
           + ++ Q
Sbjct: 390 VVLIFQ 395

>KAFR0A05970 Chr1 (1206007..1209042) [3036 bp, 1011 aa] {ON}
           Anc_4.246 YLR389C
          Length = 1011

 Score =  157 bits (397), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 83/241 (34%), Positives = 137/241 (56%), Gaps = 8/241 (3%)

Query: 7   KTFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDPRDIPGI 66
           K F ++F  P    +R+ +  +LPN + AL+I D +    A ++ V  G+  DP  +PG+
Sbjct: 48  KDFKLNFIKPD-LDDRSYRFIKLPNNLKALVIQDPTADKAAAALDVNIGAFEDPEHLPGL 106

Query: 67  AHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAIEQNTFG 126
           AH CEH++   GS+K+P    +   L+ + GS NA+T+   T +YFE      +      
Sbjct: 107 AHFCEHLLFM-GSEKFPDENEYSSFLSKHGGSSNAYTSSLNTNYYFE------VNHEHLY 159

Query: 127 EILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSHPFHNFS 186
             LD FS FF  PLFN+  T+KEI A++SE+  N+ N    +Y  ++ LSN  HP+H FS
Sbjct: 160 NALDRFSGFFTCPLFNKGSTDKEISAVDSENKKNLQNDVWRIYQLDKSLSNLQHPYHKFS 219

Query: 187 TGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALANFGDIK 246
           TGN+ TL +       N+++ L +++ ++Y +  M +CI G + L++L+  A   F D++
Sbjct: 220 TGNLITLGENPKSLNLNIRDELLKFYYHSYSANLMKLCIIGREDLDTLSNWAYKLFKDVR 279

Query: 247 D 247
           +
Sbjct: 280 N 280

 Score = 65.5 bits (158), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 89/367 (24%), Positives = 156/367 (42%), Gaps = 54/367 (14%)

Query: 624 LVSQNDMHKLWVNPKNSKDQLSESPCIVSFKL--VNNSIQESPESTMHLELMGQLLHTLL 681
           L+    + KLW   K+ +         VS KL   + S+  S  ST++++L    L  L 
Sbjct: 550 LLKDTKLSKLWFK-KDDRFWQPRGYIYVSLKLPHTHASVLNSMLSTIYVQLANDFLKDLQ 608

Query: 682 INKLYPALNVGYTFEISPSVRGDVSLSFTLSGFSEGI-------------FKIIKECINI 728
            +     LN+ +       V+ +  L  TLSGF++ +             FK  +E   I
Sbjct: 609 YDASCANLNLSF-------VKTNQGLDITLSGFNDKLVTLMTRFLQGVKDFKPTEERFKI 661

Query: 729 FGELTSSDLITKKEFRRARILVRDKYEDAASDSCVKLASVGLLILLERKMWTLEERIDAL 788
           F + T+  L          +L    Y         +++ V   ++ ER  W++EE+++ +
Sbjct: 662 FKDKTTQHL--------KNLLYEVPYS--------QISGVYNSLINERS-WSVEEKLNVV 704

Query: 789 ELIDLEMFLEFAQKFFQNLFLSLYIEGNLEYADLIN--SYFSDKLVHHLTKRLDYPKEDT 846
           E I  E  L F    F+ L+    + GNL++ + I   S  +D L+ +        K + 
Sbjct: 705 EHITFEQLLAFIPTVFEELYYETLVHGNLKFEEAIEIESLINDILITNENHNNLQVKNNR 764

Query: 847 LQS--LPSTKLISGTNIYYELEGSVDDPNN--SIVYFIQTGDLSNKKILSLTSLTAFIIS 902
           L+S  +P  K        Y  E  + D  N  S +  +   D+ N+++ +L+ L A +I 
Sbjct: 765 LRSYFIPKGKT-------YRFEKELKDSKNVNSCIQHVTQLDVYNEELSALSGLFAQMIH 817

Query: 903 FSLVPELRNKKQIGYVVFGGLRTLSDTVGLHITIMSDGKPLDIEIEIEKYISYLEFDLLG 962
                 LR K+Q+GYVVF        T  + I + S+     +E  IE++ S     +L 
Sbjct: 818 EPCFDTLRTKEQLGYVVFSSSLNNHGTANIRILVQSEHTTPYLEWRIEEFYSKFG-AILK 876

Query: 963 NLDDETF 969
           ++ +E F
Sbjct: 877 DMSEEDF 883

>NDAI0J02240 Chr10 complement(547488..550487) [3000 bp, 999 aa] {ON}
           Anc_4.246
          Length = 999

 Score =  157 bits (397), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 90/259 (34%), Positives = 141/259 (54%), Gaps = 8/259 (3%)

Query: 1   MSWINTKTFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDP 60
           MS  N    + DF  P    +R+ +   LPN + ALLISD +    A S+ V  G+  DP
Sbjct: 30  MSNKNYTILNQDFQKPD-LDDRSYRFIELPNKLKALLISDPTTDKAAASLDVNIGAFEDP 88

Query: 61  RDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAI 120
             +PG+AH CEH++   GS+K+P    +   L+ + G  NA+T  + T ++FE      I
Sbjct: 89  ESLPGLAHFCEHLLFM-GSEKFPDENDYSSFLSKHGGHSNAYTGSQNTNYFFE------I 141

Query: 121 EQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSH 180
                   LD FS FF  PLFN   T+KEI A++SE+  N+ +    +Y  ++ LS   H
Sbjct: 142 NYEHLKGALDRFSGFFSCPLFNIGSTDKEINAVDSENKKNLQSDMWRIYQLDKSLSLLDH 201

Query: 181 PFHNFSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALA 240
           P+H FSTGN+ TL  +   K  N+++ L +++  NY +  M +CI G + L++L+    +
Sbjct: 202 PYHKFSTGNLETLKIIPESKNVNVRDELLKFYNANYSANLMKLCIIGREDLDTLSDYVQS 261

Query: 241 NFGDIKDKDELTKFHINSI 259
            F D+K+ D+   F+ + I
Sbjct: 262 FFKDVKNIDKELPFYDSKI 280

 Score = 68.2 bits (165), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 150/649 (23%), Positives = 255/649 (39%), Gaps = 123/649 (18%)

Query: 350 NIWCHIFGDETKGSFCDYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNII 409
           +I  H+ G E  GS   +L    W  E  A   T + GN    +++ LT  G+K  + +I
Sbjct: 320 HILSHLIGHEGNGSLLSHLKTLGWANELSAGGHTVSRGNAFFSIDIDLTENGLKNYEQVI 379

Query: 410 DILLQQVVKLLVDNFTENLAYFLAENNIISILRFINSDVEINPMDECSELSGLLQENFKL 469
            +L  Q +++L ++  +   Y   +N   +  +F       NP    S LS LL      
Sbjct: 380 -LLAFQYIEMLKNSLPQKWIYLELQNIANANFKFKQKG---NPSSTVSSLSKLL------ 429

Query: 470 FNPKYLFYGSEFLLLENESLPQKNNMFDGNSTTFWIGQAIKFQTFLKEFMNWENIKIVGI 529
                          E E +P  N +  G    F   +    + +L E M + N +I  I
Sbjct: 430 ---------------EKEYIPVGNILSTG---LFNKYEPELVEKYLSE-MIYSNSRITLI 470

Query: 530 GDIDEFKNVLNIVKEMSKKTDLYYEFEYQKLKISKKSRICPRDYPFTYPIKNEYLPKFGY 589
                 KN+    KE    T   Y+ E   + +  K +    +  F  P  NE++     
Sbjct: 471 S-----KNLETDSKEKWYGTK--YKLEDYSVDLINKIKTPGLNPNFHLPRPNEFIAD--- 520

Query: 590 XXXXXXXXXXXXXESSRTVSFYMPQVSEEED-----QNKLVSQNDMHKLWVNPKNSKDQL 644
                              +F++ +   E D     +  L+    M KLW   K+ +   
Sbjct: 521 -------------------NFHVDKPKNESDIIPLEEPLLLKDTSMGKLWYK-KDDRFWQ 560

Query: 645 SESPCIVSFKL--VNNSIQESPESTMHLELMGQLLHTLLINKLYPALNVGYTFEISPSVR 702
                 +SFKL   ++++  S  +T++++++   L  L  +     L+V     +S + +
Sbjct: 561 PRGYIKISFKLPHTHSTLLNSMLTTLYVQMVNDSLKDLQYDASCANLHVS----LSKTNQ 616

Query: 703 G-DVSLS-------FTLSGFSEGI--FKIIKECINIFGELTSSDLITKKEFRRARILVRD 752
           G D+SLS         L+ F +GI  FK   E   IF + T             + L   
Sbjct: 617 GLDISLSGFNDKLIILLTRFLQGIKDFKPTSERFQIFKDKT------------IQHLKNS 664

Query: 753 KYEDAASDSCVKLASVGLLILLERKMWTLEERIDALELIDLEMFLEFAQKFFQNLFLSLY 812
            YE   S    +++S+    L+  K W  EE+++ +  + L+    F    F  LF   +
Sbjct: 665 MYEVPYS----QMSSL-YNALINEKTWLPEEKLNMMNKLTLDQLNSFIPFIFDELFFECF 719

Query: 813 IEGNLEYADLINSYFSDKLVHHLTKRLDYPKEDTLQS-----------LPSTKLISGTNI 861
           + GNL+Y + I        +  L   L   KE+   S           LP  K    T  
Sbjct: 720 VHGNLKYDEAIE-------IESLIDLLMSSKENLTNSQYENEKLRSYLLPKNK----TYR 768

Query: 862 YYELEGSVDDPNNSIVYFIQTGDLSNKKILSLTSLTAFIISFSLVPELRNKKQIGYVVFG 921
           Y  L     + N+ I + IQ  D+ ++++ ++  L A ++       LR K+Q+GYVVF 
Sbjct: 769 YETLLKDRKNVNSCIQHVIQV-DIYSEELSAICGLFAQMLHEPCFDTLRTKEQLGYVVFS 827

Query: 922 GLRTLSDTVGLHITIMSDGKPLDIEIEIEKYISYLEF-DLLGNLDDETF 969
                  T  + I + S+     +E  I+++  Y +F DLL  + DE F
Sbjct: 828 STLNNHGTANIRILVQSEKSTPYLEWRIDEF--YKKFGDLLNGMSDEDF 874

>KLLA0E05105g Chr5 (447645..450659) [3015 bp, 1004 aa] {ON} similar
           to uniprot|Q06010 Saccharomyces cerevisiae YLR389C STE23
           Metalloprotease involved with homolog Axl1p in
           N-terminal processing of pro-a-factor to the mature form
           member of the insulin-degrading enzyme family
          Length = 1004

 Score =  157 bits (397), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 85/232 (36%), Positives = 128/232 (55%), Gaps = 7/232 (3%)

Query: 14  YLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDPRDIPGIAHLCEHM 73
           +L     +R  +  +LPN + ALLISD      A ++ V  GS  DP  +PG+AH CEH+
Sbjct: 52  FLKPDLDDRKYRYIQLPNNLKALLISDAEADKAAAALDVNIGSFQDPEHLPGLAHFCEHL 111

Query: 74  ILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAIEQNTFGEILDIFS 133
           +   G++KYP    +   L+ + GS NA+T  + T +YF L              LD FS
Sbjct: 112 LFM-GNEKYPDENDYSSFLSKHGGSSNAYTGSQNTNYYFHL------NHENLYPALDRFS 164

Query: 134 SFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSHPFHNFSTGNIHTL 193
            FF  PLFN+  T+KEI A++SE+  N+ N    +Y  ++ L+N  HP+H FSTGNI TL
Sbjct: 165 GFFSCPLFNKASTDKEINAVDSENKKNLQNDIWRMYQLDKSLTNWEHPYHKFSTGNIKTL 224

Query: 194 SKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALANFGDI 245
             +  LK  +++  L ++ KNNY +  M +C+ G + L++L       F D+
Sbjct: 225 GDIPKLKGIDIRNELLDFHKNNYSANLMKLCVLGREDLDTLADWVYELFKDV 276

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 54/202 (26%), Positives = 91/202 (45%), Gaps = 12/202 (5%)

Query: 773 LLERKMWTLEERIDALELIDLEMFLEFAQKFFQNLFLSLYIEGN--LEYADLINSYFSDK 830
           L+  + WT + ++D  + +  E    F    ++ LF    + GN  +E A  IN    D 
Sbjct: 687 LVNERSWTTKAKLDVTKDLTFEHLKSFVPTIYEQLFHESLVLGNFSVEMAYEINQ-LVDI 745

Query: 831 LVHHLTKRLDYPKEDTLQS--LPSTKLISGTNIYYELEGSVDDPNNSIVYFIQTGDLSNK 888
           LV      L+  K + L+S  LP     S     Y LE   +  N+ I Y IQ G  S +
Sbjct: 746 LVVDRIPNLEV-KNNKLRSYILPEE---SAFRYEYMLEDKAN-VNSCIQYLIQLGAYS-E 799

Query: 889 KILSLTSLTAFIISFSLVPELRNKKQIGYVVFGGLRTLSDTVGLHITIMSDGKPLDIEIE 948
           ++ +  SL + +I       LR K+Q+GY+VF  +     T  L + + S+     +E  
Sbjct: 800 ELAAKASLVSQLIHEPCFDTLRTKEQLGYIVFSAVANTHGTTNLRVLVQSERDSAYVESR 859

Query: 949 IEKYISYLEFDLLGNLDDETFQ 970
           I K+++    + L  + +E F+
Sbjct: 860 IVKFLNSFG-EALKEMPEEAFE 880

>ZYRO0B12320g Chr2 complement(996046..999030) [2985 bp, 994 aa] {ON}
           similar to uniprot|Q06010 Saccharomyces cerevisiae
           YLR389C STE23 Metalloprotease involved with homolog
           Axl1p in N-terminal processing of pro-a-factor to the
           mature form member of the insulin-degrading enzyme
           family
          Length = 994

 Score =  153 bits (387), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 117/443 (26%), Positives = 201/443 (45%), Gaps = 60/443 (13%)

