Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0C045708.270ON60860830530.0
Smik_4.3628.270ON6483445126e-56
Kpol_392.18.270ON4243474961e-55
Skud_4.3788.270ON6523475012e-54
Suva_2.2778.270ON6493374994e-54
YDR118W (APC4)8.270ON6523494978e-54
ZYRO0C01474g8.270ON5993354834e-52
TDEL0F039708.270ON6194414774e-51
KAFR0B054608.270ON6104544623e-49
NCAS0B037908.270ON6123434034e-41
TPHA0J007908.270ON6853923975e-40
KNAG0H031908.270ON6223393912e-39
NDAI0J012708.270ON7353853613e-35
Kwal_56.237668.270ON7404103524e-34
SAKL0H16852g8.270ON6443503266e-31
CAGL0B01859g8.270ON6223543142e-29
KLTH0G13508g8.270ON6453423123e-29
Ecym_43008.270ON7153291912e-14
AGR078C8.270ON7153321662e-11
KLLA0F19316g8.270ON6711531055e-04
KLTH0F11352g3.396ON631122810.36
KAFR0I022001.402ON36537714.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0C04570
         (608 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0C04570 Chr3 (1107010..1108836) [1827 bp, 608 aa] {ON} Anc_8...  1180   0.0  
Smik_4.362 Chr4 (647135..649081) [1947 bp, 648 aa] {ON} YDR118W ...   201   6e-56
Kpol_392.1 s392 complement(1..1272) [1272 bp, 424 aa] {ON} compl...   195   1e-55
Skud_4.378 Chr4 (657502..659460) [1959 bp, 652 aa] {ON} YDR118W ...   197   2e-54
Suva_2.277 Chr2 (480574..481624,481684..482579) [1947 bp, 649 aa...   196   4e-54
YDR118W Chr4 (685882..687840) [1959 bp, 652 aa] {ON}  APC4Subuni...   196   8e-54
ZYRO0C01474g Chr3 complement(106209..108008) [1800 bp, 599 aa] {...   190   4e-52
TDEL0F03970 Chr6 (735393..737252) [1860 bp, 619 aa] {ON} Anc_8.2...   188   4e-51
KAFR0B05460 Chr2 complement(1118755..1120587) [1833 bp, 610 aa] ...   182   3e-49
NCAS0B03790 Chr2 complement(676973..678811) [1839 bp, 612 aa] {O...   159   4e-41
TPHA0J00790 Chr10 (182991..185048) [2058 bp, 685 aa] {ON} Anc_8....   157   5e-40
KNAG0H03190 Chr8 complement(597550..599418) [1869 bp, 622 aa] {O...   155   2e-39
NDAI0J01270 Chr10 (297256..299463) [2208 bp, 735 aa] {ON} Anc_8....   143   3e-35
Kwal_56.23766 s56 complement(695943..698165) [2223 bp, 740 aa] {...   140   4e-34
SAKL0H16852g Chr8 complement(1482321..1484255) [1935 bp, 644 aa]...   130   6e-31
CAGL0B01859g Chr2 (168976..170844) [1869 bp, 622 aa] {ON} weakly...   125   2e-29
KLTH0G13508g Chr7 complement(1159671..1161608) [1938 bp, 645 aa]...   124   3e-29
Ecym_4300 Chr4 complement(642023..644170) [2148 bp, 715 aa] {ON}...    78   2e-14
AGR078C Chr7 complement(877135..879282) [2148 bp, 715 aa] {ON} S...    69   2e-11
KLLA0F19316g Chr6 (1786659..1788674) [2016 bp, 671 aa] {ON} cons...    45   5e-04
KLTH0F11352g Chr6 complement(962701..964596) [1896 bp, 631 aa] {...    36   0.36 
KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.4...    32   4.7  

>TBLA0C04570 Chr3 (1107010..1108836) [1827 bp, 608 aa] {ON}
           Anc_8.270 YDR118W
          Length = 608

 Score = 1180 bits (3053), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 579/608 (95%), Positives = 579/608 (95%)

Query: 1   MSSVSFIENPKSNPTLPLTLCKSDSGLKVIRTADKSIIINYKIRNKNDIIYYQWENNIGN 60
           MSSVSFIENPKSNPTLPLTLCKSDSGLKVIRTADKSIIINYKIRNKNDIIYYQWENNIGN
Sbjct: 1   MSSVSFIENPKSNPTLPLTLCKSDSGLKVIRTADKSIIINYKIRNKNDIIYYQWENNIGN 60

Query: 61  YVAIFFQRGTVMIYDGIKTSRLLAMLNGGKPNVDAGIWDRYYFPNDNEKDIFDSDITLYM 120
           YVAIFFQRGTVMIYDGIKTSRLLAMLNGGKPNVDAGIWDRYYFPNDNEKDIFDSDITLYM
Sbjct: 61  YVAIFFQRGTVMIYDGIKTSRLLAMLNGGKPNVDAGIWDRYYFPNDNEKDIFDSDITLYM 120

Query: 121 PTLIQIIRDKEKICPGTYFPPHSTWRAKKEESLKNEFLDIHLLHHSVDDSFTFILNGELK 180
           PTLIQIIRDKEKICPGTYFPPHSTWRAKKEESLKNEFLDIHLLHHSVDDSFTFILNGELK
Sbjct: 121 PTLIQIIRDKEKICPGTYFPPHSTWRAKKEESLKNEFLDIHLLHHSVDDSFTFILNGELK 180

Query: 181 LPFPSNSTSGRAIGIIKGENNCFICFYQDLTVRMIDCHDLLQLKGNEILVDHFIRINHLL 240
           LPFPSNSTSGRAIGIIKGENNCFICFYQDLTVRMIDCHDLLQLKGNEILVDHFIRINHLL
Sbjct: 181 LPFPSNSTSGRAIGIIKGENNCFICFYQDLTVRMIDCHDLLQLKGNEILVDHFIRINHLL 240

Query: 241 KYLKEHIMFIKDNMSTPFNEFLTSVKGEATQEMMMENLITMLVSGYISTELEEWIRNTIG 300
           KYLKEHIMFIKDNMSTPFNEFLTSVKGEATQEMMMENLITMLVSGYISTELEEWIRNTIG
Sbjct: 241 KYLKEHIMFIKDNMSTPFNEFLTSVKGEATQEMMMENLITMLVSGYISTELEEWIRNTIG 300

Query: 301 IKNLTRWATLGGIFYEKGVDIITLMVIPACERFMILVARLQGLIEYVIVRNRCDNRGVNL 360
           IKNLTRWATLGGIFYEKGVDIITLMVIPACERFMILVARLQGLIEYVIVRNRCDNRGVNL
Sbjct: 301 IKNLTRWATLGGIFYEKGVDIITLMVIPACERFMILVARLQGLIEYVIVRNRCDNRGVNL 360

Query: 361 NSSYIENVKHAAKRFMKEALRMXXXXXXXXXXXXXXXHWFSENVRGVVQDEAVSGNILVK 420
           NSSYIENVKHAAKRFMKEALRM               HWFSENVRGVVQDEAVSGNILVK
Sbjct: 361 NSSYIENVKHAAKRFMKEALRMLEQLQLQKQLFEKFLHWFSENVRGVVQDEAVSGNILVK 420

Query: 421 NVNNCRDIVEYLEWSMGGGPNRVTELTQFEKXXXXXXXXXXXXXXDFVEPALSVAISIGD 480
           NVNNCRDIVEYLEWSMGGGPNRVTELTQFEK              DFVEPALSVAISIGD
Sbjct: 421 NVNNCRDIVEYLEWSMGGGPNRVTELTQFEKELEVVQENLNLLNQDFVEPALSVAISIGD 480

Query: 481 RKNIGAILGVCNPEGELLSMEKVMSLESTLVIYIIKYEMQGEMKYEIGLLNCNMENIFCQ 540
           RKNIGAILGVCNPEGELLSMEKVMSLESTLVIYIIKYEMQGEMKYEIGLLNCNMENIFCQ
Sbjct: 481 RKNIGAILGVCNPEGELLSMEKVMSLESTLVIYIIKYEMQGEMKYEIGLLNCNMENIFCQ 540

