Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0C045303.501ON2222228811e-121
Smik_16.4063.501ON2122224673e-58
Skud_16.4483.501ON2082234648e-58
KNAG0A079903.501ON2212294414e-54
YPR154W (PIN3)3.501ON2152234283e-52
Kpol_480.83.501ON2391294164e-50
Suva_16.4823.501ON2352224086e-49
NDAI0B059203.501ON2351334069e-49
Kwal_47.189053.501ON2361323877e-46
NCAS0F036003.501ON2371423808e-45
TPHA0A057203.501ON2201233763e-44
TDEL0D056903.501ON2011323682e-43
ZYRO0D09702g3.501ON1581653616e-43
SAKL0F02486g3.501ON2301173677e-43
KLTH0G02332g3.501ON2331193554e-41
AFR320W3.501ON2571363313e-37
KLLA0E03873g3.501ON2201293041e-33
Suva_7.4243.501ON2491413001e-32
Smik_6.2323.501ON2411412991e-32
YGR136W (LSB1)3.501ON2411472946e-32
KAFR0G037403.501ON2341592876e-31
CAGL0F04829g3.501ON2021312847e-31
Skud_7.4473.501ON2381412842e-30
Ecym_12283.501ON2531322755e-29
KNAG0B007503.501ON2171212334e-23
TBLA0D029103.501ON2691142112e-19
ZYRO0G20372gsingletonON150682014e-19
TBLA0D049501.356ON468501359e-09
TPHA0C040202.502ON485581322e-08
KAFR0D033602.502ON455761286e-08
NCAS0A089901.356ON434501286e-08
Suva_15.1991.356ON457511252e-07
AEL017W1.356ON416781242e-07
Smik_8.811.356ON468511242e-07
Ecym_24402.502ON459791242e-07
YHR016C (YSC84)1.356ON468511233e-07
CAGL0K02761g2.502ON450631233e-07
Ecym_27471.356ON452501233e-07
Skud_8.681.356ON475511224e-07
KLLA0B13475g2.502ON508601207e-07
CAGL0I08965g1.356ON437721199e-07
KAFR0C044001.356ON459591191e-06
TPHA0O012801.356ON454501191e-06
TDEL0D022401.356ON433611181e-06
NDAI0A043505.470ON459681181e-06
Smik_8.472.502ON447931181e-06
Kwal_0.3711.356ON217501161e-06
TBLA0A025705.470ON493551181e-06
KLTH0D06138g2.502ON489531172e-06
TDEL0A027802.502ON451601172e-06
KNAG0C020401.356ON464501162e-06
SAKL0E02200g2.502ON511631162e-06
TBLA0B054702.502ON539521163e-06
SAKL0D09702g1.356ON428661153e-06
KLTH0H12980g1.356ON399661153e-06
NCAS0B072501.356ON441501144e-06
Smik_7.3351.356ON460501144e-06
Kpol_1056.372.502ON501601144e-06
KLLA0A08360g1.356ON423501135e-06
YFR024C-A (LSB3)1.356ON459501145e-06
NCAS0A119205.470ON463561135e-06
NDAI0G059601.356ON423541127e-06
Kpol_1008.251.356ON449721128e-06
Suva_8.512.502ON456521119e-06
ZYRO0B01298g2.502ON411601111e-05
TBLA0F034901.356ON511731111e-05
KAFR0E036405.470ON441551111e-05
KAFR0A009701.356ON396611101e-05
Skud_8.432.502ON454521101e-05
SAKL0G03454g5.470ON468551092e-05
ABR008C2.502ON443501092e-05
YHR114W (BZZ1)2.159ON633701092e-05
Skud_4.6615.470ON460551082e-05
Skud_6.1081.356ON459501082e-05
YDR388W (RVS167)5.470ON482561083e-05
CAGL0M01650g5.470ON466561083e-05
Kwal_55.212875.470ON461561083e-05
NCAS0A050802.502ON450521083e-05
KNAG0C046305.470ON516551083e-05
YHL002W (HSE1)2.502ON452521083e-05
Suva_6.961.356ON455501073e-05
Kpol_440.105.470ON470741073e-05
Kwal_26.79022.502ON532751073e-05