Query: 1   MSWINTKTFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDP 60
           MS  N K  +  F  P    +R+ +  +LPN + ALLI D+     A ++ V  G+  DP
Sbjct: 27  MSNNNYKKLEGQFVKPD-LDDRSYRYIQLPNDLKALLIHDSKADKAAAALDVNVGAFEDP 85

Query: 61  RDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAI 120
             +PG+AH CEH++   GS+KYP    +   L+ + G+ NA+T  + T +YFE+      
Sbjct: 86  EGLPGLAHFCEHLLFM-GSEKYPDENEYSSYLSKHGGASNAYTGSQNTNYYFEVN----- 139

Query: 121 EQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSH 180
            ++ FG  LD F+ FF  PLFN   T+KEI A++SE+  N+ +    LY  ++ L+N+ H
Sbjct: 140 HEHLFG-ALDRFAGFFTCPLFNRDSTDKEIKAVDSENKKNLQSDLWRLYQLDKSLTNEEH 198

Query: 181 PFHNFSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALA 240
           P+H FSTGN  TL ++      +++E L +++K +Y +  M +C+ G + L++L+  A +
Sbjct: 199 PYHKFSTGNFITLHEIPTSNGIDVREELLKFYKKSYSANLMKLCVLGREDLDTLSNWACS 258

Query: 241 NFGDIKDKDELTKFHINSIKPQXXXXXXXXXXXXXXCNSFKTNENLDLENFKLLDNAWLD 300
            F D+           N  +P                                     + 
Sbjct: 259 LFQDVP----------NIARP-------------------------------------VP 271

Query: 301 KYGDNVCFPTSLSHNTIFLSSSKQPILRLLFPISEKLTRFTKRDIKIYSNIWCHIFGDET 360
           +YG  +    SL       S      L + F   +    +  +   I S++  H    E 
Sbjct: 272 EYGSKMLDERSLQKVIHAKSVKDLKKLEVTFSAPDMDLEWESKPQHILSHLVGH----EG 327

Query: 361 KGSFCDYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIIDILLQQVVKLL 420
            GS   +L    W  E  A   + +  N    +++ LT+ G+K  +++  I+  Q +++L
Sbjct: 328 SGSLLAHLKDKGWANELSAGGHSVSKENAFFSIDIDLTDLGLKHYEDVTHIIF-QYLEML 386

Query: 421 VDNFTENLAYFLAENNIISILRF 443
             N  +   Y   E+   +  +F
Sbjct: 387 KLNLPKKWIYLELEDIARATFKF 409

 Score = 55.1 bits (131), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 72/355 (20%), Positives = 150/355 (42%), Gaps = 26/355 (7%)

Query: 624 LVSQNDMHKLWVNPKNSKDQLSESPCIVSFKL--VNNSIQESPESTMHLELMGQLLHTLL 681
           L+  + + KLW   K+ +         +SFKL     SI  S  ST++++L+   +  L 
Sbjct: 535 LLKDDKISKLWYK-KDDRFWQPRGYIYISFKLPHTQASIVNSMLSTLYVQLINDYIKDLQ 593

Query: 682 INKLYPALNVGYTFEISPSVRGDVSLSFTLSGFSEGIFKIIKECINIFGELTSSDLITKK 741
            +     L++ ++       + +  L  T+ GF++ +  ++   +             K 
Sbjct: 594 YDAACADLHLSFS-------KTNQGLDITVVGFNDKLTILLTRFLEGLKSF-------KP 639

Query: 742 EFRRARILVRDKYEDAASDSCVKLASVGLLI----LLERKMWTLEERIDALELIDLEMFL 797
           E  R +I  +DK     ++   ++  + +      L+  + W+++E+++ L+ +  E  +
Sbjct: 640 EKNRFQIF-KDKCTRQLTNQLYEVPYLQVFPVYSSLINERTWSVKEKLEVLKRLTFEQLV 698

Query: 798 EFAQKFFQNLFLSLYIEGNLEYADLINSYFSDKLVHHLTKRLDYPKEDTLQSLPSTKLIS 857
            +    ++ +F   ++ GN++Y + I     D LV  L        +     L S  L  
Sbjct: 699 TYLPTIYEEMFFEAFVHGNMKYEEAIE---VDSLVQMLVPNDIRNFQTKNGKLRSYFLPQ 755

Query: 858 GTNIYYELEGSVDDPNNSIVYFIQTGDLSNKKILSLTSLTAFIISFSLVPELRNKKQIGY 917
           G    YE +       NS +  +    + +++I +  SL A +I       LR K+Q+GY
Sbjct: 756 GETYRYETKLQDSQNLNSCIQHVTQLGVYSEEISAKASLFAQMIHEPCFDTLRTKEQLGY 815

Query: 918 VVFGGLRTLSDTVGLHITIMSDGKPLDIEIEIEKYISYLEFDLLGNLDDETFQNN 972
           VVF        T  + I + S+     +E  IE ++      +L ++ D+ F+ +
Sbjct: 816 VVFSSSLNNHGTANIRILVQSEHTTPFLEWRIESFLQGFG-KILQDMSDKDFEGH 869

>Smik_12.476 Chr12 complement(838321..841398) [3078 bp, 1025 aa]
           {ON} YLR389C (REAL)
          Length = 1025

 Score =  153 bits (387), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 86/255 (33%), Positives = 133/255 (52%), Gaps = 8/255 (3%)

Query: 5   NTKTFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDPRDIP 64
           N KT   DF  P     R+ +   LPN + ALLI D      A S+ V  G+  DP  +P
Sbjct: 56  NFKTLVRDFLKPD-LDERSYRYIELPNKLKALLIQDPKADKAAASLDVNIGAFEDPEKLP 114

Query: 65  GIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAIEQNT 124
           G+AH CEH++   GS+K+P    +   L+ + GS NA+T  + T ++FE      +    
Sbjct: 115 GLAHFCEHLLFM-GSEKFPDENEYSSFLSKHGGSSNAYTASQNTNYFFE------VNHQH 167

Query: 125 FGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSHPFHN 184
             + LD FS FF  PLFN+  T+KEI A+ SE+  N+ N    +Y  ++ L+N  HP+H 
Sbjct: 168 LFDALDRFSGFFSCPLFNKDSTDKEINAVNSENKKNLQNDIWRIYQLDKSLTNTKHPYHK 227

Query: 185 FSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALANFGD 244
           FSTGNI TL         N+++ L ++ K+ Y +  M +CI G + L++L+      F +
Sbjct: 228 FSTGNIETLGTSPKENGLNIRDELLKFHKDFYSANLMKLCILGREDLDTLSDWVYDLFKN 287

Query: 245 IKDKDELTKFHINSI 259
           + +      ++   I
Sbjct: 288 VSNNGREVPYYAEPI 302

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 67/299 (22%), Positives = 122/299 (40%), Gaps = 32/299 (10%)

Query: 651 VSFKL--VNNSIQESPESTMHLELMGQLLHTLLINKLYPALNVGYTFEISPSVRGDVSLS 708
           +SFKL   + SI  S  ST++++L+   L  L  +     L + ++       + +  L 
Sbjct: 586 LSFKLPHTHASIVNSMLSTLYIQLVNDALKDLQYDAACADLRISFS-------KTNQGLD 638

Query: 709 FTLSGFSEGIFKIIKECINIFGELTSS----DLITKKEFRRARILVRDKYEDAASDSCVK 764
            T SGF+E +  ++   +             +++  K  R  + L+   YE   S     
Sbjct: 639 ITASGFNEKLIILLTRFLQGVTSFEPKKDRFEILKDKTIRHLKNLL---YEVPYSQMSNY 695

Query: 765 LASVGLLILLERKMWTLEERIDALELIDLEMFLEFAQKFFQNLFLSLYIEGNLEYADLIN 824
             +     L+  + W+  E++   E +  E  + F    ++ +F    I GN+++ + + 
Sbjct: 696 YNA-----LINERSWSTVEKLQVFEKLTFEQLINFIPTIYEGVFFETLIHGNIKHEEAVE 750

Query: 825 SYFSDKLVHHLTKRLDYPKEDTLQ----SLPSTKLISGTNIYYELEGSVDDPNNSIVYFI 880
                  V  L K L     + LQ     L S  L  G +  YE         NS +  +
Sbjct: 751 -------VDSLIKSLITNNINNLQVANNRLRSYLLPKGKSFRYETALKDSQNVNSCIQHV 803

Query: 881 QTGDLSNKKILSLTSLTAFIISFSLVPELRNKKQIGYVVFGGLRTLSDTVGLHITIMSD 939
              D+ ++++ +L+ L A +I       LR K+Q+GYVVF        T  + I I S+
Sbjct: 804 TQLDVYSEELSALSGLFAQLIHEPCFDTLRTKEQLGYVVFSSSLNNHGTANIRILIQSE 862

>Kpol_1055.83 s1055 (216511..219573) [3063 bp, 1020 aa] {ON}
           (216511..219573) [3063 nt, 1021 aa]
          Length = 1020

 Score =  153 bits (386), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 80/229 (34%), Positives = 131/229 (57%), Gaps = 8/229 (3%)

Query: 7   KTFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDPRDIPGI 66
           K  D++F  P    +R+ +   LPN   ALLI D S   +A S+ V  G+  DP+++ G+
Sbjct: 59  KIHDLNFIKPD-LDDRSYRFIELPNKFKALLIHDASTDKSAASLDVNIGAFQDPKNLQGL 117

Query: 67  AHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAIEQNTFG 126
           AH CEH++   GSKK+P    +   L  + GS NA+T  + T ++FE      I      
Sbjct: 118 AHFCEHLLFM-GSKKFPNENEYSSYLNKHGGSSNAYTGAQNTNYFFE------INHEHLH 170

Query: 127 EILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSHPFHNFS 186
             LD FS FF  PLFN   T+KEI A++SE+  N+ N    +Y  ++ LSN+ HP+H FS
Sbjct: 171 GALDRFSGFFTCPLFNPNSTSKEINAVDSENKKNLQNDVWRMYQLDKSLSNEKHPYHKFS 230

Query: 187 TGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLT 235
           TGN+ TL ++   +  +++  L +++ ++Y +  M +C+ G + L++++
Sbjct: 231 TGNLKTLDEMPKKEGLDIRNELLKFYSDSYSANLMKLCVLGREDLDTMS 279

 Score = 49.3 bits (116), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 44/202 (21%), Positives = 90/202 (44%), Gaps = 17/202 (8%)

Query: 773 LLERKMWTLEERIDALELIDLEMFLEFAQKFFQNLFLSLYIEGN------LEYADLINSY 826
           L+  + W++++++  +E I  E FL F    ++  +    + GN      +E   L+ S 
Sbjct: 700 LINERTWSVKQKLSIIEKITYEQFLAFLPTIYEECYFDGLVHGNFRNEEAVEIDSLVQSL 759

Query: 827 FSDKLVHHLTKRLDYPKEDTLQSLPSTKLISGTNIYYELE-GSVDDPNNSIVYFIQTGDL 885
            +  +V+   K            L S  + +G    +E++    ++ N+ + + +Q G  
Sbjct: 760 ITTDIVNLHVKN---------TRLRSYVIPNGETYRFEIDLEDAENVNSCVQHVVQLGGY 810

Query: 886 SNKKILSLTSLTAFIISFSLVPELRNKKQIGYVVFGGLRTLSDTVGLHITIMSDGKPLDI 945
           S +++ +++ L A I++      LR K+Q+GYVVF        T  + I + S+     +
Sbjct: 811 S-EELSAMSGLFAQILNEPCFDTLRTKEQLGYVVFSSSLNNHGTANIRILVQSEHSTPYL 869

Query: 946 EIEIEKYISYLEFDLLGNLDDE 967
           E  I+++       L    DDE
Sbjct: 870 EWRIDEFYKSFGETLRNMSDDE 891

>SAKL0H03124g Chr8 (291984..295004) [3021 bp, 1006 aa] {ON} similar
           to uniprot|Q06010 Saccharomyces cerevisiae YLR389C STE23
           Metalloprotease involved with homolog Axl1p in
           N-terminal processing of pro-a-factor to the mature form
           member of the insulin-degrading enzyme family
          Length = 1006

 Score =  152 bits (385), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 79/246 (32%), Positives = 137/246 (55%), Gaps = 11/246 (4%)

Query: 2   SWINTKTFDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDPR 61
           S+IN K   I F  P    +RN +  +LPN + ALLI D +    A ++ +  G+  DP 
Sbjct: 44  SYINHK---ISFKKPD-LDDRNYRFIQLPNNLKALLIQDPATDKAAAALDINVGAFEDPE 99

Query: 62  DIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAIE 121
           +IPG+AH CEH++   GS K+P    +   L+ + G+ NA+T  + T +YF+      + 
Sbjct: 100 NIPGLAHFCEHLLFM-GSSKFPDENEYSSFLSKHGGASNAYTGSQNTNYYFQ------VN 152

Query: 122 QNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSHP 181
                  LD FS FF  PLFN+  T+KEI A++SE+  N+ N    +Y  ++  ++  HP
Sbjct: 153 HEDLRGALDRFSGFFTSPLFNKNSTDKEINAVDSENKKNLQNDLWRMYQLDKSFTSPMHP 212

Query: 182 FHNFSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALAN 241
           +H FSTGN+ TL +    +  ++++ L +++   Y +  M +C+ G + L+++++     
Sbjct: 213 YHKFSTGNLKTLGETPKNQGLDIRDELLKFYNKFYSANIMKLCVLGREDLDTMSEWVYEL 272

Query: 242 FGDIKD 247
           F D+++
Sbjct: 273 FKDVRN 278

 Score = 45.4 bits (106), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 81/351 (23%), Positives = 151/351 (43%), Gaps = 34/351 (9%)

Query: 632 KLWVNPKNSKDQLSESP---CIVSFKLVN--NSIQESPESTMHLELMGQLLHTLLINKLY 686
           KLW      KD    +P     VS KL +  +SI  S  +++++EL+   L  L  +   
Sbjct: 556 KLWY----KKDDTFWAPRGYIYVSMKLAHTHSSIVNSMLTSLYVELINDHLKDLQYDAEV 611

Query: 687 PALNVGYTFEISPSVRGDVSLSFTLSGFSEGIFKIIKECINIFGELTSS-DLITKKEFRR 745
             L+V ++       + +  L  +L G++E +  ++   +    E T   D     + + 
Sbjct: 612 ANLHVSFS-------KTNQGLDISLCGYNEKLTILLTRFLEGIKEFTPKLDRFKIFQDKL 664