Query: 541 NEVKLGSRRQEVVETKINVEKRQFENDSNLFVIEKEDEFDVQVEFRNNDSVFTKKFVLNI 600
           NEVKLGSRRQEVVETKINVEKRQFENDSNLFVIEKEDEFDVQVEFRNNDSVFTKKFVLNI
Sbjct: 541 NEVKLGSRRQEVVETKINVEKRQFENDSNLFVIEKEDEFDVQVEFRNNDSVFTKKFVLNI 600

Query: 601 KEKSIEGC 608
           KEKSIEGC
Sbjct: 601 KEKSIEGC 608

>Smik_4.362 Chr4 (647135..649081) [1947 bp, 648 aa] {ON} YDR118W
           (REAL)
          Length = 648

 Score =  201 bits (512), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 110/344 (31%), Positives = 186/344 (54%), Gaps = 4/344 (1%)

Query: 13  NPTLPLTLCKSDSGLKVIRTADKSIIINYKIRNKNDIIYYQWENNIGNYVAIFFQRGTVM 72
           NP  P+   ++  GL + R +D + +    IRN N +  Y W+   G +++IFF+ GT+ 
Sbjct: 13  NPRFPIFATRTAKGLAINRVSDHARLAAIPIRNINLVANYNWDTVTGKFLSIFFKDGTIR 72

Query: 73  IYDGIKTSRLLAMLNGGKPNVDAGIWDRYYFPNDNEKDIFDSDITLYMPTLIQIIRDKEK 132
           I+D  K  RL++ L      +  G WDR    +++       +I  Y+P LI+ ++D ++
Sbjct: 73  IHDIFKDGRLVSFLRIPSTKISKGTWDRIPLESESGNGNLAYNIIDYLPKLIRYVKDSKR 132

Query: 133 ICPGTYFPPHSTWRAKKE-ESLKNEFLDIHLLHHSVDDSFTFILNGELKLPFPSNSTSGR 191
           I    Y PP+S WR   E E   NE LDIH++ +   D  T   NG+  +  P  +    
Sbjct: 133 INIVPYTPPNSLWRGPDEDEPENNEKLDIHIIFNEGHDKITVFFNGDYAIFVPVGADENE 192

Query: 192 AI--GIIKGENNCFICFYQDLTVRMIDCHDLLQLKGNEILVDHFIRINHLLKYLKEHIMF 249
                I+K ++  + CFY D TVR ++   LL+ + +  ++ + + I  L+ YL  HI F
Sbjct: 193 RFVKSIVKIQDGFYHCFYDDGTVRTLNLGPLLRSEPSMNILKYIMAIKELIGYLLNHIEF 252

Query: 250 IKDNMSTPFNEFLTSVKGEA-TQEMMMENLITMLVSGYISTELEEWIRNTIGIKNLTRWA 308
           I   + TP+ EF+  +  EA   + ++  L  + + G +S +LE+W+ N++G KN  RW 
Sbjct: 253 INRELVTPYLEFVNRLCDEAYGYDKLISELECLFLLGEVSCDLEDWLCNSVGEKNFKRWK 312

Query: 309 TLGGIFYEKGVDIITLMVIPACERFMILVARLQGLIEYVIVRNR 352
            LG   Y+K   I+TL+ +PACER +I V +L+G++E   ++N+
Sbjct: 313 CLGCEAYQKTTQILTLIFVPACERIIIFVEKLRGILEAFSIQNK 356

>Kpol_392.1 s392 complement(1..1272) [1272 bp, 424 aa] {ON}
           complement(1..1272) [1272 nt, 424 aa]
          Length = 424

 Score =  195 bits (496), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 110/347 (31%), Positives = 195/347 (56%), Gaps = 13/347 (3%)

Query: 11  KSNPTLPLTLCKSDSGLKVIRTADKSIIINYKIRNKNDIIYYQWENNIGNYVAIFFQRGT 70
           K NP   L + +SD GL V R  D S + +  I++ + +  Y+W+N  G ++++F   GT
Sbjct: 13  KYNPCFQLYVTRSDQGLAVYRIKDSSQLAHIFIKDFDTVAGYEWDNYSGRFISVFLTDGT 72

Query: 71  VMIYDGIKTSRLLAML-NGGKPNVDAGIWDRYYFPNDNEKDIFDSDITLYMPTLIQIIRD 129
           + IYD  K  RL++ + +  + NVD+ +WDR  F   ++  +FDS+I   +PTLI+ ++D
Sbjct: 73  IRIYDIFKNGRLVSYIRSSSQKNVDSCLWDRAEFSIPSKLQLFDSNIIECLPTLIKFVKD 132

Query: 130 KEKICPGTYFPPHSTWRAKKEESLKNE-------FLDIHLLHHSVDDSFTFILNG--ELK 180
              I    Y+PP+ +WR   +ES   +        LD+H+ H+  +D+FT ILNG  E+ 
Sbjct: 133 SRNINIIDYYPPNHSWRHVDKESQDTDKEIDFRNLLDVHIQHNPNEDNFTIILNGVYEIN 192

Query: 181 LPFPSNSTSGRAIGIIKGENNCFICFYQDLTVRMIDCHDLLQLKGNEILVDHFIRINHLL 240
                + +      ++K  N  ++ FY++   R I+ ++LL    +  L+ + + I +L 
Sbjct: 193 GIVMPDISKSEVYQLLKLHNGEYMSFYKNGHYRKINFNNLLSCNVSNGLLSNILEIRNLN 252

Query: 241 KYLKEHIMFIKDNMSTPFNEFLTSVKGEATQEMMM---ENLITMLVSGYISTELEEWIRN 297
           +Y+ +H+  IK  +  P+++F+  +  +A    M    + L ++L++G I+ E ++W+ N
Sbjct: 253 RYVNDHLDLIKRELIIPYSDFVKKICIDAYAGGMTKLNDELESLLLTGEINNEFKDWLVN 312

Query: 298 TIGIKNLTRWATLGGIFYEKGVDIITLMVIPACERFMILVARLQGLI 344
            IG +N  +W  LG   +EK V I+TL +IP+CERFMI + R  G +
Sbjct: 313 IIGDRNGKKWRKLGMDMFEKIVKILTLAIIPSCERFMIYLERTDGYL 359

>Skud_4.378 Chr4 (657502..659460) [1959 bp, 652 aa] {ON} YDR118W
           (REAL)
          Length = 652

 Score =  197 bits (501), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 104/347 (29%), Positives = 185/347 (53%), Gaps = 4/347 (1%)

Query: 13  NPTLPLTLCKSDSGLKVIRTADKSIIINYKIRNKNDIIYYQWENNIGNYVAIFFQRGTVM 72
           NP  P+   +   GL + R +D + I    +RN   +  Y W+   G +++IFF+ GTV 
Sbjct: 13  NPRFPIFATRITKGLAIHRVSDHARIAIIPVRNIALVANYSWDRTSGKFLSIFFKDGTVR 72

Query: 73  IYDGIKTSRLLAMLNGGKPNVDAGIWDRYYFPNDNEKDIFDSDITLYMPTLIQIIRDKEK 132
           I+D  K  RL++ L      +  GIWDR     + + + F  ++   +P LI+ ++D ++
Sbjct: 73  IHDIFKDGRLVSFLRVPSTKISRGIWDRIPLKREYDSETFAYNVIDILPKLIRFVKDSKR 132

Query: 133 ICPGTYFPPHSTWRAKKEESLKN-EFLDIHLLHHSVDDSFTFILNGELKLPFPSNSTSGR 191
           +    Y PP+  WR   E+  ++ E LD+H++ +  +D  T   NG+  +  P +     
Sbjct: 133 VSIVPYTPPNGLWRGPDEDDPESGEILDVHVIFNEGNDKITIFFNGDYTILLPMDDIENE 192