NDAI0K021302.502ON459531073e-05
Smik_4.6585.470ON472561074e-05
KLTH0F15114g5.470ON435551064e-05
CAGL0A02145g1.356ON391521064e-05
NDAI0B045801.356ON424501064e-05
TDEL0A033405.470ON473531065e-05
TPHA0A022101.356ON397501056e-05
KNAG0A067102.502ON419871057e-05
ZYRO0D11110g5.470ON459551049e-05
ABR082W2.591ON683551041e-04
ZYRO0G00792g1.356ON469501031e-04
NDAI0I002206.366ON615691031e-04
Kwal_47.178942.159ON621821022e-04
TPHA0E015005.470ON457551012e-04
TDEL0B052202.159ON613831012e-04
Ecym_23082.591ON678561012e-04
Skud_8.1752.159ON633521003e-04
KLTH0E09790g2.159ON622711003e-04
TPHA0B028902.159ON63466994e-04
AFR140C5.470ON38853976e-04
Smik_8.1922.159ON63370977e-04
Smik_3.1866.366ON59157960.001
ACR266W2.159ON62651960.001
Suva_3.1246.366ON60057950.001
KLLA0E03059g5.470ON42858940.001
Skud_3.1606.366ON58657940.001
Suva_2.3268.344ON24074930.002
TBLA0H011608.344ON22450920.002
YCR088W (ABP1)6.366ON59257940.002
CAGL0C03597g6.366ON58082930.002
NCAS0D047406.366ON59480920.003
Skud_4.4208.344ON23374900.003
KNAG0I015801.356ON58185920.003
Kpol_538.255.170ON70772910.004
KNAG0I027006.366ON57553910.004
KAFR0J026506.366ON55353910.004
Kpol_325.126.366ON57050910.004
Kpol_1072.562.159ON63752900.005
Ecym_23165.470ON42154890.007
Suva_15.3102.159ON63470880.009
ZYRO0F13882g8.344ON28875860.011
TDEL0E055204.45ON158960870.014
Ecym_25266.366ON52451860.018
NCAS0B033608.344ON233104840.022
ZYRO0D17358g6.366ON66875840.027
YDR162C (NBP2)8.344ON23650830.029
ADL288C2.319ON92568840.030
Suva_2.564singletonON4320740.044
TBLA0F002806.366ON57673830.044
TPHA0H023806.366ON52878820.045
KLTH0D08580g2.591ON60069820.047
NDAI0J008508.344ON24560810.050
SAKL0H15048g8.344ON20771800.060
Smik_4.4068.344ON23550800.062
SAKL0A00594g6.366ON63650810.064
TPHA0F031007.365ON38161810.065
NCAS0B060202.319ON86455810.066
KLLA0D16874g8.344ON22751800.073
Smik_13.2022.591ON66346810.074
KLLA0C12551g2.591ON60757800.082
KAFR0B058608.344ON24972790.094
Ecym_42288.344ON26152790.10
AGR306C5.170ON92358800.10
SAKL0H24222g4.45ON152674800.10
SAKL0E06820g2.319ON90552790.12
TDEL0G024902.319ON85053790.13
SAKL0H21912g4.108ON125375790.14
Skud_12.2567.365ON40359780.16
NDAI0B033302.319ON91953780.16
CAGL0E01045g8.344ON21350760.18
Kpol_2000.28.344ON22550760.20
KLLA0E09043g2.319ON81452770.22
KLLA0F23848g2.159ON64949770.23
Ecym_47107.365ON39979760.24
ZYRO0A02662g2.319ON88653770.26
SAKL0F11748g7.365ON40862760.26
ZYRO0G10098g4.108ON139261770.27
NCAS0A145707.419ON35553760.28
TBLA0C055602.159ON67351760.32
TBLA0B096202.319ON94154760.36
SAKL0G17600g4.335ON44158750.38
YDL117W (CYK3)2.319ON88553750.38
YLR191W (PEX13)7.365ON38659740.44
ACR230C7.365ON39884740.45
KNAG0A050208.344ON27071730.51
Ecym_54262.159ON67251740.51
Suva_13.2012.591ON66867740.52
TDEL0F046808.344ON26450730.53
Smik_4.1192.319ON88753740.54