Query: 746 ARILVRDKYEDAASDSCVKLASVGLLILLERKMWTLEERIDALELIDLEMFLEFAQKFFQ 805
            R L    YE   S    +L+ +   ++ ER  W+ +E++D  + +  E    F    ++
Sbjct: 665 VRKLNNHLYEVPYS----QLSGIFNSLINERS-WSTKEKLDLTKQLTFEHLKNFIPTIYE 719

Query: 806 NLFLSLYIEGNL--EYADLINSYFSDKLVHHLTKRLDYPKEDTLQS--LPSTKLISGTNI 861
            L+  + + GN   E A  IN      +V +  K L   K   L+S  +P  K       
Sbjct: 720 QLYYEILVHGNFSQEAATEIND-LVKMMVPNDIKNLQV-KNGKLRSYIIPQEKTFR---- 773

Query: 862 YYELEGSVDDPNNSIVYFIQTGDLSNKKILSLTSLTAFIISFSLVPELRNKKQIGYVVFG 921
             EL  + +   NS +  +    + ++ + + T+L A +I       LR K+Q+GYVVF 
Sbjct: 774 -MELPLADEKNVNSCIQHVTQFGIYSEDLSAKTALLAQLIDEPCFDTLRTKEQLGYVVFS 832

Query: 922 GLRTLSDTVGLHITIMSDGKPLDIEIEIEKYISYLEFDLLGNLDDETFQNN 972
              +   TV L + I S+     +E  I+ ++     ++L  + +E F+ +
Sbjct: 833 SALSTHGTVNLRLLIQSERDSSYLESRIDSFLKKFG-NILREMPEEEFEKH 882

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 31/63 (49%)

Query: 354 HIFGDETKGSFCDYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIIDILL 413
           H+ G E  GS   YL    W  E  A   T ++ N    ++++LTN G+   Q+++  + 
Sbjct: 334 HLIGHEGSGSLLAYLKGQGWANELSAGAHTVSVNNAFFSVDIELTNNGLDHYQDVVSSVF 393

Query: 414 QQV 416
           Q +
Sbjct: 394 QYI 396

>Ecym_3273 Chr3 (515048..518119) [3072 bp, 1023 aa] {ON} similar to
           Ashbya gossypii AER053C
          Length = 1023

 Score =  152 bits (385), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 79/228 (34%), Positives = 124/228 (54%), Gaps = 7/228 (3%)

Query: 21  NRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDPRDIPGIAHLCEHMILAAGSK 80
           +RN +  +LPN +   LI D S    A ++ V  G   DP D+PG+AH CEH++   GS+
Sbjct: 77  DRNYRYIQLPNRLKVFLIQDKSTDKAAAALDVNVGFFQDPEDLPGLAHFCEHLLFM-GSE 135

Query: 81  KYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAIEQNTFGEILDIFSSFFKKPL 140
           K+P    +   L+ + G+ NA+T+ + T +YF       +      + LD FS FF  PL
Sbjct: 136 KFPNENEYSSYLSHHGGASNAYTSTQNTNYYF------MVNHGNLYDALDRFSGFFTSPL 189

Query: 141 FNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSHPFHNFSTGNIHTLSKVVNLK 200
           F+   TNKE+ A++SE+  N+ +    +   +R L+N  HPFH FSTGN  TL K    +
Sbjct: 190 FSVSSTNKEVNAVDSENKKNLQSDLWRMQQLDRSLTNPGHPFHKFSTGNYQTLYKEPKSR 249

Query: 201 KYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALANFGDIKDK 248
              ++E L +++   Y +  M + I G + L++L+  A   F D+ DK
Sbjct: 250 GIEIREELLKFYDKTYSANLMRLVILGMEDLDTLSAWAYELFKDVPDK 297

 Score = 55.5 bits (132), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 73/350 (20%), Positives = 153/350 (43%), Gaps = 32/350 (9%)

Query: 632 KLWVNPKNSKDQLSESPCIVSFKLVNN--SIQESPESTMHLELMGQLLHTLLINKLYPAL 689
           +LW   K+ +  + E    VSFKL ++  S+  S  ST+++E++   L  LL N      
Sbjct: 574 RLWYK-KDDRFWVPEGHVYVSFKLPHSYSSVVNSMLSTLYVEMVKDSLKDLLYNAECANF 632

Query: 690 NVGYTFEISPSVRGDVSLSFTLSGFSEGIFKIIKECINIFGELTSSDLITKKEFRRARIL 749
            V +       V+ +  L  +L+G+++ +  ++    +I   + + D   ++     ++L
Sbjct: 633 EVSF-------VKTNQGLDLSLTGYNDKMTLLL---TSILEGIRNFDPKKERFDVLQKLL 682

Query: 750 VRDKYEDAASDSCVKLASVGLLI--LLERKMWTLEERIDALELIDLEMFLEFAQKFFQNL 807
            +  Y    +   V  + +G+L   L+  + WT  E++   + +  E F  F    ++ +
Sbjct: 683 CQKLYNRLYN---VPYSQIGVLYNSLINDRSWTPSEKLKVTKQLTFEHFKAFVPSIYEQM 739

Query: 808 FLSLYIEGNLEYADLI--NSYFSDKL---VHHLTKRLDYPKEDTLQSLPSTKLISGTNIY 862
           +    + GN      I  NSY    +   + H   R + P+        S  L  G    
Sbjct: 740 YFETLVHGNFPENQAIELNSYICSLIPNQIKHSGARNNRPR--------SYMLPEGKTYR 791

Query: 863 YELEGSVDDPNNSIVYFIQTGDLSNKKILSLTSLTAFIISFSLVPELRNKKQIGYVVFGG 922
           YE     ++  NS    +    + ++ + +  SL A +I+      LR ++Q+GYVV+  
Sbjct: 792 YETTLFDEENVNSCFEMVIQLGMYSEDMNAKGSLLAQLINEPCFNTLRTEEQLGYVVWSS 851

Query: 923 LRTLSDTVGLHITIMSDGKPLDIEIEIEKYISYLEFDLLGNLDDETFQNN 972
            +    +  L I + S+   + IE  ++K+++    D L ++ ++ F+ +
Sbjct: 852 KQNTHASTNLRILVQSESDTVYIESRVDKFLNNFA-DTLRSMSEQAFEKH 900

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 32/63 (50%)

Query: 354 HIFGDETKGSFCDYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIIDILL 413
           H+ G E+  S   YL   +W TE Y    T + GN    + ++LT+ GV+  + ++  + 
Sbjct: 352 HLIGHESSNSLLSYLISQSWATELYCGAQTVSKGNAYFCIHIELTDKGVQDYEEVVYTVF 411

Query: 414 QQV 416
           Q +
Sbjct: 412 QYI 414

>Kwal_23.4237 s23 (630432..633437) [3006 bp, 1001 aa] {ON} YLR389C
           (STE23) - involved in a-factor processing [contig 1]
           FULL
          Length = 1001

 Score =  152 bits (384), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 82/254 (32%), Positives = 140/254 (55%), Gaps = 14/254 (5%)

Query: 2   SWINTKTF------DIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATG 55
           S IN++T       +I+F  P    +R  +   LPN +  LLI D +    A ++ V  G
Sbjct: 31  SKINSRTMASYVNHNIEFKKPL-LDDREYRFIELPNKLKVLLIQDVNTDKAAAALDVNVG 89

Query: 56  SHSDPRDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELP 115
           S  DP ++PG+AH CEH++   GS KYP    +   L+ + G  NA+T+ + T ++F+  
Sbjct: 90  SFEDPENLPGLAHFCEHLLFM-GSSKYPNENEYSSYLSKHGGGSNAYTSSQNTNYFFQ-- 146

Query: 116 TSTAIEQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLL 175
               + Q      LD FS FF  PLFN+  T+KEI A++SE+  N+ +    LY  ++  
Sbjct: 147 ----VNQGNLHGALDRFSGFFSCPLFNKDSTDKEINAVDSENKKNLQSDLWRLYQLDKSQ 202

Query: 176 SNKSHPFHNFSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLT 235
           S+  HP+H FSTGN+ TL ++   +  ++++ L +++  +Y +  M +C+ G + L+ L+
Sbjct: 203 SSPEHPYHKFSTGNLKTLGELPKSQNLDVRDELLKFYNRSYSANLMKLCVLGREDLDVLS 262

Query: 236 KLALANFGDIKDKD 249
           +     F D+ ++D
Sbjct: 263 QWVYDLFKDVPNRD 276

 Score = 65.1 bits (157), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 110/475 (23%), Positives = 189/475 (39%), Gaps = 86/475 (18%)

Query: 624  LVSQNDMHKLWVNPKNSKDQLSESPCIVSFKLVN--NSIQESPESTMHLELMGQLLHTLL 681
            L+ Q+   +LW   K+ +  + +    VS KLV+  +SI  S  ++++++L+   L  + 
Sbjct: 544  LLLQDGQSRLWYK-KDDRFWVPKGHIYVSMKLVHTYSSIVNSMLTSLYVDLVNDFLKDIQ 602

Query: 682  INKLYPALNVGYTFEISPSVRGDVSLSFTLSGFSE-----------GI--FKIIKECINI 728
             +    +L V +        + +  L   LSG++E           GI  FK  +E   I
Sbjct: 603  YDSQVASLTVSFR-------KTNQGLDLALSGYNEKMPILLTSYLEGISRFKPNQERFKI 655

Query: 729  FGELTSSDLITKKEFRRARILVRDKYEDAASDSCVKLASVGLLILLERKMWTLEERIDAL 788
            F     + LI K        L    YE   S +     S     L+  + WT++++++ +
Sbjct: 656  F----QAKLIQK--------LNNHLYEIPYSQASDVYNS-----LINERSWTIKDKLEVV 698

Query: 789  ELIDLEMFLEFAQKFFQNLFLSLYIEGNLEYADLINSYFSDKLVHHLTKRL---DYPKED 845
            E +  +    F    F+  F    + GN  Y   +        +H L K L   D     
Sbjct: 699  EQLTFQHLENFLPTIFEQFFFEALVHGNFSYETAVE-------IHKLVKALAPNDIKNCL 751

Query: 846  TLQSLPSTKLISGTNIYYELEGSVDDPN-NSIVYFIQTGDLSNKKILSLTSLTAFIISFS 904
               S P +  I     YY  +   D+ N NS +  +      ++++ +  +L A +I   
Sbjct: 752  LKSSKPRSLHIPPGRAYYYEQRLADEKNINSCIQHVNQFGTYSEELAAKAALFAQLIDEP 811

Query: 905  LVPELRNKKQIGYVVFGGLRTLSDTVGLHITIMSDGKPLDIEIEIEKYISYLEFDLLGNL 964
                LR K+Q+GYVVF        TV L I I S+     +E  I+ +++ +   +L ++
Sbjct: 812  AFDTLRTKEQLGYVVFSSALNTHGTVNLRILIQSERDTAFLESRIDAFLAKMG-QILQDM 870

Query: 965  DDETFQNNYLIKYIDLINGIYKKSTEQTSGPINIMNEIIANVHGGDSAILNSEXXXXXXX 1024
             +E F+ +       L+   YK  +E+ S            ++ GD   LN E       
Sbjct: 871  SEEEFERHRTALCKTLLQR-YKNLSEENS-------RFTTAIYIGDYNFLNKERK----- 917

Query: 1025 XXXELFGDAQMTEELKYVDIEFLKNLNLIKYLQFFKGSISTNSKRRSKLSIHIKS 1079
                    A + E L   D+           LQF+   +   SK  SKL IH+KS
Sbjct: 918  --------AALVERLSKTDM-----------LQFYNSFVV--SKDASKLVIHLKS 951

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 28/64 (43%)

Query: 353 CHIFGDETKGSFCDYLNKNNWITECYAFKSTFAIGNTSLILELKLTNTGVKKLQNIIDIL 412
            H+ G E  GS   YL    W  E  A   T +  N    + + LT+ G+   ++++  +
Sbjct: 329 SHLIGHEGSGSLLAYLKSKGWANELSAGSHTVSKDNGFFSISIDLTDEGIANYEDVVISV 388

Query: 413 LQQV 416
            Q +
Sbjct: 389 FQYI 392

>TBLA0A08050 Chr1 (1988388..1991375) [2988 bp, 995 aa] {ON}
           Anc_4.246 YLR389C
          Length = 995

 Score =  141 bits (356), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 83/229 (36%), Positives = 123/229 (53%), Gaps = 8/229 (3%)

Query: 22  RNQKLCRL-PNGILALLISDNSVTTTACSISVATGSHSDPRDIPGIAHLCEHMILAAGSK 80
           RN +  +L  N + AL+I D +    A ++ V  G+  DP ++PG+AH CEH++   GSK
Sbjct: 39  RNYQFIKLNKNNLHALIIQDKTTDKAAAALDVNAGAFMDPSNLPGLAHFCEHLLFM-GSK 97

Query: 81  KYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAIEQNTFGEILDIFSSFFKKPL 140
            +P    +   L  N G  NA+T    T ++FE      I      E L  FS FFK PL
Sbjct: 98  NFPNENDYSSYLNQNGGFSNAYTGSMNTNYHFE------INHANLFEALRRFSCFFKTPL 151

Query: 141 FNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSHPFHNFSTGNIHTLSKVVNLK 200
           FN   T KEI+AI+SE+  N+ N    LY   + LSN  HP+H FSTG+  TL +     
Sbjct: 152 FNNDSTIKEIHAIDSENKKNLQNDYWRLYQLGKSLSNHEHPYHKFSTGSKLTLLENTETL 211

Query: 201 KYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALANFGDIKDKD 249
             N++E L +++   Y S  M +CI G + L +L++ A   F ++ +K+
Sbjct: 212 NLNIREELIKFYNKWYSSNIMNLCIIGREDLGTLSRWAKILFENVPNKN 260

 Score = 53.9 bits (128), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 85/185 (45%), Gaps = 11/185 (5%)