Query: 192 AI--GIIKGENNCFICFYQDLTVRMIDCHDLLQLKGNEILVDHFIRINHLLKYLKEHIMF 249
            I   ++K ++  + CFY D +VR ++   LL+ K +  L+ + + I  L+ YL  H+  
Sbjct: 193 RILESVVKVQDGFYHCFYNDGSVRTLNLQPLLRSKPSVDLLHYIMVIKELIGYLLAHVEL 252

Query: 250 IKDNMSTPFNEFLTSVKGEAT-QEMMMENLITMLVSGYISTELEEWIRNTIGIKNLTRWA 308
           I   + TP+ +F+  +  EA     +   L  + + G +S +LE+W+ N++G KNL +W 
Sbjct: 253 INRELITPYLDFVKRICDEAYGYNKLKSELECLFLLGEVSCDLEDWLCNSVGEKNLKKWK 312

Query: 309 TLGGIFYEKGVDIITLMVIPACERFMILVARLQGLIEYVIVRNRCDN 355
            LG   Y+K   I+TL+ +P CER +I V +L+G +E   V+N+ +N
Sbjct: 313 FLGCEAYQKTTQILTLVFVPTCERIIIFVEKLRGTLEAFSVQNKSNN 359

>Suva_2.277 Chr2 (480574..481624,481684..482579) [1947 bp, 649 aa]
           {ON} YDR118W (REAL)
          Length = 649

 Score =  196 bits (499), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 103/337 (30%), Positives = 180/337 (53%), Gaps = 4/337 (1%)

Query: 13  NPTLPLTLCKSDSGLKVIRTADKSIIINYKIRNKNDIIYYQWENNIGNYVAIFFQRGTVM 72
           NP  P+   +   GL + R +D + +    +RN   +  Y W+ + G +++IFF+ GT+ 
Sbjct: 9   NPRFPIFAIRVVKGLAIHRVSDHARLAVIPVRNIALVANYNWDVSTGKFLSIFFKDGTIR 68

Query: 73  IYDGIKTSRLLAMLNGGKPNVDAGIWDRYYFPNDNEKDIFDSDITLYMPTLIQIIRDKEK 132
           I+D  K  RL++ L   +  +  GIWDR     ++    F +++   +P LI+ ++D ++
Sbjct: 69  IHDIFKDGRLVSFLRIPRTKISRGIWDRIPLKYESSNRNFANNVIDVLPKLIRFVKDSKR 128

Query: 133 ICPGTYFPPHSTWRAKKEESLKN-EFLDIHLLHHSVDDSFTFILNGELKLPFPSNSTSGR 191
           +    Y PP+S WR   E+  +N E LDIH++ +  +D  T   NG+  +  P +     
Sbjct: 129 VTIAPYTPPNSLWRGPDEDDPENCENLDIHVIFNEGNDKITVFFNGDYAILLPVSDIENE 188

Query: 192 AI--GIIKGENNCFICFYQDLTVRMIDCHDLLQLKGNEILVDHFIRINHLLKYLKEHIMF 249
            I   ++K +N  + CFY D TV   +   LLQ + +  L+ + + I  L+ YL  HI F
Sbjct: 189 KILKSVVKVQNGFYHCFYNDGTVSTFNLERLLQSEPSVDLLRYMMVIKELIGYLLAHIEF 248

Query: 250 IKDNMSTPFNEFLTSVKGEAT-QEMMMENLITMLVSGYISTELEEWIRNTIGIKNLTRWA 308
           I   ++TP+ +F+  +  EA     +   L  + + G + ++L++W+ N +G KN  RW 
Sbjct: 249 INRELTTPYMDFVKRICDEAYGYSKLKSELKCLFLLGEVPSDLDDWLCNAVGEKNFKRWK 308

Query: 309 TLGGIFYEKGVDIITLMVIPACERFMILVARLQGLIE 345
            LG   Y+K V + TL  +P CER +I V +L+G++E
Sbjct: 309 VLGCEAYQKTVQVFTLAFVPTCERIIIFVQKLKGILE 345

>YDR118W Chr4 (685882..687840) [1959 bp, 652 aa] {ON}  APC4Subunit
           of the Anaphase-Promoting Complex/Cyclosome (APC/C),
           which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors, including mitotic
           cyclins, during the metaphase/anaphase transition;
           component of the platform domain of the APC/C, based on
           structural analysis
          Length = 652

 Score =  196 bits (497), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 114/349 (32%), Positives = 195/349 (55%), Gaps = 14/349 (4%)

Query: 13  NPTLPLTLCKSDSGLKVIRTADKSIIINYKIRNKNDIIYYQWENNIGNYVAIFFQRGTVM 72
           NP  P+   +   GL + R +D + +    IRN N +  Y W+   G +++IFF+ GT+ 
Sbjct: 13  NPLFPIFATRIAKGLAIYRVSDHARLAVIPIRNINLVANYDWDTTTGKFLSIFFKDGTIR 72

Query: 73  IYDGIKTSRLLAMLNGGKPNVDAGIWDRY---YFPNDNEKDIFDSDITLYMPTLIQIIRD 129
           I+D  K  RL++ L      +  GIWDR    Y PN+ +   F  +I   +P LI+ ++D
Sbjct: 73  IHDIFKDGRLVSFLRIPSTKISKGIWDRIPLRYEPNNRD---FACNIIDDLPKLIRFVKD 129

Query: 130 KEKICPGTYFPPHSTWRAKKEESL-KNEFLDIHLLHHSVDDSFTFILNGE----LKLPFP 184
            ++I    Y  P+S WR   E+ L  NE LD+H++ +  +D  T   NG+    L +   
Sbjct: 130 SKRINIVPYTQPNSLWRGPDEDDLDSNEKLDVHVVFNEGNDKITVFFNGDYAVFLSVDNI 189

Query: 185 SNSTSGRAIGIIKGENNCFICFYQDLTVRMIDCHDLLQLKGNEILVDHFIRINHLLKYLK 244
            N  S ++  IIK ++  + CFY+D TV+ ++   LLQ K +  L+++ + I  L+ Y+ 
Sbjct: 190 ENENSLKS--IIKVQDGFYQCFYEDGTVQTLNLGPLLQSKSSVNLLNYIMVIKELIGYML 247

Query: 245 EHIMFIKDNMSTPFNEFLTSVKGEATQEMMMEN-LITMLVSGYISTELEEWIRNTIGIKN 303
            H+ FI   ++TP+ +F+  +  EA     +++ L  + + G IS +LE+W+ N++G KN
Sbjct: 248 THLEFINRELATPYLDFVKRLCDEAYGYGKLKSELEALFLLGEISCDLEDWLCNSVGEKN 307

Query: 304 LTRWATLGGIFYEKGVDIITLMVIPACERFMILVARLQGLIEYVIVRNR 352
             RW  LG   Y+K V I+TL+ +PACER +I V +L+ +++   ++N+
Sbjct: 308 FKRWKYLGCEAYQKTVQILTLIFVPACERIIIYVEKLRAILQAFSIQNK 356

>ZYRO0C01474g Chr3 complement(106209..108008) [1800 bp, 599 aa] {ON}
           weakly similar to uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 599

 Score =  190 bits (483), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 104/335 (31%), Positives = 178/335 (53%), Gaps = 9/335 (2%)

Query: 13  NPTLPLTLCKSDSGLKVIRTADKSIIINYKIRNKNDIIYYQWENNIGNYVAIFFQRGTVM 72
           NP  PL + +   G  V R AD + I    +R+ + +  YQW+   G +++IF++ GTV 
Sbjct: 9   NPVYPLYVKQFTRGFSVHRMADDARIATIIVRDMSQVAGYQWDPITGKFLSIFYKDGTVR 68

Query: 73  IYDGIKTSRLLAMLNGGKPNVDAGIWDR--YYFPNDNEKD-IFDSDITLYMPTLIQIIRD 129
           IYDG ++ RL+++L        +GIWDR       +N KD   D D+T  MP +++  RD
Sbjct: 69  IYDGFRSGRLVSLLRASSNGAVSGIWDRIELLHSEENIKDWSIDHDVTEMMPKMVKFARD 128