KLTH0G11682g8.344ON18750720.56
Smik_12.2517.365ON38859730.56
Suva_4.1292.319ON88753740.57
KNAG0H035002.159ON63466740.59
Skud_4.1372.319ON88753740.60
Kpol_1024.458.539ON55467730.72
KLLA0F10175g6.366ON57685730.72
Kwal_26.83232.591ON62769730.79
Suva_5.2397.419ON36853720.80
SAKL0E10780g2.159ON62561730.81
TDEL0A078106.366ON55850720.82
AGL237C6.366ON57850720.83
TBLA0A006108.539ON59776720.83
TPHA0F003804.45ON161845730.86
YMR032W (HOF1)2.591ON66967720.91
TPHA0K006807.419ON35547711.1
KLLA0E06953g7.419ON35752711.2
NCAS0B069802.159ON63972711.3
TDEL0F023804.108ON125560711.3
KAFR0L015807.365ON34459701.3
Suva_10.2877.365ON39259701.5
KNAG0C029104.108ON124471711.5
TPHA0G009302.319ON82453701.6
ZYRO0F01166g2.591ON74863701.8
KLLA0E23365g8.539ON57554701.8
KAFR0K020007.419ON33247691.9
NCAS0D019505.170ON93951692.2
TDEL0C028107.419ON33747682.5
NCAS0B022208.539ON55466682.5
Smik_2.1134.108ON123071692.6
NCAS0A059704.45ON132357692.6
Kpol_1045.217.419ON35847682.6
KLTH0A07348g6.366ON62670682.6
Skud_13.1882.591ON66967682.7
SAKL0H10098g8.539ON55587682.9
Ecym_72314.108ON114660683.0
AGL286C7.419ON33046673.1
Smik_5.2637.419ON36852673.1
CAGL0M05357g8.539ON55775683.2
Kpol_457.12singletonON56751683.3
TBLA0D004507.413ON100554683.4
Suva_2.1184.108ON1166102683.4
TBLA0C041004.108ON130260674.1
CAGL0I02750g2.159ON61967674.1
TDEL0B030708.539ON541101674.2
KNAG0C033907.419ON34251664.3
KLLA0F14575g5.170ON85155674.5
KLLA0D09306g4.45ON153766674.6
KLTH0F09240g2.319ON88873674.6
NDAI0A014707.419ON36753664.8
CAGL0G03597g7.419ON35352664.9
Kwal_23.64376.366ON63160656.6
KLTH0E07744g4.108ON124960656.8
Ecym_42268.346ON74270656.8
NCAS0A034904.108ON123564656.9
KNAG0B050005.170ON85553657.0
NDAI0A033304.108ON122657657.2
CAGL0E02783g4.108ON120365657.6
Skud_5.2617.419ON37232647.8
SAKL0E00946g6.13ON49379648.4
TPHA0L016608.539ON54769649.4
Ecym_71347.419ON33246639.6
Skud_10.2005.170ON110176649.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0C04530
         (222 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0C04530 Chr3 (1097179..1097847) [669 bp, 222 aa] {ON} Anc_3....   343   e-121
Smik_16.406 Chr16 (706485..707123) [639 bp, 212 aa] {ON} YPR154W...   184   3e-58
Skud_16.448 Chr16 (788136..788762) [627 bp, 208 aa] {ON} YPR154W...   183   8e-58
KNAG0A07990 Chr1 (1272958..1273623) [666 bp, 221 aa] {ON} Anc_3....   174   4e-54
YPR154W Chr16 (834565..835212) [648 bp, 215 aa] {ON}  PIN3Protei...   169   3e-52
Kpol_480.8 s480 complement(17610..18329) [720 bp, 239 aa] {ON} c...   164   4e-50
Suva_16.482 Chr16 (830850..831557) [708 bp, 235 aa] {ON} YPR154W...   161   6e-49
NDAI0B05920 Chr2 (1429564..1430271) [708 bp, 235 aa] {ON} Anc_3....   160   9e-49
Kwal_47.18905 s47 (1021428..1022138) [711 bp, 236 aa] {ON} YPR15...   153   7e-46