Query: 773 LLERKMWTLEERIDALELIDLEMFLEFAQKFFQNLFLSLYIEGNLEYADLINSYFSDKLV 832
           L+  + W++EE +  ++ ID     +F    +Q LF      GN++Y     +   D LV
Sbjct: 669 LINERSWSVEENLKVVQDIDFPQLQDFIPTIYQELFFETLAFGNIQYEQ---AQEVDSLV 725

Query: 833 HHL---TKRLDYPKEDTLQSLPSTKLISGTNIYYEL-EGSVDDPNNSIVYFIQTGDLSNK 888
             L   T +    K D L+S     + SG    YE+ +   ++ N  I Y  Q G + ++
Sbjct: 726 RTLIPNTIKNSQVKNDRLRSYI---IPSGKTFKYEVFQKDKNNLNTCIQYICQFG-IYSE 781

Query: 889 KILSLTSLTAFIISFSLVPELRNKKQIGYVVFGGLRTLSDTVGLHITIMSDGKPLDIEIE 948
            + ++ SL A I+       LR K+Q+GY+VF    +   T  L I + S+     ++  
Sbjct: 782 YLAAVVSLLAQIMHEPCFNTLRTKEQLGYIVFSSSLSNHGTCNLSIMVQSEYSTDYLQFR 841

Query: 949 IEKYI 953
           IE ++
Sbjct: 842 IENFL 846

>AGL138C Chr7 complement(453737..455149) [1413 bp, 470 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR163C
           (MAS1)
          Length = 470

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 56/238 (23%), Positives = 97/238 (40%), Gaps = 21/238 (8%)

Query: 15  LPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDPRDIPGIAHLCEHMI 74
           L +S +    ++ +LPNG+     +  +  T +  I V  GS ++     G AH  EH+ 
Sbjct: 20  LATSSTVPRTRISQLPNGLTVASEAMPNTATASVGIFVDAGSRAENVRNNGTAHFLEHLA 79

Query: 75  LAAGSKKYPKPGLFHEVLAANNGSQ-NAFTTGEQTTFYFELPTSTAIEQNTFGEILDIFS 133
              G+K   + G+  E+   N GS  NA+T+ E T +Y +        Q      LD+ S
Sbjct: 80  F-KGTKNRTQVGIELEI--ENLGSHLNAYTSRENTVYYAK------SLQEDIPRALDVLS 130

Query: 134 SFFKKPLFNEVLTNKEIYAI--ESEHDGNMSNTSKILYHAERLLSNKSHPFHNFSTGNIH 191
               + + +     +E   I  ESE    M +  ++++     +S ++ P      G I 
Sbjct: 131 DILTRSVLDPKAVERERDVIIRESEEVDKMYD--EVVFDHLHAISYENQPLGRTILGPIE 188

Query: 192 TLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALANFGDIKDKD 249
            +  +   ++ +LK    EY   NY    M +   G    + L +     FG I   D
Sbjct: 189 NIKSI---QQRDLK----EYISTNYKGDRMALVGAGAVDHDELVRYGEKYFGHIPKSD 239

>Kwal_23.3345 s23 (253614..254990) [1377 bp, 458 aa] {ON} YLR163C
           (MAS1) - mitochondrial processing protease subunit
           [contig 252] FULL
          Length = 458

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 55/220 (25%), Positives = 91/220 (41%), Gaps = 21/220 (9%)

Query: 29  LPNGILALLISDNSVTTTACSISVATGSHSDPRDIPGIAHLCEHMILAAGSKKYPKPGLF 88
           LPNG+     +  + ++    I V  GS ++     G AH  EH+    G+K   + G+ 
Sbjct: 27  LPNGLTVATEAIPNTSSATVGIFVDAGSRAENSKNNGTAHFLEHLAF-KGTKNRTQVGIE 85

Query: 89  HEVLAANNGSQ-NAFTTGEQTTFYFELPTSTAIEQNTFGEILDIFSSFFKKPLF--NEVL 145
            E+   N GS  NA+T+ E T +Y     +  + QN     +DI S    K +   N + 
Sbjct: 86  MEI--ENIGSHLNAYTSRENTVYY-----AKTLTQN-IPNAVDILSDILTKSVLDTNAIE 137

Query: 146 TNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSHPFHNFSTGNIHTLSKVVNLKKYNLK 205
             +++   ESE    M +  ++++     ++ K  P      G I       N+K    +
Sbjct: 138 RERDVIIRESEEVDKMYD--EVVFDHLHAITYKDQPLGRTILGPIK------NIKTIQQR 189

Query: 206 EMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALANFGDI 245
           + L EY   NY    M +   G    + L + A   FG I
Sbjct: 190 D-LREYISTNYKGDRMVLAGAGDVDHDKLVEYAGKYFGHI 228

>NCAS0C04950 Chr3 complement(1009698..1012796) [3099 bp, 1032 aa]
           {ON} Anc_3.93
          Length = 1032

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 81/200 (40%), Gaps = 31/200 (15%)

Query: 65  GIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAIEQNT 124
           G+ H  EH+I   GSK++P  GL   V      S NA+T  +QT +     T T+     
Sbjct: 57  GVPHTLEHLIFM-GSKQHPYKGLLDTVGNLCMSSTNAWTATDQTVY-----TLTSAGWKG 110

Query: 125 FGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAE------------ 172
           F +IL  + +    P   +     E+Y ++ E   ++S+   +    E            
Sbjct: 111 FSKILPAYLNHILFPTLTDDACTTEVYHVDPE---DLSDKGVVFSEMEAIESQSWFVTML 167

Query: 173 ---RLLSNKSHPFHNFSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQ 229
              RL+  +   + + + G  + L  + N       E + E+ K NY S N+ + I G  
Sbjct: 168 EKQRLMFPRGSGYRSETGGLTNNLRDLTN-------EEIKEFHKANYSSDNLCLIICGNV 220

Query: 230 SLNSLTKLALANFGDIKDKD 249
             + L ++       + DKD
Sbjct: 221 PESELLEIVQNWDNSLPDKD 240

>KLLA0D18095g Chr4 complement(1526808..1528217) [1410 bp, 469 aa]
           {ON} highly similar to uniprot|P10507 Saccharomyces
           cerevisiae YLR163C MAS1 Smaller subunit of the
           mitochondrial processing protease essential processing
           enzyme that cleaves the N-terminal targeting sequences
           from mitochondrially imported proteins
          Length = 469

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/247 (22%), Positives = 102/247 (41%), Gaps = 31/247 (12%)

Query: 29  LPNGILALLISDNSVTTTACSISVATGSHSDPRDIPGIAHLCEHMILAAGSKKYPKPGLF 88
           LPNG+     S  +  T    I V TGS ++     G AH  EH+    G++   + G+ 
Sbjct: 38  LPNGLTVASESLPNTNTATVGIFVDTGSRAENEKNNGTAHFLEHLAF-KGTQNRSQTGIE 96

Query: 89  HEVLAANNGSQ-NAFTTGEQTTFYFELPTSTAIEQNTFGEILDIFSSFFKKPLFNEVLTN 147
            E+   N GS  NA+T+ E T +Y     + +++Q+   + +DI +    + + +     
Sbjct: 97  LEI--ENIGSHLNAYTSRENTVYY-----AKSLKQD-IPKAVDILADILTRSVLDPKAIE 148

Query: 148 KEIYAI--ESEHDGNMSNTSKILYHAERLLSNKSHPFHNFSTGNIHTLSKVVNLKKYNLK 205
           +E   I  ESE    M +  ++++     ++ K+ P      G I  +  +        +
Sbjct: 149 RERDVIIRESEEVDKMYD--EVVFDHLHTITYKNQPLGRTILGPIKNIKSI-------QR 199

Query: 206 EMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALANFGDIKD----------KDELTKFH 255
             L E+ + +Y    M +   G    + L + A   FG ++           +  L  FH
Sbjct: 200 SDLQEFIEKHYTGDRMVLVGTGAVDHDKLVEYAGKYFGHVRKSEAPIPLGSPRGPLPVFH 259

Query: 256 INSIKPQ 262
            N +K Q
Sbjct: 260 GNELKIQ 266

>Smik_12.225 Chr12 complement(439006..440394) [1389 bp, 462 aa] {ON}
           YLR163C (REAL)
          Length = 462

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/228 (21%), Positives = 93/228 (40%), Gaps = 21/228 (9%)

Query: 25  KLCRLPNGILALLISDNSVTTTACSISVATGSHSDPRDIPGIAHLCEHMILAAGSKKYPK 84
           +  +LPNG+        + ++    I V  GS ++     G AH  EH+    G++   +
Sbjct: 27  RTSKLPNGLTIATEYIPNTSSATVGIFVDAGSRAENLKNNGTAHFLEHLAF-KGTQNRSQ 85

Query: 85  PGLFHEVLAANNGSQ-NAFTTGEQTTFYFELPTSTAIEQNTFGEILDIFSSFFKKPLF-- 141
            G+  E+   N GS  NA+T+ E T +Y     + ++E++   + +DI S    K +   
Sbjct: 86  QGIELEI--ENIGSHLNAYTSRENTVYY-----AKSLEED-IPKAVDILSDILTKSVLDS 137

Query: 142 NEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSHPFHNFSTGNIHTLSKVVNLKK 201
           N +   +++   ESE    M +  ++++     ++ K  P      G I  +  +     
Sbjct: 138 NAIERERDVIIRESEEVDKMYD--EVVFDHLHEITYKDQPLGRTILGPIKNIKSIT---- 191

Query: 202 YNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALANFGDIKDKD 249
              +  L +Y   NY    M +   G      L + A   FG +   D
Sbjct: 192 ---RSDLKDYITKNYKGDRMVLAGAGAVDHERLVQYAQKYFGHVPRSD 236

>Kpol_1024.23 s1024 (68467..69831) [1365 bp, 454 aa] {OFF}
           (68467..69831) [1365 nt, 455 aa]
          Length = 454

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 55/229 (24%), Positives = 92/229 (40%), Gaps = 21/229 (9%)

Query: 18  SYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDPRDIPGIAHLCEHMILAA 77
           SY  ++  + RL NG+        +  T    I V  GS ++     G AH  EH+    
Sbjct: 5   SYLQQSTNISRLSNGLTIATEYIPNTPTATVGIYVDAGSRAENTKNNGTAHFLEHLAFKG 64

Query: 78  GSKKYPKPGLFHEVLAANNGSQ-NAFTTGEQTTFYFELPTSTAIEQNTFGEILDIFSSFF 136
             K+  K     E+   N GS  NA+T+ E T +Y     +  +++N   + +DI S   
Sbjct: 65  TEKRSQKK---IELDIENIGSHLNAYTSRENTVYY-----AKTLKEN-VPQAIDILSDIL 115

Query: 137 KKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSH--PFHNFSTGNIHTLS 194
            K   ++        AIE E D  +  + ++    + ++ +  H   + + S G    L 
Sbjct: 116 TKSTLDKS-------AIERERDVIIRESEEVDKMYDEVVFDHLHEIAYSDQSLGRT-ILG 167

Query: 195 KVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALANFG 243
            + N+K    ++ L  Y   NY    M +   G    N + K A   FG
Sbjct: 168 PIKNIKSIT-RDDLKNYITQNYKGDRMVLASAGDIDHNEIVKYAEKYFG 215

>Kpol_YGOB_1024.23 s1024 (68437..69831) [1395 bp, 464 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 464

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 55/229 (24%), Positives = 92/229 (40%), Gaps = 21/229 (9%)

Query: 18  SYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDPRDIPGIAHLCEHMILAA 77
           SY  ++  + RL NG+        +  T    I V  GS ++     G AH  EH+    
Sbjct: 15  SYLQQSTNISRLSNGLTIATEYIPNTPTATVGIYVDAGSRAENTKNNGTAHFLEHLAFKG 74

Query: 78  GSKKYPKPGLFHEVLAANNGSQ-NAFTTGEQTTFYFELPTSTAIEQNTFGEILDIFSSFF 136
             K+  K     E+   N GS  NA+T+ E T +Y     +  +++N   + +DI S   
Sbjct: 75  TEKRSQKK---IELDIENIGSHLNAYTSRENTVYY-----AKTLKEN-VPQAIDILSDIL 125

Query: 137 KKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSH--PFHNFSTGNIHTLS 194
            K   ++        AIE E D  +  + ++    + ++ +  H   + + S G    L 
Sbjct: 126 TKSTLDKS-------AIERERDVIIRESEEVDKMYDEVVFDHLHEIAYSDQSLGRT-ILG 177

Query: 195 KVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALANFG 243
            + N+K    ++ L  Y   NY    M +   G    N + K A   FG
Sbjct: 178 PIKNIKSIT-RDDLKNYITQNYKGDRMVLASAGDIDHNEIVKYAEKYFG 225

>CAGL0I07535g Chr9 complement(725369..728434) [3066 bp, 1021 aa]
           {ON} similar to uniprot|Q12496 Saccharomyces cerevisiae
           YOL098c
          Length = 1021

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 48/106 (45%), Gaps = 10/106 (9%)

Query: 51  SVATGSHSDPRDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTF 110
           +VAT   +D     G+ H  EH+I   GSKKYP  GL   +      S NA+T  +QT +
Sbjct: 47  AVATECPNDS----GVPHTLEHLIFM-GSKKYPYKGLLDTLGNLCMSSTNAWTATDQTVY 101

Query: 111 YFELPTSTAIEQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESE 156
                T T+     F ++L ++      P   +     E+Y I+ +
Sbjct: 102 -----TLTSAGWQGFKKLLPVYLDHLLNPTLTDEACVTEVYHIDPQ 142

>Kwal_56.22688 s56 (236214..239336) [3123 bp, 1040 aa] {ON} YOL098C
           - Hypothetical ORF [contig 184] FULL
          Length = 1040

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 47/106 (44%), Gaps = 10/106 (9%)

Query: 51  SVATGSHSDPRDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTF 110
           +VAT   +D     G+ H  EH+I   GSKKYP  GL          S NA+T  +QT +
Sbjct: 47  AVATECPTDS----GVPHTLEHLIFM-GSKKYPYKGLLDTAGNLCMSSTNAWTATDQTVY 101

Query: 111 YFELPTSTAIEQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESE 156
                T T+     F  +L ++      P  ++     E+Y ++ E
Sbjct: 102 -----TLTSAGWLGFKNLLPVYLDHVLHPTISDHACTTEVYHVDPE 142