Query: 130 KEKICPGTYFPPHSTWRAKKEESLKNEFLDIHLLHHSVDDSFTFILNGELKLPFPSNSTS 189
             ++C   Y  P   WR +  +   N  LD H++     DS + + +GE  +     +  
Sbjct: 129 SRQLCVVPYTLPSDVWRPQAADD-TNALLDAHVIR--CHDSLSVMFDGEFTISIQLAAIP 185

Query: 190 GRAIGIIKGENNCFICFYQDLTVRMIDCHDLLQLKGNEILVDHFIRINHLLKYLKEHIMF 249
              +  +  ++  ++ FYQD +V   D  +L++   +  L+ + I +  L +YL++HI  
Sbjct: 186 SPLVKFVSAQHQ-YLAFYQDGSVERFDLANLVKDPFSLRLLKNVITMRQLHRYLQDHIEL 244

Query: 250 IKDNMSTPFNEFLTSVKGEA--TQEMMMENLITMLVSGYISTELEEWIRNTIGIKNLTRW 307
           I+ ++  P++EFL      A    +++ E LI +++ G ++ ELE+W+ N++G KNL RW
Sbjct: 245 IQRDLLQPYDEFLERCCQGAFGGYDLLREQLIDLMLVGDVTPELEDWLVNSMGEKNLKRW 304

Query: 308 ATLGGIFYEKGVDIITLMVIPACERFMILVARLQG 342
             LG   Y K + ++TL  +PACER + L  R  G
Sbjct: 305 RKLGTDAYHKTLQVLTLACLPACERLISLGQRCTG 339

>TDEL0F03970 Chr6 (735393..737252) [1860 bp, 619 aa] {ON} Anc_8.270
           YDR118W
          Length = 619

 Score =  188 bits (477), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 126/441 (28%), Positives = 208/441 (47%), Gaps = 18/441 (4%)

Query: 13  NPTLPLTLCKSDSGLKVIRTADKSIIINYKIRNKNDIIYYQWENNIGNYVAIFFQRGTVM 72
           NP   L   K + GL + R AD + I    +R+ N +  +QW+   G  + +F++ G   
Sbjct: 12  NPLYSLYAKKFNKGLSICRVADNAKIATVAVRDLNVLAQFQWDPITGKRMTVFYKDGNAR 71

Query: 73  IYDGIKTSRLLAMLNGGKPNVDAGIWDRYYFPNDNEKDIFDSDITLYMPTLIQIIRDKEK 132
           IYD  +  +LLA+L   K  VD  IWDR           FD  +   MP +I+  RD  +
Sbjct: 72  IYDAFQAGKLLALLRISKTRVDGAIWDRIELSRQEVTFKFDHFVLNSMPKMIRFARDTRQ 131

Query: 133 ICPGTYFPPHSTWRAKKEE----SLKNEFLDIHLLHHSVDDSFTFILNGELKLPFPSNST 188
           I    Y PP+ TWR   EE      + E LD+HL+H   D+    +L+G+  L   +  +
Sbjct: 132 IFILPYEPPNKTWRLATEEEDGVKREKEILDVHLVHQE-DNGLVLMLDGDFILRLAAGPS 190

Query: 189 SGRAIGIIKGENNCFICFYQDLTVRMIDCHDLLQLKGNEILVDHFIRINHLLKYLKEHIM 248
                 I+  +   + CFY+D TV  +    L+Q      L+ HFI I  L  YL++H+ 
Sbjct: 191 GPALKDIVVADRGLYHCFYEDATVESLSLDQLIQCDATIQLIQHFIAIKQLNHYLQDHLD 250

Query: 249 FIKDNMSTPFNEFLTSVKGEA-TQEMMMENLITMLVSGYISTELEEWIRNTIGIKNLTRW 307
            IK ++  P+ EFLT +   A   E++ E L ++L+ G +S ELE W   T+G KN  +W
Sbjct: 251 LIKRDLVAPYTEFLTKICDAAFGYEILHEELESLLLGGGLSVELENWFCYTVGEKNFKKW 310

Query: 308 ATLGGIFYEKGVDIITLMVIPACERFMILVARLQGLIEYVIVRNRCDNRGVNLNSSYIEN 367
             +G   Y+K + I+TL  IPACER ++L  R +  ++ +    +        +SS   N
Sbjct: 311 KKMGLEMYQKTIQILTLSFIPACERVILLSERCRACLKAL----QLIESSTTTDSSEFAN 366

Query: 368 VKHAAKRFMKEALRMXXXXXXXXXXXXXXXHWFSENVRGVVQDEAVSGNILVKNVNNCR- 426
           +   ++ +++  +                  WF + +   + DE     + +   +NC+ 
Sbjct: 367 LTSLSQTYLRSTVETIQGVSAQEVLFQTFLQWFDDRLHEAL-DEDYKQKLSID--SNCKI 423

Query: 427 --DIVEYLEWSMGGGPNRVTE 445
              I  YL+  +   P++ +E
Sbjct: 424 GYQIATYLDLRI--NPDKQSE 442

>KAFR0B05460 Chr2 complement(1118755..1120587) [1833 bp, 610 aa]
           {ON} Anc_8.270 YDR118W
          Length = 610

 Score =  182 bits (462), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 125/454 (27%), Positives = 209/454 (46%), Gaps = 16/454 (3%)

Query: 9   NPKS------NPTLPLTLCKSDSGLKVIRTADKSIIINYKIRNKNDIIYYQWENNIGNYV 62
           NPK       N  LPL   K   GL V R +D + I +  I+    +    W+   G Y+
Sbjct: 5   NPKERSYCVYNKKLPLYTEKGPKGLMVYRRSDNTAIAHTIIKKWELVAGIYWDKISGKYL 64

Query: 63  AIFFQRGTVMIYDGIKTSRLLAMLNGGKPNVDAGIWDRYYFPNDNEKDIFDSDITLYMPT 122
           +IFF+ G++ I D  K  +L+A L     NVD   WDR      NE   F+ +I   MP+
Sbjct: 65  SIFFRDGSIRIIDVFKDGKLVAFLRTQFKNVDCTYWDRIEEQTTNEMKQFNKNIVDLMPS 124

Query: 123 LIQIIRDKEKICPGTYFPPHSTWRAKKEESLKNEFLDIHLLHHSVDDSFTFILNGE---- 178
           LIQ +    K+    Y P ++ WR    +  KN  +D+H LH S  DSF  +LNG+    
Sbjct: 125 LIQFVSSANKLSLIPYTPSNANWRELDAKWKKNRVIDMHCLHQSETDSFLMVLNGDYYLT 184

Query: 179 LKLPFPSNSTSGRAIGIIKGENNCFICFYQDLTVRMIDCHDLLQLKGNEILVDHFIRINH 238
           LK P    S    A  +IK  N+ + C Y+D + R ID    L  K    L++  + +  
Sbjct: 185 LKTPETDLSEKVPACSLIKSANSLYQCIYKDGSARKIDTSSFLSSKSCIDLLECILSLKD 244

Query: 239 LLKYLKEHIMFIKDNMSTPFNEFLTSV-KGEATQEMMMENLITMLVSGYISTELEEWIRN 297
           + KY + H+  ++  +  P+ +FL  +  G   +E ++  L    + G IS EL++W+  
Sbjct: 245 MSKYTRNHLDLLERVIIKPYLDFLEKICDGAFGREKLINELKITFLLGTISDELQDWLHY 304

Query: 298 TIGIKNLTRWATLGGIFYEKGVDIITLMVIPACERFMILVARLQGLI-EYVIVRNRCDNR 356
           ++G KN+T+W TL    Y++  ++ T+ ++ ACER ++L  R  GLI  +       DN 
Sbjct: 305 SVGDKNVTQWRTLCHDAYQQTTELFTIALMCACERMILLSERCFGLIMAFQFESGADDNS 364