NCAS0F03600 Chr6 (715784..716497) [714 bp, 237 aa] {ON} Anc_3.50...   150   8e-45
TPHA0A05720 Chr1 (1293214..1293876) [663 bp, 220 aa] {ON} Anc_3....   149   3e-44
TDEL0D05690 Chr4 (1022136..1022741) [606 bp, 201 aa] {ON} Anc_3....   146   2e-43
ZYRO0D09702g Chr4 complement(823900..824376) [477 bp, 158 aa] {O...   143   6e-43
SAKL0F02486g Chr6 complement(216399..217091) [693 bp, 230 aa] {O...   145   7e-43
KLTH0G02332g Chr7 complement(184383..185084) [702 bp, 233 aa] {O...   141   4e-41
AFR320W Chr6 (1014675..1015448) [774 bp, 257 aa] {ON} Syntenic h...   132   3e-37
KLLA0E03873g Chr5 complement(354700..355362) [663 bp, 220 aa] {O...   121   1e-33
Suva_7.424 Chr7 (732619..733368) [750 bp, 249 aa] {ON} YGR136W (...   120   1e-32
Smik_6.232 Chr6 (380319..381044) [726 bp, 241 aa] {ON} YGR136W (...   119   1e-32
YGR136W Chr7 (762428..763153) [726 bp, 241 aa] {ON}  LSB1Protein...   117   6e-32
KAFR0G03740 Chr7 (767426..768130) [705 bp, 234 aa] {ON} Anc_3.50...   115   6e-31
CAGL0F04829g Chr6 (487684..488292) [609 bp, 202 aa] {ON} similar...   114   7e-31
Skud_7.447 Chr7 (741615..742331) [717 bp, 238 aa] {ON} YGR136W (...   114   2e-30
Ecym_1228 Chr1 complement(473518..474279) [762 bp, 253 aa] {ON} ...   110   5e-29
KNAG0B00750 Chr2 complement(140620..141273) [654 bp, 217 aa] {ON...    94   4e-23
TBLA0D02910 Chr4 complement(717010..717819) [810 bp, 269 aa] {ON...    86   2e-19
ZYRO0G20372g Chr7 (1680364..1680816) [453 bp, 150 aa] {ON} weakl...    82   4e-19
TBLA0D04950 Chr4 complement(1216633..1218039) [1407 bp, 468 aa] ...    57   9e-09
TPHA0C04020 Chr3 complement(861629..863086) [1458 bp, 485 aa] {O...    55   2e-08
KAFR0D03360 Chr4 complement(658469..659836) [1368 bp, 455 aa] {O...    54   6e-08
NCAS0A08990 Chr1 complement(1780800..1782036,1782134..1782201) [...    54   6e-08
Suva_15.199 Chr15 complement(345409..346735,346904..346950) [137...    53   2e-07
AEL017W Chr5 (603303..603349,603451..604654) [1251 bp, 416 aa] {...    52   2e-07
Smik_8.81 Chr8 complement(117184..118543,118714..118760) [1407 b...    52   2e-07
Ecym_2440 Chr2 (858070..859449) [1380 bp, 459 aa] {ON} similar t...    52   2e-07
YHR016C Chr8 complement(136881..138240,138409..138455) [1407 bp,...    52   3e-07
CAGL0K02761g Chr11 (249893..251245) [1353 bp, 450 aa] {ON} simil...    52   3e-07
Ecym_2747 Chr2 complement(1449887..1451198,1451401..1451447) [13...    52   3e-07
Skud_8.68 Chr8 complement(118475..119855,120025..120071) [1428 b...    52   4e-07
KLLA0B13475g Chr2 complement(1178856..1180382) [1527 bp, 508 aa]...    51   7e-07
CAGL0I08965g Chr9 complement(869942..871255) [1314 bp, 437 aa] {...    50   9e-07
KAFR0C04400 Chr3 (868668..868714,868802..870134) [1380 bp, 459 a...    50   1e-06
TPHA0O01280 Chr15 complement(252746..254110) [1365 bp, 454 aa] {...    50   1e-06