>KLTH0C09570g Chr3 complement(795587..798715) [3129 bp, 1042 aa]
           {ON} similar to uniprot|Q12496 Saccharomyces cerevisiae
           YOL098C Hypothetical ORF
          Length = 1042

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 47/106 (44%), Gaps = 10/106 (9%)

Query: 51  SVATGSHSDPRDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTF 110
           +VAT   +D     G+ H  EH+I   GSKK+P  GL          S NA+T  +QT +
Sbjct: 47  AVATECPTDS----GVPHTLEHLIFM-GSKKFPYKGLLDTAGNLCMSSTNAWTATDQTVY 101

Query: 111 YFELPTSTAIEQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESE 156
                T T+     F ++L ++      P   +     E+Y ++ E
Sbjct: 102 -----TLTSAGWQGFKKLLPVYLDHVLHPTITDDACTTEVYHVDPE 142

>TDEL0F05000 Chr6 complement(942516..943886) [1371 bp, 456 aa] {ON}
           Anc_8.376 YLR163C
          Length = 456

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 51/206 (24%), Positives = 85/206 (41%), Gaps = 21/206 (10%)

Query: 43  VTTTACSISVATGSHSDPRDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQ-NA 101
           ++T    I V  GS ++     G AH  EH+    G+K   + G+  E+   N GS  NA
Sbjct: 39  MSTATVGIFVDAGSRAENEKNNGTAHFLEHLAF-KGTKDRTQSGIELEI--ENIGSHLNA 95

Query: 102 FTTGEQTTFYFELPTSTAIEQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNM 161
           +T+ E T +Y +        ++     +DI S    + + +         AIE E D  +
Sbjct: 96  YTSRENTVYYAKS------LRDDIPRAVDILSDILTRSVLDP-------RAIERERDVII 142

Query: 162 SNTSKILYHAERLLSNKSH--PFHNFSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSR 219
             + ++    + ++ +  H   + + S G    L  V N+K    K+ L +Y   NY   
Sbjct: 143 RESEEVDKMYDEVVFDHLHEIAYKDQSLGRT-ILGPVKNIKSITRKD-LKDYITKNYKGD 200

Query: 220 NMTICIKGPQSLNSLTKLALANFGDI 245
            M +   G    + L K A   FG I
Sbjct: 201 RMVLAGAGAVDHDDLVKQAERFFGHI 226

>NCAS0C02970 Chr3 (558478..559863) [1386 bp, 461 aa] {ON} Anc_8.376
          Length = 461

 Score = 41.2 bits (95), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 54/220 (24%), Positives = 92/220 (41%), Gaps = 25/220 (11%)

Query: 29  LPNGILAL--LISDNSVTTTACSISVATGSHSDPRDIPGIAHLCEHMILAAGSKKYPKPG 86
           LPNG+     LI + S  T    I V  GS ++     G AH  EH+    G++   + G
Sbjct: 30  LPNGLTVATELIPNTSSAT--VGIFVDAGSRAENVKNNGTAHFLEHLAF-KGTQNRSQKG 86

Query: 87  LFHEVLAANNGSQ-NAFTTGEQTTFYFELPTSTAIEQNTFGEILDIFSSFFKKPLFNEVL 145
           +  E+   N GS  NA+T+ E T +Y     + +++++   + +DI S    K + +   
Sbjct: 87  IELEI--ENIGSHLNAYTSRENTVYY-----AKSLKED-IPKAVDILSDILTKSVLDPRA 138

Query: 146 TNKEIYAI--ESEHDGNMSNTSKILYHAERLLSNKSHPFHNFSTGNIHTLSKVVNLKKYN 203
             +E   I  ESE    M +  ++++     ++ K  P      G I  +  +       
Sbjct: 139 IERERDVIIRESEEVDKMHD--EVVFDHLHAITYKDQPLGRTILGPIKNIKSIT------ 190

Query: 204 LKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALANFG 243
            +  L EY   NY    M +   G  + + L + A   FG
Sbjct: 191 -RNDLREYITKNYKGDRMVLAGAGAVNHDELVEYAQKYFG 229

>TPHA0C02450 Chr3 (545815..547224) [1410 bp, 469 aa] {ON} Anc_8.376
           YLR163C
          Length = 469

 Score = 40.8 bits (94), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 54/224 (24%), Positives = 90/224 (40%), Gaps = 21/224 (9%)

Query: 25  KLCRLPNGILALLISDNSVTTTACSISVATGSHSDPRDIPGIAHLCEHMILAAGSKKYPK 84
           ++ +L NG+        + +T    I V  GS ++     G AH  EH+     SK+  K
Sbjct: 28  EISKLSNGLTVATEYMPNTSTATVGIYVNAGSRAENVKNNGTAHFLEHLAFKGTSKRSQK 87

Query: 85  PGLFHEVLAANNGSQ-NAFTTGEQTTFYFELPTSTAIEQNTFGEILDIFSSFFKKPLF-- 141
                E+   N GS  NA+T+ E T +Y     +  +++N     +DI S          
Sbjct: 88  Q---IELDIENIGSHLNAYTSRENTVYY-----AKTLKEN-LPLAVDILSDILTNSKLEK 138

Query: 142 NEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSHPFHNFSTGNIHTLSKVVNLKK 201
           N +   +++   ESE    M +  ++++     ++ K  P      G I       N+K 
Sbjct: 139 NAIERERDVIVRESEEVDKMYD--EVVFDHLHEIAYKDQPLGRTILGPIK------NIKS 190

Query: 202 YNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALANFGDI 245
            N  + L  Y  +NY    M +   G  +   L KLA   FG +
Sbjct: 191 INRSD-LVHYITSNYKGDRMVLAGAGDINHQDLIKLAEKYFGHL 233

>TBLA0B08240 Chr2 (1965563..1968661) [3099 bp, 1032 aa] {ON}
           Anc_3.93 YOL098C
          Length = 1032

 Score = 41.2 bits (95), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 54/230 (23%), Positives = 86/230 (37%), Gaps = 31/230 (13%)

Query: 11  IDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDPRDIPGIAHLC 70
           +DF L  +      K     +G+  + ++ +S        +VAT   +D     G  H  
Sbjct: 7   VDFKLDYAPQYHVSKYISQKSGLQLVHVNHSSSPLVQGYFAVATECPNDS----GCPHTL 62

Query: 71  EHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAIEQNTFGEILD 130
           EH+I   GSK YP  GL          S NA+T  +QT +     T T      F  +L 
Sbjct: 63  EHLIFM-GSKSYPYKGLLDTAGNLCMSSTNAWTATDQTVY-----TLTTAGWKGFKTLLP 116

Query: 131 IFSSFFKKPLFN-------------EVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSN 177
           ++      P                E LT+K +   E +   N S    +L   +RL+  
Sbjct: 117 VYLDHLLFPTLTDEACITEVHHIDPETLTDKGVVYSEMDAIENQSWFVTML-EKQRLMFK 175

Query: 178 KSHPFHNFSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKG 227
           +   + + + G    L  + N       E + E+ KN Y   N+ I + G
Sbjct: 176 EGSGYRSETGGLTENLRDLTN-------EEIREFHKNLYCPENLCIIVCG 218

>TPHA0P01040 Chr16 (208875..211991) [3117 bp, 1038 aa] {ON} Anc_3.93
           YOL098C
          Length = 1038

 Score = 41.2 bits (95), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 47/106 (44%), Gaps = 10/106 (9%)

Query: 51  SVATGSHSDPRDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTF 110
           +VAT   +D     G+ H  EH+I   GS KYP  GL   V      S NA+T  +QT +
Sbjct: 47  AVATECGNDS----GVPHTLEHLIFM-GSPKYPYKGLLDTVGNLCMSSTNAWTATDQTVY 101

Query: 111 YFELPTSTAIEQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESE 156
                T T+     F ++L ++      P   +     E+Y I+ +
Sbjct: 102 -----TLTSAGWTGFKKLLPMYLEHIINPTLTDDAYVTEVYHIDPD 142

>NDAI0G02320 Chr7 (518661..520052) [1392 bp, 463 aa] {ON} Anc_8.376
           YLR163C
          Length = 463

 Score = 40.8 bits (94), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 90/218 (41%), Gaps = 21/218 (9%)

Query: 29  LPNGILALLISDNSVTTTACSISVATGSHSDPRDIPGIAHLCEHMILAAGSKKYPKPGLF 88
           LPNG+        + ++    I V  GS ++     G AH  EH+    G+K   + G+ 
Sbjct: 32  LPNGLTVATEWMPNTSSATVGIFVDAGSRAENEKNNGTAHFLEHLAF-KGTKNRSQKGIE 90

Query: 89  HEVLAANNGSQ-NAFTTGEQTTFYFELPTSTAIEQNTFGEILDIFSSFFKKPLFNEVLTN 147
            E+   N GS  NA+T+ E T +Y     + +++++   + +DI S    + + +     
Sbjct: 91  LEI--ENIGSHLNAYTSRENTVYY-----AKSLKED-IPKAVDILSDILTRSVLDPEAIE 142

Query: 148 KEIYAI--ESEHDGNMSNTSKILYHAERLLSNKSHPFHNFSTGNIHTLSKVVNLKKYNLK 205
           +E   I  ESE    M +  ++++     ++ K  P      G I  +  +        +
Sbjct: 143 RERDVIIRESEEVDKMYD--EVVFDHLHEVTYKDQPLGRTILGPIKNIQSIT-------R 193

Query: 206 EMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALANFG 243
           + L +Y  +NY    M +   G      L + A   FG
Sbjct: 194 DDLSKYITDNYKGDRMVLAGAGAVDHEKLVEYAQRCFG 231

>KLTH0F08954g Chr6 (770605..771981) [1377 bp, 458 aa] {ON} highly
           similar to uniprot|P10507 Saccharomyces cerevisiae
           YLR163C MAS1 Smaller subunit of the mitochondrial
           processing protease essential processing enzyme that
           cleaves the N-terminal targeting sequences from
           mitochondrially imported proteins
          Length = 458

 Score = 40.4 bits (93), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 55/240 (22%), Positives = 94/240 (39%), Gaps = 21/240 (8%)

Query: 9   FDIDFYLPSSYSNRNQKLCRLPNGILALLISDNSVTTTACSISVATGSHSDPRDIPGIAH 68
           F   F  P + +  + +   L NG+        + ++    I V  GS ++     G AH
Sbjct: 7   FGTRFSRPLATAASSTRTSVLRNGLTVATEHIPNTSSATVGIFVDAGSRAENTRNNGTAH 66

Query: 69  LCEHMILAAGSKKYPKPGLFHEVLAANNGSQ-NAFTTGEQTTFYFELPTSTAIEQNTFGE 127
             EH+    G+K   + G+  E+   N GS  NA+T+ E T +Y     +  + QN    
Sbjct: 67  FLEHLAF-KGTKNRTQVGIELEI--ENIGSHLNAYTSRENTVYY-----AKTLTQN-IPN 117

Query: 128 ILDIFSSFFKKPLFNEVLTNKEIYAI--ESEHDGNMSNTSKILYHAERLLSNKSHPFHNF 185
            +D+ S    + + +     +E   I  ESE    M +  ++++     ++ K  P    
Sbjct: 118 AVDVLSDILTRSVLDARAIERERDVIIRESEEVDKMYD--EVVFDHLHAITYKDQPLGRT 175

Query: 186 STGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALANFGDI 245
             G I       N+K    ++ L +Y   NY    M +   G      L + A   FG I
Sbjct: 176 ILGPIE------NIKTIQRRD-LQDYISKNYKGDRMVLAGAGAVDHEKLVEYADKYFGHI 228

>KNAG0K00690 Chr11 complement(124385..127477) [3093 bp, 1030 aa]
           {ON} Anc_3.93 YOL098C
          Length = 1030

 Score = 40.8 bits (94), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 41/179 (22%), Positives = 71/179 (39%), Gaps = 33/179 (18%)

Query: 65  GIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAIEQNT 124
           G  H  EH++   GSK+YP  GL          S NA+T  + T +       T      
Sbjct: 56  GAPHTLEHLVFM-GSKQYPYKGLLDTAGNLCMSSTNAWTATDHTAYSL-----TTAGWEG 109

Query: 125 FGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKS----- 179
           F ++L ++      P   +     E++ I+ E   N+S+   ++Y     + N+S     
Sbjct: 110 FAKLLPVYLDHVLFPTLTDDACVTEVHHIDPE---NLSDKG-VVYSEMDAIENQSWFITN 165

Query: 180 -------HP----FHNFSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKG 227
                  HP    + + + G  H L  + N       E + ++ K+ Y S N+ + I G
Sbjct: 166 LAMQRLVHPNGSGYRSETGGLTHQLRDLTN-------EQIRQFHKDMYSSDNLCLIITG 217

>ZYRO0C03806g Chr3 complement(301873..303270) [1398 bp, 465 aa] {ON}
           highly similar to uniprot|P10507 Saccharomyces
           cerevisiae YLR163C MAS1 Smaller subunit of the
           mitochondrial processing protease essential processing
           enzyme that cleaves the N-terminal targeting sequences
           from mitochondrially imported proteins
          Length = 465

 Score = 40.4 bits (93), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 52/220 (23%), Positives = 93/220 (42%), Gaps = 21/220 (9%)

Query: 29  LPNGILALLISDNSVTTTACSISVATGSHSDPRDIPGIAHLCEHMILAAGSKKYPKPGLF 88
           LPNG+        +V++    I V  GS ++     G AH  EH+    G+K   + G+ 
Sbjct: 34  LPNGLTVASERLPNVSSATVGIFVDAGSRAENARNNGTAHFLEHLAF-KGTKNRSQTGIE 92

Query: 89  HEVLAANNGSQ-NAFTTGEQTTFYFELPTSTAIEQNTFGEILDIFSSFFKKPLFNEVLTN 147
            E+   N GS  NA+T+ E T ++     + ++E++     ++I S    + + +     
Sbjct: 93  LEI--ENIGSHLNAYTSRENTVYF-----AKSLEED-VPRAVEILSDILTRSVLDP---- 140