Query: 357 GVNLNSSYIENVKHAAKRFMKEALRMXXXXXXXXXXXXXXXHWFSENVRGVVQDEAVSGN 416
            ++  +  + N++   K  +  A                   W ++ V   + D+     
Sbjct: 365 RLHELNELMSNLQDMLKSIIYTA----EESANKFEMLKIFLSWLNDRVHEELDDDYKPQL 420

Query: 417 ILVKNVNNCRDIVEYLEWSMGGGPNRVTELTQFE 450
            + +N N C  + +  E+ +  G     ++  F+
Sbjct: 421 SITQNSNTCYKLGKSFEYLLQEGKKDSEDILNFD 454

>NCAS0B03790 Chr2 complement(676973..678811) [1839 bp, 612 aa] {ON}
           Anc_8.270 YDR118W
          Length = 612

 Score =  159 bits (403), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 100/343 (29%), Positives = 173/343 (50%), Gaps = 15/343 (4%)

Query: 13  NPTLPLTLCKSDSGLKVIRTADKSIIINYKIRNKNDIIYYQWENNIGNYVAIFFQRGTVM 72
           NP+ P  L K+  G  V RT D + I+   IRN + +I   W +   NY+ + F  G+  
Sbjct: 12  NPSYPAKLYKTSYGFAVRRTRDDTQIVKIVIRNMDAVIATCWNSFGSNYLTVMFNDGSAR 71

Query: 73  IYDGIKTSRLLAML---NGGKPNVDAGIWDRYYF---PNDNEKDIFDSDITLYMPTLIQI 126
           I+D  +  +L+ +L   +G +  +D GIW +      PN+ E   FD DI+  MP+ I+ 
Sbjct: 72  IHDIFREGKLMTLLRLQDGFQKCMDTGIWSKLEVRQKPNEGE---FDRDISGLMPSPIKF 128

Query: 127 IRDKEKICPGTYFPPHSTWRAKKEESLKNEFLDIHLLHHSVDDSFTFILNGELKLPFPSN 186
           + +  ++    Y    + WR   +    N+ +DIH+ H+S  D +  ++NG  KL    N
Sbjct: 129 VNNAGQLEVVPYVVTQTQWRNVDKPLEVNDIIDIHMAHNSNTDEYLLMINGVYKLTIQPN 188

Query: 187 ST----SGRAIGIIKGENNC-FICFYQDLTVRMIDCHDLLQLKGNEILVDHFIRINHLLK 241
           ST    S +   II  E    F CFY+D     ID   L++   +  L++    +  L +
Sbjct: 189 STDENASNQLHKIIHLEKTAIFHCFYKDRKTSTIDLTTLMESTPHVSLLNVLTEMKQLHR 248

Query: 242 YLKEHIMFIKDNMSTPFNEFLTSVKGEATQEMMMENLITMLVSGYISTELEEWIRNTIGI 301
           Y+ +H+  I +++  P ++FL  V      + + ++L + ++ G ++  L  W+ N +G 
Sbjct: 249 YIVDHLDIIDNDLKKPLDDFL-EVTNILNIKDLSKSLKSFILYGLMAKSLNHWLCNVVGE 307

Query: 302 KNLTRWATLGGIFYEKGVDIITLMVIPACERFMILVARLQGLI 344
           KNL +W  L    Y+K + II+L V+PA E+  +L  R + L+
Sbjct: 308 KNLKKWKRLSETKYQKIIQIISLAVLPALEKLSLLSIRCEALV 350

>TPHA0J00790 Chr10 (182991..185048) [2058 bp, 685 aa] {ON} Anc_8.270
           YDR118W
          Length = 685

 Score =  157 bits (397), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 109/392 (27%), Positives = 191/392 (48%), Gaps = 27/392 (6%)

Query: 11  KSNPTLPLTLCKSDSGLKVIRTADKSIIINYKIRNKNDIIYYQWENNIGNYVAIFFQRGT 70
           K NP   L   KSD GL +   +D SI+    I++ + ++ + W++  G ++   F  G+
Sbjct: 13  KLNPIYQLYTFKSDKGLAICTISDHSILATIFIKDFSLVVDFFWDSITGKFLLFAFNDGS 72

Query: 71  VMIYDGIKTSRLLAMLNGGKPNVDAGIWDRYYFPN--DNEKDIFDSDITLYMPTLIQIIR 128
           + +YD  K  RL++        +    WDR       D +  IFD D+T  MPTL++ ++
Sbjct: 73  IRVYDIFKLGRLVSFFRSPLKQIKCVYWDRIIITETLDQQLKIFDYDLTNSMPTLVKFVK 132

Query: 129 DKEKICPGTYFPPHSTWRA-----------KKEESLKNEFLDIHLLH-HSVDDSFTFILN 176
           D + +           WR             K E   ++ LDIHLL+  S  D+F  ++N
Sbjct: 133 DPQGLQLVPVLKNTQAWRQIDVDLNLKLENSKTEVSTDDVLDIHLLYTESGMDNFAVLVN 192

Query: 177 GELKLP--FPSNSTSGRAIGIIKGENNCFICFYQDLTVRMIDCHDLLQLKGNEI---LVD 231
           G   L      N +  + I ++K     ++ FY++ + R+ID   +     N+I   L++
Sbjct: 193 GVYDLSDIHVPNRSPNKVIKLVKASQGKYLGFYENASYRLID---VTPFSSNDIRVNLLN 249

Query: 232 HFIRINHLLKYLKEHIMFIKDNMSTPFNEFLTSVKGEATQ--EMMMENLITMLVSGYIST 289
           + I + + +  LKE I  IK  + +PF  F+  V  +A +  + +  ++  +L++G IS 
Sbjct: 250 NSIDLRNSVSLLKEQIEIIKKELISPFESFINLVCVDAYEGYDNLYRSMTNLLLTGEISE 309

Query: 290 ELEEWIRNTIGIKNLTRWATLGGIFYEKGVDIITLMVIPACERFMILVARLQGLIEYVIV 349
           E E+W+ NTIG +NL +W  LG    +K V I++L+ IP  E+F+I   R+Q    Y+  
Sbjct: 310 EFEDWLINTIGERNLRKWKNLGIELLDKLVQILSLIFIPITEKFIITAERIQN---YITA 366

Query: 350 RNRCDNRGVNLNSSYIENVKHAAKRFMKEALR 381
               DN  +  N S I ++       +K +++
Sbjct: 367 MRLSDNSKILENDSEINDLILNLSNILKTSIK 398

>KNAG0H03190 Chr8 complement(597550..599418) [1869 bp, 622 aa] {ON}
           Anc_8.270 YDR118W
          Length = 622

 Score =  155 bits (391), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 90/339 (26%), Positives = 165/339 (48%), Gaps = 8/339 (2%)

Query: 13  NPTLPLTLCKSDSGLKVIRTADKSIIINYKIRNKNDIIYYQWENNIGNYVAIFFQRGTVM 72
           N  LPL + +    L V R  D S I +  IR+ + ++ YQW+   G  +++ FQ G++ 
Sbjct: 16  NNVLPLYVTRGTKQLVVNRDTDDSTIASTFIRDPSQVVSYQWDTIGGEIISVMFQDGSIR 75

Query: 73  IYDGIKTSRLLAMLNGGKPNVDAGIWDRYYFPNDNEKDIFDSD-ITLYMPTLIQIIRDKE 131
           I D +  ++L+A+L   +  +D  +WDR   P+  +   +D D IT  +P L++ +    
Sbjct: 76  INDVMYDAKLVALLRTQRTGLDCVLWDRIRLPSRAQSMEWDPDIITQSLPRLVKFMGSDA 135

Query: 132 KICPGTYFPPHSTWRAKKEESLKNEFLDIHLLHHSVDDSFTFILNGELKL----PFPSNS 187
                 Y P + +WR     +     LD+H LH  + D+   +LNGE +L    P   + 
Sbjct: 136 SPSMSPYLPTNHSWRFPNSGA-AGGILDVHFLHQKLGDTLVALLNGEYQLQLTGPHQEDQ 194