TDEL0D02240 Chr4 (431160..431206,431314..432568) [1302 bp, 433 a...    50   1e-06
NDAI0A04350 Chr1 complement(979014..980393) [1380 bp, 459 aa] {O...    50   1e-06
Smik_8.47 Chr8 (81503..82846) [1344 bp, 447 aa] {ON} YHL002W (REAL)    50   1e-06
Kwal_0.371 s0 complement(179002..179655) [654 bp, 217 aa] {ON} Y...    49   1e-06
TBLA0A02570 Chr1 complement(622892..624373) [1482 bp, 493 aa] {O...    50   1e-06
KLTH0D06138g Chr4 (544661..546130) [1470 bp, 489 aa] {ON} simila...    50   2e-06
TDEL0A02780 Chr1 (504696..506051) [1356 bp, 451 aa] {ON} Anc_2.5...    50   2e-06
KNAG0C02040 Chr3 complement(397447..398841) [1395 bp, 464 aa] {O...    49   2e-06
SAKL0E02200g Chr5 complement(171315..172850) [1536 bp, 511 aa] {...    49   2e-06
TBLA0B05470 Chr2 complement(1301018..1302637) [1620 bp, 539 aa] ...    49   3e-06
SAKL0D09702g Chr4 complement(805912..807151,807326..807372) [128...    49   3e-06
KLTH0H12980g Chr8 complement(1110123..1111259,1111344..1111406) ...    49   3e-06
NCAS0B07250 Chr2 complement(1371597..1372875,1373026..1373072) [...    49   4e-06
Smik_7.335 Chr7 complement(563424..564759,564853..564899) [1383 ...    49   4e-06
Kpol_1056.37 s1056 (92852..94357) [1506 bp, 501 aa] {ON} (92852....    49   4e-06
KLLA0A08360g Chr1 complement(739092..740316,740718..740764) [127...    48   5e-06
YFR024C-A Chr6 complement(201960..203292,203387..203433) [1380 b...    49   5e-06
NCAS0A11920 Chr1 (2363750..2365141) [1392 bp, 463 aa] {ON} Anc_5...    48   5e-06
NDAI0G05960 Chr7 (1474282..1475553) [1272 bp, 423 aa] {ON} Anc_1...    48   7e-06
Kpol_1008.25 s1008 complement(50905..52207,52597..52643) [1350 b...    48   8e-06
Suva_8.51 Chr8 (98991..100361) [1371 bp, 456 aa] {ON} YHL002W (R...    47   9e-06
ZYRO0B01298g Chr2 (110004..111239) [1236 bp, 411 aa] {ON} simila...    47   1e-05
TBLA0F03490 Chr6 (859156..859202,859415..860903) [1536 bp, 511 a...    47   1e-05
KAFR0E03640 Chr5 complement(731325..732650) [1326 bp, 441 aa] {O...    47   1e-05
KAFR0A00970 Chr1 (181162..182352) [1191 bp, 396 aa] {ON} Anc_1.3...    47   1e-05
Skud_8.43 Chr8 (84125..85489) [1365 bp, 454 aa] {ON} YHL002W (REAL)    47   1e-05
SAKL0G03454g Chr7 (284017..285423) [1407 bp, 468 aa] {ON} some s...    47   2e-05
ABR008C Chr2 complement(406780..408111) [1332 bp, 443 aa] {ON} S...    47   2e-05
YHR114W Chr8 (338083..339984) [1902 bp, 633 aa] {ON}  BZZ1SH3 do...    47   2e-05
Skud_4.661 Chr4 (1170843..1172225) [1383 bp, 460 aa] {ON} YDR388...    46   2e-05
Skud_6.108 Chr6 complement(197616..198948,199044..199090) [1380 ...    46   2e-05
YDR388W Chr4 (1250186..1251634) [1449 bp, 482 aa] {ON}  RVS167Ac...    46   3e-05
CAGL0M01650g Chr13 complement(184085..185485) [1401 bp, 466 aa] ...    46   3e-05
Kwal_55.21287 s55 complement(768495..769880) [1386 bp, 461 aa] {...    46   3e-05