Query: 148 KEIYAIESEHDGNMSNTSKILYHAERLLSNKSH--PFHNFSTGNIHTLSKVVNLKKYNLK 205
               AIE E D  +  + ++    + ++ +  H   + N + G    L  + N+K    +
Sbjct: 141 ---KAIERERDVIIRESEEVDKMYDEVVFDHLHDVAYKNQALGRT-ILGPIKNIKTIT-R 195

Query: 206 EMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALANFGDI 245
           E L  Y   NY    M +   G      L + A  +FG I
Sbjct: 196 EDLKNYIDKNYKGDRMVLAGAGAIDHEKLIEYAQKSFGHI 235

>Ecym_4191 Chr4 (396094..397482) [1389 bp, 462 aa] {ON} similar to
           Ashbya gossypii AGL138C
          Length = 462

 Score = 40.4 bits (93), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 55/226 (24%), Positives = 98/226 (43%), Gaps = 23/226 (10%)

Query: 25  KLCRLPNGI-LALLISDNSVTTTACSISVATGSHSDPRDIPGIAHLCEHMILAAGSKKYP 83
           ++ +L NGI +A  +  N+ T T   I V  GS ++     G AH  EH+    G+    
Sbjct: 26  QISQLSNGITVASEVLPNTSTAT-VGIFVDAGSRAENSRNNGTAHFLEHLAF-KGTTNRS 83

Query: 84  KPGLFHEVLAANNGSQ-NAFTTGEQTTFYFELPTSTAIEQNTFGEILDIFSSFFKKPLFN 142
           + G+  E+   N GS  NA+T+ E T +Y     + +++++   + +DI S    +   N
Sbjct: 84  QVGIELEI--ENIGSHLNAYTSRENTVYY-----AKSLKED-IPKAMDILSDILTRSTLN 135

Query: 143 EVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSHP--FHNFSTGNIHTLSKVVNLK 200
                    AIE E D  +  + ++    + ++ +  H   + + + G    L  + N+K
Sbjct: 136 P-------KAIERERDVIIRESEEVDKMYDEVVFDHLHAITYKDQALGRT-ILGPIENIK 187

Query: 201 KYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALANFGDIK 246
               K+ L EY   NY    M +   G    + L +     FG I+
Sbjct: 188 SIQRKD-LAEYISTNYTGDRMALVGAGSVDHDKLVEYGERYFGHIR 232

>YLR163C Chr12 complement(491866..493254) [1389 bp, 462 aa] {ON}
           MAS1Smaller subunit of the mitochondrial processing
           protease (MPP), essential processing enzyme that cleaves
           the N-terminal targeting sequences from mitochondrially
           imported proteins
          Length = 462

 Score = 40.0 bits (92), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 51/224 (22%), Positives = 89/224 (39%), Gaps = 21/224 (9%)

Query: 25  KLCRLPNGILALLISDNSVTTTACSISVATGSHSDPRDIPGIAHLCEHMILAAGSKKYPK 84
           +  +LPNG+        + ++    I V  GS ++     G AH  EH+    G++   +
Sbjct: 27  RTSKLPNGLTIATEYIPNTSSATVGIFVDAGSRAENVKNNGTAHFLEHLAF-KGTQNRSQ 85

Query: 85  PGLFHEVLAANNGSQ-NAFTTGEQTTFYFELPTSTAIEQNTFGEILDIFSSFFKKPLFNE 143
            G+  E+   N GS  NA+T+ E T +Y +        Q    + +DI S    K + + 
Sbjct: 86  QGIELEI--ENIGSHLNAYTSRENTVYYAKS------LQEDIPKAVDILSDILTKSVLDN 137

Query: 144 VLTNKEIYAI--ESEHDGNMSNTSKILYHAERLLSNKSHPFHNFSTGNIHTLSKVVNLKK 201
               +E   I  ESE    M +  ++++     ++ K  P      G I  +  +    +
Sbjct: 138 SAIERERDVIIRESEEVDKMYD--EVVFDHLHEITYKDQPLGRTILGPIKNIKSIT---R 192

Query: 202 YNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALANFGDI 245
            +LK    +Y   NY    M +   G      L + A   FG +
Sbjct: 193 TDLK----DYITKNYKGDRMVLAGAGAVDHEKLVQYAQKYFGHV 232

>AFR334W Chr6 (1043252..1046341) [3090 bp, 1029 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL098C
          Length = 1029

 Score = 39.3 bits (90), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 42/90 (46%), Gaps = 6/90 (6%)

Query: 65  GIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAIEQNT 124
           G+ H  EH+I   GS++YP+ GL          + NA+T  + T   +EL ++  +    
Sbjct: 57  GVPHTLEHLIFM-GSQRYPRKGLLDTAGGITMSTTNAYTASDHTA--YELVSAGWL---G 110

Query: 125 FGEILDIFSSFFKKPLFNEVLTNKEIYAIE 154
           F ++L ++      P   E     E+Y ++
Sbjct: 111 FKKLLPVYLDHLLHPTLTEHAFTTEVYHLD 140

>NDAI0G04280 Chr7 (1027206..1030310) [3105 bp, 1034 aa] {ON}
           Anc_3.93 YOL098C
          Length = 1034

 Score = 39.3 bits (90), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 47/104 (45%), Gaps = 8/104 (7%)

Query: 53  ATGSHSDPRDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYF 112
           A G+   P D  G+ H  EH+I   GSK++P  GL   V      S NA+T  +QT +  
Sbjct: 47  AVGTEC-PND-SGVPHTLEHLIFM-GSKEHPYKGLLDTVGNLCMSSTNAWTATDQTVY-- 101

Query: 113 ELPTSTAIEQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESE 156
              T T+     F ++L  + +    P   +     E+Y ++ E
Sbjct: 102 ---TLTSAGWKGFSKLLPSYLNHILFPTLTDEACTTEVYHVDPE 142

>SAKL0H14168g Chr8 (1211470..1212855) [1386 bp, 461 aa] {ON} highly
           similar to uniprot|P10507 Saccharomyces cerevisiae
           YLR163C MAS1 Smaller subunit of the mitochondrial
           processing protease essential processing enzyme that
           cleaves the N-terminal targeting sequences from
           mitochondrially imported proteins
          Length = 461

 Score = 38.9 bits (89), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 57/251 (22%), Positives = 100/251 (39%), Gaps = 31/251 (12%)

Query: 25  KLCRLPNGILALLISDNSVTTTACSISVATGSHSDPRDIPGIAHLCEHMILAAGSKKYPK 84
           ++  L NG+        + +T    I V  GS ++     G AH  EH+    G++   +
Sbjct: 26  QISVLANGLTVASERIPNTSTATVGIFVDAGSRAENAKNNGTAHFLEHLAF-KGTQNRTQ 84

Query: 85  PGLFHEVLAANNGSQ-NAFTTGEQTTFYFELPTSTAIEQNTFGEILDIFSSFFKKPLFNE 143
            G+  E+   N GS  NA+T+ E T +Y     + ++E N   + +DI S    + + + 
Sbjct: 85  TGIELEI--ENIGSHLNAYTSRENTVYY-----AKSLE-NDIPQAVDILSDILTRSVLDP 136

Query: 144 VLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSHP--FHNFSTGNIHTLSKVVNLKK 201
                   AIE E D  +  + ++    + ++ +  H   + +   G    L  + N+K 
Sbjct: 137 -------RAIERERDVIIRESEEVDKMYDEVVFDHLHAIVYQDQPLGRT-ILGPIKNIKT 188

Query: 202 YNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALANFGDIKDKDE----------L 251
              ++ L  Y   NY    M +   G    + L   A   FG I+   +          L
Sbjct: 189 IQ-RDDLQAYISKNYSGDRMVLVGAGAVDHHKLVDYAQTYFGHIRKSQQPVPLGSPRGPL 247

Query: 252 TKFHINSIKPQ 262
             FH N +K Q
Sbjct: 248 PVFHGNELKFQ 258

>Skud_12.230 Chr12 complement(438565..439953) [1389 bp, 462 aa] {ON}
           YLR163C (REAL)
          Length = 462

 Score = 38.5 bits (88), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 49/224 (21%), Positives = 86/224 (38%), Gaps = 21/224 (9%)

Query: 25  KLCRLPNGILALLISDNSVTTTACSISVATGSHSDPRDIPGIAHLCEHMILAAGSKKYPK 84
           +  RLPNG+        + ++    I V  GS ++     G AH  EH+    G++   +
Sbjct: 27  RTSRLPNGLTIATEYIPNTSSATVGIFVDAGSRAENVKNNGTAHFLEHLAF-KGTQNRSQ 85

Query: 85  PGLFHEVLAANNGSQ-NAFTTGEQTTFYFELPTSTAIEQNTFGEILDIFSSFFKKPLF-- 141
            G+  E+   N GS  NA+T+ E T +Y +        Q    + + I S    K +   
Sbjct: 86  QGIELEI--ENIGSHLNAYTSRENTVYYAKS------LQEDIPKAVGILSDILTKSVLDN 137

Query: 142 NEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSHPFHNFSTGNIHTLSKVVNLKK 201
           N +   +++   ESE    M +  ++++     ++ K  P      G I  +  +     
Sbjct: 138 NAIERERDVIIRESEEVDKMYD--EVVFDHLHEITYKDQPLGRTILGPIKNIKSIT---- 191

Query: 202 YNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALANFGDI 245
              +  L  Y   NY    M +   G      L + A   FG +
Sbjct: 192 ---RSDLKNYITRNYKGDRMVLAGAGAVDHEELVEYAQKYFGHV 232

>ZYRO0B06490g Chr2 (517721..520807) [3087 bp, 1028 aa] {ON} similar
           to uniprot|Q12496 Saccharomyces cerevisiae YOL098C
           Hypothetical ORF
          Length = 1028

 Score = 38.9 bits (89), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 46/107 (42%), Gaps = 10/107 (9%)

Query: 51  SVATGSHSDPRDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTF 110
           +VAT   +D     G  H  EH++   GS+KYP  GL          S NA+T  +QT +
Sbjct: 47  AVATECPTDS----GAPHTLEHLVFM-GSQKYPYKGLLDTAGNLCMSSTNAWTATDQTVY 101

Query: 111 YFELPTSTAIEQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESEH 157
                T T      F ++L ++      P   +     E++ I+ +H
Sbjct: 102 -----TLTTAGWQGFKKLLPVYLDHILNPTLTDESCLTEVHHIDPDH 143

>SAKL0C09504g Chr3 complement(865789..868998) [3210 bp, 1069 aa]
           {ON} similar to uniprot|Q12496 Saccharomyces cerevisiae
           YOL098C Hypothetical ORF
          Length = 1069

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 51/119 (42%), Gaps = 10/119 (8%)

Query: 38  ISDNSVTTTACSISVATGSHSDPRDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNG 97
           I+ NS        ++AT   +D     G+ H  EH+I   GS+K+P  GL          
Sbjct: 63  INSNSSPLVQGYFALATECPTDS----GVPHTLEHLIFM-GSRKFPFKGLLDTAGNLCMS 117

Query: 98  SQNAFTTGEQTTFYFELPTSTAIEQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESE 156
           S NA+T  +QT +     T T+     F ++L ++      P   +     E+Y ++ E
Sbjct: 118 STNAWTATDQTVY-----TLTSAGWLGFKKLLPVYLDHVLNPTLTDEACCTEVYHVDPE 171

>KLLA0B00957g Chr2 complement(73661..76609) [2949 bp, 982 aa] {ON}
           similar to uniprot|P32898 YDR430C Saccharomyces
           cerevisiae CYM1 Cytosolic metalloprotease
          Length = 982

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 43/91 (47%), Gaps = 5/91 (5%)

Query: 53  ATGSHSDPRDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYF 112
           + G  ++P D  G+ H+ EH  L  GS KYP    F ++L  +  +     TG   TFY 
Sbjct: 69  SIGFKTNPPDSTGVPHILEHTTL-CGSHKYPVRDPFFKMLNRSLANFMNAMTGHDYTFY- 126

Query: 113 ELPTSTAIEQNTFGEILDIFSSFFKKPLFNE 143
             P +T  E + F  + D++      PL N+
Sbjct: 127 --PFATTNETD-FANLRDVYLDATLNPLLNQ 154

>KAFR0C01430 Chr3 (292206..295313) [3108 bp, 1035 aa] {ON} Anc_3.93
           YOL098C
          Length = 1035

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 75/189 (39%), Gaps = 29/189 (15%)

Query: 51  SVATGSHSDPRDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTF 110
           +VAT   +D     G  H  EH+I   GS+K+   GL          S NA+T  +QT +
Sbjct: 47  AVATECPTDS----GTPHTLEHLIFM-GSQKHHYKGLLDTAGNLCMSSTNAWTATDQTVY 101

Query: 111 YFELPTSTAIEQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIE-----------SEHDG 159
                T T      F ++L  +      P   +     E+Y I+           SE + 
Sbjct: 102 -----TLTTAGWKGFQKLLPAYLDHILNPTLTDAACMTEVYHIDPEDLTDKGVVYSEMEA 156

Query: 160 NMSNTSKI-LYHAERLLSNKSHPFHNFSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFS 218
             S +  + +   +RLL  +   + + + G  + L K+ N       E +  + K+ Y S
Sbjct: 157 IESQSWFVTMLEKQRLLFPQGSGYRSETGGLTNNLRKLTN-------EEIKSFHKSQYSS 209

Query: 219 RNMTICIKG 227
            N+ I + G
Sbjct: 210 HNLCIIVCG 218

>ADR184W Chr4 (1025969..1028941) [2973 bp, 990 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR430C (CYM1)
          Length = 990

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 49/112 (43%), Gaps = 7/112 (6%)

Query: 53  ATGSHSDPRDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGS-QNAFTTGEQTTFY 111
           + G  + P D  G+ H+ EH  L  GS+KYP    F ++L  +  +  NA T  + T + 
Sbjct: 69  SVGFRTPPPDATGVPHILEHTTL-CGSQKYPVRDPFFKMLNRSLANFMNAMTAHDHTFYP 127

Query: 112 FELPTSTAIEQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSN 163
           F         Q  F  + D++     +PL       +E + +E    G+ S+
Sbjct: 128 F-----ATTNQKDFANLRDLYLDATLRPLLRHADFLQEGWRLEHRDVGDASS 174