Query: 188 TSGRA-IGIIKGENNCFICFYQDLTVRMIDCHDLLQLKGNEILVDHFIRINHLLKYLKEH 246
           +  R  I     + + + C+Y+   VR +D    ++ K    L++ F+     L Y   H
Sbjct: 195 SELRKIIARTDSKRHVYNCYYKTGPVRQVDLTGFVEDKDTIKLLERFLLFQDYLGYFLAH 254

Query: 247 IMFIKDNMSTPFNEFLTSVKGEA-TQEMMMENLITMLVSGYISTELEEWIRNTIGIKNLT 305
           +  I+     P+ EF+  +  +A  +E + E+L    + G +  EL +W+  ++G +NL 
Sbjct: 255 LEPIQTECVEPYQEFIERLCEDAFGKEKLQESLTDHFLVGSMDEELRDWLVYSLGERNLE 314

Query: 306 RWATLGGIFYEKGVDIITLMVIPACERFMILVARLQGLI 344
            W +L    Y +   ++ + ++P  ER +IL  +LQ L+
Sbjct: 315 EWKSLMNTAYRRTSQVVLMCLVPVSERLIILCEQLQALV 353

>NDAI0J01270 Chr10 (297256..299463) [2208 bp, 735 aa] {ON} Anc_8.270
           YDR118W
          Length = 735

 Score =  143 bits (361), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 107/385 (27%), Positives = 180/385 (46%), Gaps = 40/385 (10%)

Query: 13  NPTLPLTLCKSDSGLKVIRTADKSIIINYKIRNKNDIIYYQWENNIGNYVAIFFQRGTVM 72
           NP+ PL L K+ + +   RT D   I N  IRN  ++I   W++  G Y+ I F  GT  
Sbjct: 28  NPSFPLYLTKTSNSIIARRTLDGFQISNIIIRNMQNVIAIDWDSKTGKYLTINFDDGTFR 87

Query: 73  IYDGIKTSRLLAMLNGG--------KPNVDAGIWDRYYFPNDNEKDIFDSDITLYMPTLI 124
           IYD  +  +L+ ++           K  VD  IWDR    N  ++  F+ DIT  MPTLI
Sbjct: 88  IYDIFQDGKLITLVRPQRNLLDIHRKTKVDNAIWDRLIILNSIQELEFNHDITKLMPTLI 147

Query: 125 QIIRDKEKI--CPGTYFPPHSTWR---------------------AKKEESLKNEFLDIH 161
           + ++D   I   P ++    + WR                       +E      +LD+H
Sbjct: 148 KFVKDSTNIYIVPYSHNEKQNIWREFQPVSSYKPISTNMDAIDMTTNQEVEKSMRYLDLH 207

Query: 162 LLHHSVDDSFTFILNG--ELKLPFPSNSTSGR--AIGIIKGE-NNCFICFYQDLTVRMID 216
           ++H    D FT  +NG  ++ L   + +T+ R   + I+K   +  + CF+++ ++R + 
Sbjct: 208 IIHVIDPDCFTIAINGTYQINLVRKTINTTNRNKIVRILKSTVHGVYHCFHENGSIRSLY 267

Query: 217 CHDLLQLKGNEILVDHFIRINHLLKYLKEHIMFIKDNMSTPFNEFLTSVKGEATQE---- 272
                    +  L++ F+ IN ++KY + H+  I  ++   F +FL     E  Q     
Sbjct: 268 FSHFTSSTLHVELLEIFMEINEMIKYFQYHLDLINKHLLKTFTDFLYPTIFEEKQNGGGN 327

Query: 273 MMMENLITMLVSGYISTELEEWIRNTIGIKNLTRWATLGGIFYEKGVDIITLMVIPACER 332
            M++ L   L+SG +S EL EW+  +IG KNL +W  L    Y K + I +L +IPACE 
Sbjct: 328 SMLQQLKLSLLSGEMSEELIEWLTLSIGEKNLKKWKRLSEELYSKSIQIFSLALIPACEL 387

Query: 333 FMILVARLQGLIEYVIVRNRCDNRG 357
            ++L  +   ++  + +  +   R 
Sbjct: 388 TLLLSQKCLAILNAIEIEKKARIRA 412

>Kwal_56.23766 s56 complement(695943..698165) [2223 bp, 740 aa] {ON}
           YDR118W (APC4) - subunit of the anaphase promoting
           complex (APC) [contig 173] FULL
          Length = 740

 Score =  140 bits (352), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 105/410 (25%), Positives = 183/410 (44%), Gaps = 22/410 (5%)

Query: 13  NPTLPLTLCKSDSGLKVIRTADKSIIINYKIRNKNDIIYYQWENNIGNYVAIFFQRGTVM 72
           NP L L L  +D  + V R  D   I    +R++++I+  QWE N     A+F   G V 
Sbjct: 22  NPRLSLYLVLTDKKIAVNRVIDGQQIAAVNLRDEHEIVGIQWEKNESKLFAVFQSNGVVR 81

Query: 73  IYDGIKTSRLLAMLN------GGKPNVDAGIW---DRYYFPNDNEKDIFDSDITLYMPTL 123
           IYD      L  M+N        +  VDA +W   +   FP        D DIT  MP +
Sbjct: 82  IYDCSIGGSLREMVNLVEEGQAAEVKVDAVVWMTVEWAKFPESYRG--LDFDITTLMPGM 139

Query: 124 IQIIRDKEKICPGTYFPPHSTWRAKKEESLKNEFLD--IHLLHHSVDDSFTFILNGELKL 181
           ++++RD +++          +W       L  ++ D  I L H      +   ++G+L L
Sbjct: 140 VRLVRDSKQLSLAPLDLGKLSW-------LDGKYGDAAIFLAHDCESTEYMVAIDGQLSL 192

Query: 182 PFPSNSTSGRAIGIIKGENNCFICFYQDLTVRMIDCHDLLQLKGNEILVDHFIRINHLLK 241
            FPS   +   I + +G +  F+   +D T++ +     L+      LV    +I  L +
Sbjct: 193 RFPSGIRNVHKI-LPQGGSGSFLAVGKDGTLQWVTL-KFLECALMRELVKSSGQIRFLCR 250

Query: 242 YLKEHIMFIKDNMSTPFNEFLTSVKGEATQEMMMENLITMLVSGYISTELEEWIRNTIGI 301
           YL E++      +  P+  FLT + G    + +   L  +L++GYI  +LEEW+ N++G 
Sbjct: 251 YLAENVSLCHTELIEPYRVFLTRLMGAYEGDDLATRLRDILLTGYIPDDLEEWLCNSVGD 310

Query: 302 KNLTRWATLGGIFYEKGVDIITLMVIPACERFMILVARLQGLIEYVIVRNRCDNRGVNLN 361
           KN  RW  L    Y    +++TL V+PACER ++   R+QG+ + + ++  C +    L 
Sbjct: 311 KNYKRWKQLSTRMYGDLNNVLTLAVVPACERLILAAERMQGIHKSLKLQRFCKDYAGELT 370

Query: 362 SSYIENVKHAAKRFMKEALRMXXXXXXXXXXXXXXXHWFSENVRGVVQDE 411
           +  ++ +    +  ++  L +                WF + V   V ++
Sbjct: 371 TVELQTLISECQTLLEFTLNLITELNRDAALHQVFAEWFYDVVMETVDED 420

>SAKL0H16852g Chr8 complement(1482321..1484255) [1935 bp, 644 aa]
           {ON} some similarities with uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 644

 Score =  130 bits (326), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 93/350 (26%), Positives = 153/350 (43%), Gaps = 23/350 (6%)

Query: 13  NPTLPLTLCKSDSGLKVIRTADKSIIINYKIRNKNDIIYYQWENNIGNYVAIFFQRGTVM 72
           NP L L L  +  G+ V R  D   I    +++   I+ YQWE + G   A+    G + 
Sbjct: 21  NPVLSLFLVPTVKGIAVNRPVDGQRIATVSVKDHGTIVDYQWEQSEGRIFAVCHSNGIIR 80