>Ecym_3585 Chr3 (1108374..1111472) [3099 bp, 1032 aa] {ON} similar
           to Ashbya gossypii AFR334W
          Length = 1032

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 69/175 (39%), Gaps = 25/175 (14%)

Query: 65  GIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAIEQNT 124
           G  H  EH+I   GSKKYP  GL          + NA+T  +QT +     + T+     
Sbjct: 57  GAPHTLEHLIFM-GSKKYPWKGLLDISGGITMSNTNAWTATDQTVY-----SLTSAGWVG 110

Query: 125 FGEILDIFSSFFKKPLFNEVLTNKEIYAIE-----------SEHDGNMSNTSKIL-YHAE 172
           F ++L ++      P   +     E+Y I+           SE +G  S    I     +
Sbjct: 111 FKKLLLVYLDHIVNPRLTDEACTTEVYYIDPKDLVDKGVVYSEMEGIESAAYSITNLEVQ 170

Query: 173 RLLSNKSHPFHNFSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKG 227
           RL+  + + + + + G    L K+ N       E + ++    Y   N+ + I G
Sbjct: 171 RLMFPEGNAYRSETGGLTKNLRKLSN-------EEIRKFHAEKYSPDNLCLIICG 218

>KLTH0G04092g Chr7 complement(325076..328048) [2973 bp, 990 aa] {ON}
           similar to uniprot|P32898 YDR430C Saccharomyces
           cerevisiae CYM1 Cytosolic metalloprotease
          Length = 990

 Score = 37.7 bits (86), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 42/84 (50%), Gaps = 5/84 (5%)

Query: 58  SDPRDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTS 117
           ++P D  G+ H+ EH  L  GS+KYP    F ++L  +  +     TG   TFY   P +
Sbjct: 74  TNPPDASGVPHILEHTTL-CGSEKYPVRDPFFKMLNRSLANFMNAMTGHDYTFY---PFA 129

Query: 118 TAIEQNTFGEILDIFSSFFKKPLF 141
           TA + + F  + D++     KPL 
Sbjct: 130 TANKAD-FANLRDVYLDATFKPLL 152

>YOL098C Chr15 complement(132725..135838) [3114 bp, 1037 aa] {ON}
           Putative metalloprotease
          Length = 1037

 Score = 37.7 bits (86), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 42/96 (43%), Gaps = 6/96 (6%)

Query: 65  GIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAIEQNT 124
           G  H  EH+I   GSK YP  GL       +  + NA+T  +QT +     T ++     
Sbjct: 57  GAPHTLEHLIFM-GSKSYPYKGLLDTAGNLSLSNTNAWTDTDQTVY-----TLSSAGWKG 110

Query: 125 FGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGN 160
           F ++L  +      P   +     E+Y I+ E+ G+
Sbjct: 111 FSKLLPAYLDHILHPTLTDEACLTEVYHIDPENLGD 146

>TPHA0D02430 Chr4 complement(499608..502574) [2967 bp, 988 aa] {ON}
           Anc_5.541 YDR430C
          Length = 988

 Score = 37.4 bits (85), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 50/187 (26%), Positives = 78/187 (41%), Gaps = 35/187 (18%)

Query: 53  ATGSHSDPRDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAAN-NGSQNAFTTGEQTTFY 111
           + G  ++P D  G+ H+ EH  L  GS KYP    F ++L  + +   NA T  + T F 
Sbjct: 69  SIGFKTNPPDSTGVPHILEHTTL-CGSVKYPVRDPFFKMLNRSLSNFMNAMTAHDYTFFP 127

Query: 112 FELPTSTAIEQNTFGEILDIFSSFFKKPL------FNE--VLTNKEIY----------AI 153
           F         QN F  + D++     +PL      F E   L NK++            +
Sbjct: 128 F-----ATTNQNDFKNLRDVYIDATLRPLLKAEDFFQEGWRLENKDLTDPKSDLQFKGVV 182

Query: 154 ESEHDGNMSNTSKILYHAERLLSNKSHPFHNFSTGNIHTLSKVVNLKKYNLKEMLFEYFK 213
            +E  G +SN +   Y+         +P  N S G+    +K+ NL+     E L E+ +
Sbjct: 183 YNEMKGQISNAN---YYFWTKFQESLYPSLNNSGGDP---TKITNLR----YEDLVEFHE 232

Query: 214 NNYFSRN 220
            NY   N
Sbjct: 233 KNYHPSN 239

>KLLA0F27071g Chr6 complement(2496781..2499894) [3114 bp, 1037 aa]
           {ON} similar to uniprot|Q12496 Saccharomyces cerevisiae
           YOL098C Hypothetical ORF
          Length = 1037

 Score = 37.4 bits (85), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 40/92 (43%), Gaps = 6/92 (6%)

Query: 65  GIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAIEQNT 124
           G+ H  EH+I   GS+KYP  GL          + NA+T  +QT +     T +      
Sbjct: 57  GVPHTLEHLIFM-GSEKYPYKGLLDTAGNLCMSNTNAWTATDQTVY-----TLSTAGWKG 110

Query: 125 FGEILDIFSSFFKKPLFNEVLTNKEIYAIESE 156
           F ++L ++      P   E     E+Y I+ +
Sbjct: 111 FKKLLPVYLDHLFFPTLTEDACTTEVYHIDPD 142

>Suva_10.260 Chr10 complement(463944..465332) [1389 bp, 462 aa] {ON}
           YLR163C (REAL)
          Length = 462

 Score = 37.0 bits (84), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 52/226 (23%), Positives = 89/226 (39%), Gaps = 25/226 (11%)

Query: 25  KLCRLPNG--ILALLISDNSVTTTACSISVATGSHSDPRDIPGIAHLCEHMILAAGSKKY 82
           +  +LPNG  I +  I + S  T    I V  GS ++     G AH  EH+    G++  
Sbjct: 27  RTSKLPNGLTIASEYIPNTSSAT--VGIFVDAGSRAENIKNNGTAHFLEHLAF-KGTQNR 83

Query: 83  PKPGLFHEVLAANNGSQ-NAFTTGEQTTFYFELPTSTAIEQNTFGEILDIFSSFFKKPLF 141
            + G+  E+   N GS  NA+T+ E T +Y +        Q    + ++I S    K + 
Sbjct: 84  SQQGIELEI--ENIGSHLNAYTSRENTVYYAKS------LQEDIPKAVEILSDILTKSVL 135

Query: 142 --NEVLTNKEIYAIESEHDGNMSNTSKILYHAERLLSNKSHPFHNFSTGNIHTLSKVVNL 199
             N +   +++   ESE    M +  ++++     ++ K  P      G I  +  +   
Sbjct: 136 DSNAIERERDVIIRESEEVDKMYD--EVVFDHLHEITYKDQPLGRTILGPIKNIKSIT-- 191

Query: 200 KKYNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALANFGDI 245
                +  L  Y   NY    M +   G      L + A   FG +
Sbjct: 192 -----RSDLKNYITKNYKGDRMVLAGAGAVDHEKLVEHAQKYFGHV 232

>TBLA0H01010 Chr8 (217060..218559) [1500 bp, 499 aa] {ON} Anc_8.376
           YLR163C
          Length = 499

 Score = 37.0 bits (84), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 51/228 (22%), Positives = 86/228 (37%), Gaps = 21/228 (9%)

Query: 25  KLCRLPNGILALLISDNSVTTTACSISVATGSHSDPRDIPGIAHLCEHMILAAGSKKYPK 84
           K   L NG+        + +T +  I V  GS ++     G AH  EH+     + +  +
Sbjct: 61  KTTVLSNGLTVASEYIPNTSTASIGIYVDAGSRAENSKNNGTAHFLEHLAFKGTTTRSQR 120

Query: 85  PGLFHEVLAANNGSQ-NAFTTGEQTTFYFELPTSTAIEQNTFGEILDIFSSFFKKPLFNE 143
                E++  N GS  NA+T+ E T +Y +        ++     +DI S    K   ++
Sbjct: 121 D---IELVIENLGSHLNAYTSRENTVYYAK------TLKDNIPNAIDILSDILTKSTLDK 171

Query: 144 VLTNKEIYAI--ESEHDGNMSNTSKILYHAERLLSNKSHPFHNFSTGNIHTLSKVVNLKK 201
               +E   I  ESE    M +  ++++     +  K  P      G I  ++ +     
Sbjct: 172 NAIERERSVIIRESEEVDQMYD--EVVFDHLHEIVYKDQPLGRTILGPIKNINTI----- 224

Query: 202 YNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALANFGDIKDKD 249
              +  L  Y   NY    M +   G  +   L K A   FG +K  D
Sbjct: 225 --QRNDLQNYITTNYKGDRMVLAGAGDVNHEELVKYAEKYFGHVKKSD 270

>KNAG0A02760 Chr1 (301136..302539) [1404 bp, 467 aa] {ON} Anc_8.376
           YLR163C
          Length = 467

 Score = 37.0 bits (84), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 50/212 (23%), Positives = 90/212 (42%), Gaps = 22/212 (10%)

Query: 41  NSVTTTACSISVATGSHSDPRDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQ- 99
           N+ + T   I V  GS ++     G AH  EH+    G+K   + G+  E+   N GS  
Sbjct: 47  NTASAT-VGIFVDAGSRAENVKNNGTAHFLEHLAFK-GTKNRSQRGIELEI--ENIGSHL 102

Query: 100 NAFTTGEQTTFYFELPTSTAIEQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAI--ESEH 157
           NA+T+ E T +Y     + ++ ++   + +DI S    K + +     +E   I  ESE 
Sbjct: 103 NAYTSRENTVYY-----AKSLRED-IPKAVDILSDILTKSVLDPKAIERERDVIIRESEE 156

Query: 158 DGNMSNTSKILYHAERLLSNKSHPFHNFSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYF 217
              M +  ++++     ++ +  P      G I  +    ++K+ +L+     Y   NY 
Sbjct: 157 VDKMYD--EVVFDHLHEIAYRDQPLGRTILGPIKNIK---SIKRTDLQN----YIMTNYK 207

Query: 218 SRNMTICIKGPQSLNSLTKLALANFGDIKDKD 249
              M +   G    ++L   A   FG +K  D
Sbjct: 208 GDRMVLASAGSVDHDNLVAYAQKYFGHLKRSD 239

>Smik_15.58 Chr15 complement(95835..98951) [3117 bp, 1038 aa] {ON}
           YOL098C (REAL)
          Length = 1038

 Score = 37.0 bits (84), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 45/190 (23%), Positives = 79/190 (41%), Gaps = 24/190 (12%)

Query: 51  SVATGSHSDPRDIP---GIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQ 107
           ++  G  + P + P   G  H  EH++   GSK YP  GL       +    NA+T  +Q
Sbjct: 40  TLVHGYFAVPTECPNDSGAPHTLEHLVFM-GSKSYPYKGLLDTAGNLSLSVTNAWTDTDQ 98

Query: 108 TTFYFELPTSTAIEQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKI 167
           T +     T ++     F ++L  +      P   +     E+Y I+ E   N+S+   +
Sbjct: 99  TVY-----TLSSAGWKGFSKLLPAYLDHILHPTLTDEACLTEVYHIDPE---NLSDKGVV 150

Query: 168 LYHAERL------LSNKSHPFHNFSTGNIHTLSKVVNLKKYNLK----EMLFEYFKNNYF 217
               E +      +SN       F  G+ +  S+   L K NL+    E + ++ K+ Y 
Sbjct: 151 FSEMEAIETQGWYISNLEKQRLMFPEGSGYR-SETGGLTK-NLRTLTSEEIRQFHKSLYS 208

Query: 218 SRNMTICIKG 227
           S N+ + + G
Sbjct: 209 SDNLCVIVCG 218

>Skud_15.55 Chr15 complement(92056..95172) [3117 bp, 1038 aa] {ON}
           YOL098C (REAL)
          Length = 1038

 Score = 36.6 bits (83), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 31/127 (24%), Positives = 51/127 (40%), Gaps = 12/127 (9%)

Query: 51  SVATGSHSDPRDIP---GIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQ 107
           ++  G  + P + P   G  H  EH+I   GSK YP  GL       +    NA+T  +Q
Sbjct: 40  TLVHGYFAVPTECPNDSGAPHTLEHLIFM-GSKSYPYKGLLDTAGNLSMSITNAWTDTDQ 98

Query: 108 TTFYFELPTSTAIEQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKI 167
           T +     T  +     F ++L  +      P   +     E+Y I+ E   N+S+   +
Sbjct: 99  TVY-----TLASAGWKGFSKLLPTYLDHILHPTLTDEACLTEVYHIDPE---NLSDKGVV 150

Query: 168 LYHAERL 174
               E +
Sbjct: 151 FSEMEAI 157

>TDEL0D05310 Chr4 (961842..964949) [3108 bp, 1035 aa] {ON} Anc_3.93
           YOL098C
          Length = 1035

 Score = 36.6 bits (83), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 42/200 (21%), Positives = 80/200 (40%), Gaps = 29/200 (14%)

Query: 51  SVATGSHSDPRDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTF 110
           +VAT   +D     G  H  EH+I   GS+++P  GL          S NA+T  +QT +
Sbjct: 47  AVATECPTDS----GAPHTLEHLIFM-GSQQHPYKGLLDTAGNLCMSSTNAWTATDQTVY 101

Query: 111 YFELPTSTAIEQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIE-----------SEHDG 159
                T T+     F ++L  +      P   +     E+Y ++           SE D 
Sbjct: 102 -----TLTSAGWQGFKQLLPAYLDHILNPTLTDAACLTEVYHVDPDDLSDKGVVFSEMDA 156

Query: 160 NMSNTSKI-LYHAERLLSNKSHPFHNFSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFS 218
             S +  + +   +RL+  +   + + + G    L ++ N       + + ++ K+ Y  
Sbjct: 157 IESQSWFVTMLEKQRLMFPEGSGYRSETGGLTPNLRQISN-------DEIRKFHKDAYSP 209

Query: 219 RNMTICIKGPQSLNSLTKLA 238
            N+ + + G    + L K+ 
Sbjct: 210 DNLCLIVSGNVPEDELLKIV 229

>KAFR0H02030 Chr8 (374862..376250) [1389 bp, 462 aa] {ON} Anc_8.376
           YLR163C
          Length = 462

 Score = 35.8 bits (81), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 51/228 (22%), Positives = 89/228 (39%), Gaps = 21/228 (9%)

Query: 25  KLCRLPNGILALLISDNSVTTTACSISVATGSHSDPRDIPGIAHLCEHMILAAGSKKYPK 84
           +   LPNG+        + ++    I V  GS ++     G AH  EH+    G++   +
Sbjct: 26  RTSTLPNGLTIATEYIPNTSSATVGIFVDAGSRAENVKNNGTAHFLEHLAF-KGTENRSQ 84

Query: 85  PGLFHEVLAANNGSQ-NAFTTGEQTTFYFELPTSTAIEQNTFGEILDIFSSFFKKPLFNE 143
             +  E+   N GS  NA+T+ E T +Y +        QN   + ++I S    K   + 
Sbjct: 85  RAIELEI--ENIGSHLNAYTSRENTVYYAKS------LQNDIPKAVEILSDILTKSTLDP 136

Query: 144 VLTNKEIYAI--ESEHDGNMSNTSKILYHAERLLSNKSHPFHNFSTGNIHTLSKVVNLKK 201
               +E   I  ESE    M +  ++++     ++ K  P      G I  +  +    +
Sbjct: 137 RAIERERDVIIRESEEVDKMYD--EVVFDHLHDIAYKDQPLGRTILGPIKNIKSI---SR 191

Query: 202 YNLKEMLFEYFKNNYFSRNMTICIKGPQSLNSLTKLALANFGDIKDKD 249
            +LK     Y   NY    M +   G    ++L   A   FG ++  D
Sbjct: 192 TDLK----SYINKNYKGDRMVLAGAGAVDHDNLVTYAQKYFGHLQKSD 235

>TBLA0A06940 Chr1 complement(1694417..1697392) [2976 bp, 991 aa]
           {ON} Anc_5.541 YDR430C
          Length = 991

 Score = 36.2 bits (82), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 33/66 (50%), Gaps = 2/66 (3%)

Query: 53  ATGSHSDPRDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAAN-NGSQNAFTTGEQTTFY 111
             G  ++P D  G+AH+ EH  L  GSKKYP    F ++L  + +   NA T  + T + 
Sbjct: 70  CVGFKTNPPDSTGVAHILEHTTL-CGSKKYPVRDPFFKMLNRSLSNFMNAMTGHDYTMYP 128

Query: 112 FELPTS 117
           F    S
Sbjct: 129 FATTNS 134

>Kwal_47.18577 s47 (880989..883952) [2964 bp, 987 aa] {ON} YDR430C
           (CYM1) - Hypothetical ORF [contig 193] FULL
          Length = 987

 Score = 35.8 bits (81), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 39/75 (52%), Gaps = 5/75 (6%)

Query: 58  SDPRDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTS 117
           ++P D  G+ H+ EH  L  GS+KYP    F ++L  +  +     TG   TFY   P +
Sbjct: 74  TNPPDATGVPHILEHTTL-CGSQKYPVRDPFFKMLNRSLANFMNAMTGHDYTFY---PFA 129

Query: 118 TAIEQNTFGEILDIF 132
           TA + + F  + D++
Sbjct: 130 TANKAD-FANLRDVY 143

>ZYRO0D12870g Chr4 complement(1083883..1086843) [2961 bp, 986 aa]
           {ON} highly similar to uniprot|P32898 YDR430C
           Saccharomyces cerevisiae CYM1 Cytosolic metalloprotease
          Length = 986

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 45/97 (46%), Gaps = 9/97 (9%)

Query: 55  GSHSDPRDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFEL 114
           G  ++P +  G+ H+ EH  L  GS KYP    F ++L  +  +     TG   TFY   
Sbjct: 71  GFKTNPPNATGVPHILEHTTLC-GSVKYPVRDPFFKMLNRSLSNFMNAMTGPDYTFY--- 126

Query: 115 PTSTAIEQNTFGEILDIFSSFFKKPLFNEVLTNKEIY 151
           P ST   +  F  + D++        FN +LT ++ Y
Sbjct: 127 PFSTT-NRADFANLRDVYVD----ATFNPLLTPEDFY 158

>Smik_4.704 Chr4 complement(1246246..1249215) [2970 bp, 989 aa] {ON}
           YDR430C (REAL)
          Length = 989

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 46/99 (46%), Gaps = 5/99 (5%)

Query: 58  SDPRDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTS 117
           ++P D  G+ H+ EH  L  GS KYP    F ++L  +  +     TG   TF+   P S
Sbjct: 74  TNPPDATGVPHILEHTTL-CGSVKYPVRDPFFKMLNKSLANFMNAMTGPDYTFF---PFS 129

Query: 118 TAIEQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESE 156
           T   Q+ F  +  ++      PL  +   ++E + +E E
Sbjct: 130 TTNPQD-FANLRGVYLDSTLNPLLKQEDFDQEGWRLEHE 167

>NCAS0F01140 Chr6 complement(224043..227009) [2967 bp, 988 aa] {ON}
           Anc_5.541 YDR430C
          Length = 988

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 52/114 (45%), Gaps = 7/114 (6%)

Query: 58  SDPRDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTS 117
           ++P +  G+ H+ EH  L  GSKKYP    F ++L  +  +     TG   TF F   T+
Sbjct: 74  TNPPNSTGVPHVLEHTTLC-GSKKYPVRDPFFKMLNKSLANFMNAMTGHDYTF-FPFATT 131

Query: 118 TAIEQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHA 171
            A +   F  + D++      PL  +    +E + +  EHD     T+ I++  
Sbjct: 132 NAKD---FNNLRDVYLDATLNPLLKQEDFYQEGWRL--EHDTVTDVTTPIVFKG 180

>Ecym_4076 Chr4 complement(159621..162587) [2967 bp, 988 aa] {ON}
           similar to Ashbya gossypii ADR184W
          Length = 988

 Score = 34.3 bits (77), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 43/89 (48%), Gaps = 5/89 (5%)

Query: 53  ATGSHSDPRDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYF 112
           + G  ++P D  G+ H+ EH  L A S+KYP    F ++L  +  +     TG   TFY 
Sbjct: 69  SIGFKTNPPDKSGVPHILEHTTLCA-SQKYPVRDPFFKMLNRSLANFMNAMTGHDYTFY- 126

Query: 113 ELPTSTAIEQNTFGEILDIFSSFFKKPLF 141
             P +T  +++ F  + D++      PL 
Sbjct: 127 --PFATTNKKD-FANLRDLYLDATLHPLL 152

>Suva_15.67 Chr15 complement(105988..109104) [3117 bp, 1038 aa] {ON}
           YOL098C (REAL)
          Length = 1038

 Score = 34.3 bits (77), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 38/178 (21%), Positives = 67/178 (37%), Gaps = 31/178 (17%)

Query: 65  GIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTAIEQNT 124
           G  H  EH+I   GS  +P  GL       +    NA+T  +QT +     T  +     
Sbjct: 57  GAPHTLEHLIFM-GSNSHPYKGLLDTAGNLSMSVTNAWTDTDQTVY-----TLASAGWKG 110

Query: 125 FGEILDIFSSFFKKPLFNEVLTNKEIYAIESEHDGNMSNTSKILYHAE------------ 172
           F ++L ++      P   +     E+Y ++ E   N+S+   +    E            
Sbjct: 111 FSKLLPVYLDHILNPTLTDEACLTEVYHVDPE---NLSDKGVVFSEMEAIETQSWYISAL 167

Query: 173 ---RLLSNKSHPFHNFSTGNIHTLSKVVNLKKYNLKEMLFEYFKNNYFSRNMTICIKG 227
              RL+  +   + + + G    L  + N       E + E+ K+ Y S N+ + I G
Sbjct: 168 EKQRLMFPEGSGYRSETGGLTKNLRTLTN-------EEIREFHKSLYSSDNLCVIICG 218

>KNAG0C03910 Chr3 complement(766674..769112) [2439 bp, 812 aa] {ON}
           Anc_7.327 YDL148C
          Length = 812

 Score = 34.3 bits (77), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 396 KLTNTGVKKLQNIIDILLQQVVKLLVDNFTENL-AYFLAENNIISILRFINSDVEINPMD 454
           KL     ++L     +LL+ ++ L   N+T N+ AY   +N ++SIL+ ++        D
Sbjct: 422 KLAEGNKERLGTFTGVLLKHILFLSDQNYTSNVQAYEATQNTLVSILKTLSEKYNRALSD 481

Query: 455 ECSELSGLLQENFKL 469
           EC      +Q+ FK+
Sbjct: 482 ECRRTINEIQKRFKV 496

>CAGL0F03157g Chr6 complement(307854..310826) [2973 bp, 990 aa] {ON}
           similar to uniprot|P32898 Saccharomyces cerevisiae
           YDR430c
          Length = 990

 Score = 33.5 bits (75), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 40/84 (47%), Gaps = 5/84 (5%)

Query: 60  PRDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTSTA 119
           P D  G+ H+ EH  L  GS+KYP    F ++L  +  +     TG   TF F   T+ A
Sbjct: 76  PPDATGVPHILEHTTL-CGSEKYPVRDPFFKMLNKSLANFMNAMTGPDYTF-FPFATTNA 133

Query: 120 IEQNTFGEILDIFSSFFKKPLFNE 143
            +   F  + D++ +   +PL  E
Sbjct: 134 RD---FVNLRDVYLNSTLRPLLKE 154

>SAKL0G05236g Chr7 complement(429654..432614) [2961 bp, 986 aa] {ON}
           highly similar to uniprot|P32898 Saccharomyces
           cerevisiae YDR430C CYM1 Cytosolic metalloprotease
          Length = 986

 Score = 33.5 bits (75), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 58  SDPRDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFY 111
           ++P +  G+ H+ EHM L  GS KYP    F ++L  +  +     TG   TFY
Sbjct: 74  TNPPNATGVPHILEHMTLC-GSHKYPVRDPFFKMLNRSLANFMNAMTGHDYTFY 126

>Kpol_1004.32 s1004 complement(64627..67593) [2967 bp, 988 aa] {ON}
           complement(64627..67593) [2967 nt, 989 aa]
          Length = 988

 Score = 33.1 bits (74), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 41/85 (48%), Gaps = 7/85 (8%)

Query: 58  SDPRDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAAN-NGSQNAFTTGEQTTFYFELPT 116
           ++P D  G+ H+ EH  L  GS+KYP    F ++L  + +   NA T  + T F    P 
Sbjct: 74  TNPPDCTGVPHILEHTTL-CGSQKYPVRDPFFKMLNRSLSNFMNAMTAHDYTFF----PF 128

Query: 117 STAIEQNTFGEILDIFSSFFKKPLF 141
           ST  E + F  + D++      PL 
Sbjct: 129 STTNETD-FKNLRDVYIDATLNPLL 152

>Skud_4.705 Chr4 complement(1245869..1248838) [2970 bp, 989 aa] {ON}
           YDR430C (REAL)
          Length = 989

 Score = 33.1 bits (74), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 45/97 (46%), Gaps = 5/97 (5%)

Query: 58  SDPRDIPGIAHLCEHMILAAGSKKYPKPGLFHEVLAANNGSQNAFTTGEQTTFYFELPTS 117
           ++P D  G+ H+ EH  L  GS KYP    F ++L  +  +     TG   TF+   P S
Sbjct: 74  TNPPDATGVPHILEHTTL-CGSVKYPVRDPFFKMLNKSLANFMNAMTGPDYTFF---PFS 129

Query: 118 TAIEQNTFGEILDIFSSFFKKPLFNEVLTNKEIYAIE 154
           T   Q+ F  +  ++      PL  +   ++E + +E
Sbjct: 130 TTNPQD-FANLRGVYLDSTLNPLLKQEDFDQEGWRLE 165

>SAKL0G07524g Chr7 (624810..626708) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q66RD4 Saccharomyces cerevisiae YDR349C YPS7
           Putative GPI-anchored aspartic protease located in the
           cytoplasm and endoplasmic reticulum
          Length = 632

 Score = 32.7 bits (73), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 33/141 (23%), Positives = 64/141 (45%), Gaps = 7/141 (4%)

Query: 395 LKLTNTGVKKLQNIIDILLQQVVKLLVDNFTENLAYFLAENNIISI--LRFINSDVEINP 452
           + +  T V    N+  ++   + K +++N T +  ++  +++ +S+  + FIN D   + 
Sbjct: 119 ISINGTAVMDTLNLTSVIDNSLGKNILENLTNSTVHWDLDSDTLSMTNVSFINVDYSGSI 178

Query: 453 MDECSELSGLLQENFKLFNPKYLFYGSEFLLLENESLPQKNNMFDGNSTTFWIGQAIKFQ 512
                 L G +    +  N    F GS F L   E L   NN+ D +S + W+GQ +  +
Sbjct: 179 TQGALGLGGRITAPGEDINSDG-FDGSFFFL---EQL-VANNVIDSSSYSLWLGQDVGQE 233

Query: 513 TFLKEFMNWENIKIVGIGDID 533
               E+   EN   + +G +D
Sbjct: 234 DDEDEYYTEENCGKLVLGAVD 254

>Kpol_461.16 s461 complement(30618..33041) [2424 bp, 807 aa] {ON}
           complement(30618..33041) [2424 nt, 808 aa]
          Length = 807

 Score = 32.7 bits (73), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 41/74 (55%), Gaps = 1/74 (1%)

Query: 396 KLTNTGVKKLQNIIDILLQQVVKLLVDNFTENLAYFL-AENNIISILRFINSDVEINPMD 454
           KL     ++L     ILL+ ++ L   N+++++A F   +N++IS+L+ ++     +  +
Sbjct: 416 KLAEGNKERLGRFTGILLRHILFLADQNYSKDIATFKEVQNSLISVLKTLSEKYNRDLSE 475

Query: 455 ECSELSGLLQENFK 468
            C E++  + E FK
Sbjct: 476 TCREITTEIHERFK 489

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 134,168,892
Number of extensions: 6371673
Number of successful extensions: 19898
Number of sequences better than 10.0: 142
Number of HSP's gapped: 20253
Number of HSP's successfully gapped: 177
Length of query: 1202
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1081
Effective length of database: 39,606,813
Effective search space: 42814964853
Effective search space used: 42814964853
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 72 (32.3 bits)