Query: 73  IYDGIKTSRLLAMLNGGKPNVDA--GIW--DRYYFPNDNEKDIFDSDITLYMPTLIQIIR 128
           +YD     + +  +  G  + D     W  D + F      ++FD +IT  MP L++ ++
Sbjct: 81  LYDSSLAGKSVGSVILGDSDCDVLKFCWSQDSWTF-GSKFSNVFDHEITSLMPRLVKFVK 139

Query: 129 DKEKICPGTYFPPHSTWRAKKEESLKNEFLDIHLLHHSVDDSFTFILNGELKLPFP---- 184
           D  ++   T  P        +   L      I L + S        ++G  KL F     
Sbjct: 140 DSRQL---TMLPTDVGDGVPRWSKLDGNKSFIFLGYDSKRQKILMAIDGAFKLSFSVAAL 196

Query: 185 ---------SNSTSGRAIGIIKGENNCFICFYQDLTVRMIDCHDLLQLKGNEILVDHFIR 235
                     +S       I+K +N  ++    D  ++ I   D L       ++    R
Sbjct: 197 VAAGERLDEGDSVPNNVRDILKYDNGEYLVITDDWYIQKIK-FDFLNCNLTREMISCCNR 255

Query: 236 INHLLKYLKEHIMFIKDNMSTPFNEFLTSVKGEATQEMMMENLITMLVSGYISTELEEWI 295
           I  L K L E +  +K  +  P+ +F+  V G A +  ++ +L  +L +G +  ELE+W+
Sbjct: 256 IRSLHKQLHESVSLVKTELVEPYTQFIERVLG-AYEGDLIGDLTELLFTGSVPPELEDWL 314

Query: 296 RNTIGIKNLTRWATLGGIFYEKGVDIITLMVIPACERFMILVARLQGLIE 345
            NTIG KNL RW  L  + YE  V I+ L ++P CER ++   RL G+I+
Sbjct: 315 SNTIGDKNLRRWKKLSSVMYENAVKIMVLTMVPVCERLILCGERLHGIIK 364

>CAGL0B01859g Chr2 (168976..170844) [1869 bp, 622 aa] {ON} weakly
           similar to uniprot|Q04601 Saccharomyces cerevisiae
           YDR118w APC4 subunit of the anaphase promoting complex
          Length = 622

 Score =  125 bits (314), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 96/354 (27%), Positives = 167/354 (47%), Gaps = 28/354 (7%)

Query: 11  KSNPTLPLTLCKSDSGLKVIR-TADKSIIINYKIRNKNDIIYYQWENNIGNYVAIFFQRG 69
           K NP   L     D+   VIR T+D   I+   +RN   ++ Y W+   G Y+A+F + G
Sbjct: 12  KYNPKYGLFGMNEDNHSLVIRRTSDNVGIVKINVRNIVLLLDYFWDPIDGKYLALFLKDG 71

Query: 70  TVMIYDGIKTSRLLA-------MLNGGKPNVDAGIWDRYYFPND--NEKDIFDSDITLYM 120
           +V IYD     +L++       +L   KP++D  +WDR   P    +E  I ++D+T  M
Sbjct: 72  SVRIYDIFNGGKLISFLRVLPVVLGSNKPSLDCCLWDRIIIPKSGSSELRIPNNDLTESM 131

Query: 121 PTLIQIIRDKEKICPGTYFPPHST---WRAKKEESLKNEFLDIHLLHHSVDDSFTFILNG 177
           PTL++ ++D ++I      P  S    WR+      K   +D+HL +       T ++NG
Sbjct: 132 PTLVKFVQDAKQI---DIIPNRSITKLWRSIGNNEKK--VVDVHLGYSCSSAQVTILING 186

Query: 178 ELKLPFPSNSTSGRAIGIIKGENNCFIC------FYQDLTVRMIDCHDLLQLKGNEILVD 231
           E  +    +  +     I    N    C       + D +   ID   +L       L++
Sbjct: 187 EYLIEKSVSDINQIQKKIPISLNKKEFCEAIYEIHFDDYSRLQIDLTGILLNDDKLDLIE 246

Query: 232 HFIRINHLLKYLKEHIMFIKDNMSTPFNEFLTSVKGEATQEMMMENLITMLVSGYISTEL 291
             I++ +    +K+H   I+ ++  P+ EFL S+ G    +++      + + G + T+L
Sbjct: 247 TQIKMTNHFDLIKDHFNLIEKSVLAPYYEFLESIGGINDLDVLER----LFLIGELDTKL 302

Query: 292 EEWIRNTIGIKNLTRWATLGGIFYEKGVDIITLMVIPACERFMILVARLQGLIE 345
             W + TI  KNL +W+ LG  FY     ++ ++ +P CER M+L  R+ G+I+
Sbjct: 303 GNWFKETINEKNLKKWSRLGNEFYSNFKQVLIIVFVPICERLMVLTNRINGMIK 356

>KLTH0G13508g Chr7 complement(1159671..1161608) [1938 bp, 645 aa]
           {ON} some similarities with uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C)
          Length = 645

 Score =  124 bits (312), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 94/342 (27%), Positives = 150/342 (43%), Gaps = 22/342 (6%)

Query: 13  NPTLPLTLCKSDSGLKVIRTADKSIIINYKIRNKNDIIYYQWENNIGNYVAIFFQRGTVM 72
           NP L L L   D  + V R  D   I    +R    +I  QWE   G   A+FF  G V 
Sbjct: 22  NPRLSLYLVLGDKTVSVNRAIDGQRIAAVNLRGDGQLIGAQWELAEGKLFALFFGNGAVR 81

Query: 73  IYD---GIKTSRLLAMLNGGKP---NVDAGIWDRYYFPN-DNEKDIFDSDITLYMPTLIQ 125
           IYD   G     ++ +++ G+     VD  +W    +     E    + +IT  +P +++
Sbjct: 82  IYDCATGGSLREVVDLVDEGQSADVTVDTAVWSGAQWAQFRQEYKGLNIEITKQLPGMVR 141

Query: 126 IIRDKEKICPGTYFPPHSTWRAKKEESLKNEFLDIHLLHHSVDDSFTFILNGELKLPFPS 185
           ++RD +++           W A   +        I L H      +   ++G L +  PS
Sbjct: 142 LVRDAKQLSVVPLETGKLRWLADPGKDAA-----IFLGHDEKSGDYLMTVDGLLSVRVPS 196

Query: 186 NSTSGRAIGIIKGENNCFICFYQDLTVRMIDCHDLLQLKGNEILVDHFIR----INHLLK 241
                  I + +GE+  F+    D TV+ +    L     N  L+   IR    I  L  
Sbjct: 197 GIKKMHKI-LRQGEDGTFVGVGADGTVQWVVLRFL-----NSALMRELIRYSGQIRFLCS 250

Query: 242 YLKEHIMFIKDNMSTPFNEFLTSVKGEATQEMMMENLITMLVSGYISTELEEWIRNTIGI 301
           YL E+I   K ++  P+ +FLT +        +      +++SGYI  +LE+W+ N+IG 
Sbjct: 251 YLTENINMCKTDLIEPYRQFLTRIADAYEGGELASRFRDIILSGYIPEDLEDWLCNSIGD 310

Query: 302 KNLTRWATLGGIFYEKGVDIITLMVIPACERFMILVARLQGL 343
           KN  RW  L    Y    +++ L VIPACER ++   +LQG+
Sbjct: 311 KNYKRWKQLSTRMYGDLNNVLALAVIPACERLILAAEQLQGI 352

>Ecym_4300 Chr4 complement(642023..644170) [2148 bp, 715 aa] {ON}
           similar to Ashbya gossypii AGR078C
          Length = 715

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 78/329 (23%), Positives = 144/329 (43%), Gaps = 32/329 (9%)

Query: 39  INYKIRNKNDIIYYQWENNIGNYVAIFFQRGTVMIY------------DGIKTSRLLAML 86
           I  ++++  +I+  Q E N G+  A+  + G+V +Y            DG      + + 
Sbjct: 49  IPLRLKSNEEILTCQLEPNDGDLFAVVLRSGSVKVYKGRQDVDSSDPTDGADMVGTIVLG 108

Query: 87  NGGKPNVDAGIWDRYYFPNDNE-KDIFDSDITLYMPTLIQI---IRDKEKICPGTYFPPH 142
            G   N++  +W+R  + +    K  FD+ +T ++P L ++    + K    P  +  P 
Sbjct: 109 RGEWFNMEQFVWNRIKWKSRGAFKGDFDTVLTQWLPKLTEMNVSPQGKLTCTPLEFEGPE 168

Query: 143 STWRAKKEESLKNEFLD----IHLLHHSVDDSFTFILNGELKLPFP-SNSTSGRAIGIIK 197
             W A   E+  N FL        +  S+D +F F    + K P   +N  SG A     
Sbjct: 169 --WNASLSENESNMFLTYDNATRKVMVSIDGTFNFRYGEKNKFPTKVTNILSGNA----- 221

Query: 198 GENNCFICFYQDLTVRMIDCHDLLQLKGNEILVDHFIRINHLLKYLKEHIMFIKDNMSTP 257
             NN      +D  +++I        + +E L+    +I  L+KYL+++   I   +  P
Sbjct: 222 --NNYVFLNDEDWQLQIIKLEFTESHQMHE-LMKCCSQIQFLMKYLRDNHKIIGVKLMEP 278

Query: 258 FNEFLTSVKGEATQEMMMENLITMLVSGYISTE-LEEWIRNTIGIKNLTRWATLGGIFYE 316
              F+ S+  +     +++ L  +   GY + + +E W    +G   ++ W     +F+ 
Sbjct: 279 HATFINSLFPDEQASRLLKGLKDVFYLGYSAEKNIENWFTLKLGRHGISIWKQRNHLFWS 338

Query: 317 KGVDIITLMVIPACERFMILVARLQGLIE 345
               I+   +IPACER ++ V RLQGLI+
Sbjct: 339 SSQGILVTCMIPACERLIVAVKRLQGLIK 367

>AGR078C Chr7 complement(877135..879282) [2148 bp, 715 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR118W
           (APC4)
          Length = 715

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 78/332 (23%), Positives = 140/332 (42%), Gaps = 38/332 (11%)

Query: 39  INYKIRNKNDIIYYQWENNIGNYVAIFFQRGTVMIY---------DGIKTSRLLAMLNGG 89
           I  ++R   +++  QWE + G   A+  + G+V IY         +G + + L+  +  G
Sbjct: 49  IPLRLRQNEELLRCQWEPDDGELFAVALRSGSVKIYRGRLDPEGTEGSEGAELVGTVVLG 108

Query: 90  KPN---VDAGIWDRYYF----PNDNEKDIFDSDITLYMPTLIQI---IRDKEKICPGTYF 139
           + +   ++  +W+R  +    P   E   FDS +  ++P L ++    + K    P  Y 
Sbjct: 109 RGDAFQMEQFVWNRIKWRVREPFCGE---FDSPLVQWLPRLTEMSISAQGKLLCTPLGYE 165

Query: 140 PPHSTWRAKKEESLKNEFL----DIHLLHHSVDDSFTFILNGELKLPFPSNSTSGRAIGI 195
            P   W A       N FL    +   +  S+D +F F   GE K  FP+  TS     I
Sbjct: 166 GPE--WNAGLAADESNMFLTFDNNTRKVVLSIDGTFNFRY-GE-KSKFPTKVTS-----I 216

Query: 196 IKGENNCFICFY-QDLTVRMIDCHDLLQLKGNEILVDHFIRINHLLKYLKEHIMFIKDNM 254
           + G  N ++    +D  +++I   +  +      L+     I  LLKY++++   I   +
Sbjct: 217 LPGNENHYVFINDEDWQLQVIRL-EFTEYHQVHELMKCCSHIQFLLKYIRDNHRLIGTKL 275

Query: 255 STPFNEFLTSVKGEATQEMMMENLITMLVSGYISTE-LEEWIRNTIGIKNLTRWATLGGI 313
             P   F  S+  E      M+ L  +   GY   + +E W    +G      W     +
Sbjct: 276 MEPHATFTGSLFPEEQFTKFMKGLKDVFYLGYSDDKTVENWFTLKLGRHGTAIWKQRNHL 335

Query: 314 FYEKGVDIITLMVIPACERFMILVARLQGLIE 345
           F+     ++   +IPACER ++   RL GL++
Sbjct: 336 FWSSSQGVLVTCMIPACERLIVSAKRLLGLVK 367

>KLLA0F19316g Chr6 (1786659..1788674) [2016 bp, 671 aa] {ON}
           conserved hypothetical protein
          Length = 671

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 34/153 (22%), Positives = 68/153 (44%), Gaps = 4/153 (2%)

Query: 195 IIKGENNCFICFYQDLTVRMIDCHDLLQLKGNEILVDHFIRINHLLKYLKEHIMFIKDNM 254
           IIK  +  ++C  +D + +++D    LQ      L+      + LL+YLK+    ++  +
Sbjct: 195 IIKVSSGKYMCLGKDWSYQVLDL-TFLQDPNIYKLIKTTQEYSALLRYLKQLHRHLRMKL 253

Query: 255 STPFNEFLTSVKGEATQEMMMENLITMLVSGYISTELEEWIRNTIGIKNLTRWATLGGIF 314
           + P+ EF+ ++  E  +  + E     +    +  EL E    T     L +W+ L    
Sbjct: 254 TEPYFEFVETLLKEEHKNALQELFYIGVTKLEVMEELHEVQLQTF---RLDKWSALSNDL 310

Query: 315 YEKGVDIITLMVIPACERFMILVARLQGLIEYV 347
               + ++    IP  ER ++L A ++ L E +
Sbjct: 311 CSNSIGLMVACTIPLLERMIVLAASIEALCEAI 343

>KLTH0F11352g Chr6 complement(962701..964596) [1896 bp, 631 aa] {ON}
           similar to uniprot|P38273 Saccharomyces cerevisiae
           YBR131W CCZ1 Protein involved in vacuolar assembly
          Length = 631

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 55/122 (45%), Gaps = 19/122 (15%)

Query: 138 YFPPHSTW-----RAKKEESLKNEFLDIHLLHHSVDDSFTFILNGELKLPFPSNSTSGRA 192
           + P  S+W      AKKE+  ++EFL   L    + DS+      +L+L F  N+     
Sbjct: 323 FMPNISSWNPWGSSAKKEKKARSEFLISPLSASFLPDSYKV---KKLRLSFDQNAK---- 375

Query: 193 IGIIKGENNCFICFYQDLTVRMIDCHDLLQLKGNEILVD-HFIRINHLLKYLKEHIMFIK 251
                 E NC   FY ++ V ++   D +++  +E L D HF   + + K   EH+  + 
Sbjct: 376 ------EYNCLFWFYNEILVILVFEQDFMKIWEHEFLSDLHFKLQSCISKLSSEHLNTVP 429

Query: 252 DN 253
            N
Sbjct: 430 HN 431

>KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.402
           YCL018W
          Length = 365

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 13/37 (35%), Positives = 21/37 (56%)

Query: 145 WRAKKEESLKNEFLDIHLLHHSVDDSFTFILNGELKL 181
           WR   EE++KNEF  + + HH +D +   ++    KL
Sbjct: 202 WRKTVEETIKNEFPTLTINHHLIDSAAMTLVQNPTKL 238

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.139    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 64,498,769
Number of extensions: 2914057
Number of successful extensions: 7948
Number of sequences better than 10.0: 37
Number of HSP's gapped: 8130
Number of HSP's successfully gapped: 37
Length of query: 608
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 493
Effective length of database: 40,294,809
Effective search space: 19865340837
Effective search space used: 19865340837
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)