NCAS0A05080 Chr1 (1011572..1012924) [1353 bp, 450 aa] {ON} Anc_2...    46   3e-05
KNAG0C04630 Chr3 (908312..909862) [1551 bp, 516 aa] {ON} Anc_5.4...    46   3e-05
YHL002W Chr8 (102612..103970) [1359 bp, 452 aa] {ON}  HSE1Subuni...    46   3e-05
Suva_6.96 Chr6 complement(167266..168586,168693..168739) [1368 b...    46   3e-05
Kpol_440.10 s440 (25697..27109) [1413 bp, 470 aa] {ON} (25697..2...    46   3e-05
Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W...    46   3e-05
NDAI0K02130 Chr11 (481352..482731) [1380 bp, 459 aa] {ON} Anc_2....    46   3e-05
Smik_4.658 Chr4 (1170707..1172125) [1419 bp, 472 aa] {ON} YDR388...    46   4e-05
KLTH0F15114g Chr6 complement(1238921..1240228) [1308 bp, 435 aa]...    45   4e-05
CAGL0A02145g Chr1 (224026..224036,225280..226444) [1176 bp, 391 ...    45   4e-05
NDAI0B04580 Chr2 complement(1138779..1140053) [1275 bp, 424 aa] ...    45   4e-05
TDEL0A03340 Chr1 (592752..594173) [1422 bp, 473 aa] {ON} Anc_5.4...    45   5e-05
TPHA0A02210 Chr1 (455888..457081) [1194 bp, 397 aa] {ON} Anc_1.3...    45   6e-05
KNAG0A06710 Chr1 complement(1045213..1046472) [1260 bp, 419 aa] ...    45   7e-05
ZYRO0D11110g Chr4 (939064..940443) [1380 bp, 459 aa] {ON} simila...    45   9e-05
ABR082W Chr2 (537500..539551) [2052 bp, 683 aa] {ON} Syntenic ho...    45   1e-04
ZYRO0G00792g Chr7 (61277..61323,61435..62797) [1410 bp, 469 aa] ...    44   1e-04
NDAI0I00220 Chr9 (32281..34128) [1848 bp, 615 aa] {ON} Anc_6.366...    44   1e-04
Kwal_47.17894 s47 (597826..599691) [1866 bp, 621 aa] {ON} YHR114...    44   2e-04
TPHA0E01500 Chr5 complement(304130..305503) [1374 bp, 457 aa] {O...    44   2e-04
TDEL0B05220 Chr2 complement(918098..919939) [1842 bp, 613 aa] {O...    44   2e-04
Ecym_2308 Chr2 complement(597163..599199) [2037 bp, 678 aa] {ON}...    44   2e-04
Skud_8.175 Chr8 (311857..313758) [1902 bp, 633 aa] {ON} YHR114W ...    43   3e-04
KLTH0E09790g Chr5 (881284..883152) [1869 bp, 622 aa] {ON} simila...    43   3e-04
TPHA0B02890 Chr2 complement(659614..661518) [1905 bp, 634 aa] {O...    43   4e-04
AFR140C Chr6 complement(692042..693208) [1167 bp, 388 aa] {ON} S...    42   6e-04
Smik_8.192 Chr8 (314456..316357) [1902 bp, 633 aa] {ON} YHR114W ...    42   7e-04
Smik_3.186 Chr3 (264667..266442) [1776 bp, 591 aa] {ON} YCR088W ...    42   0.001
ACR266W Chr3 (838689..840569) [1881 bp, 626 aa] {ON} Syntenic ho...    42   0.001
Suva_3.124 Chr3 (182459..184261) [1803 bp, 600 aa] {ON} YCR088W ...    41   0.001
KLLA0E03059g Chr5 (281543..282829) [1287 bp, 428 aa] {ON} simila...    41   0.001
Skud_3.160 Chr3 (249584..251344) [1761 bp, 586 aa] {ON} YCR088W ...    41   0.001
Suva_2.326 Chr2 complement(574424..575146) [723 bp, 240 aa] {ON}...    40   0.002
TBLA0H01160 Chr8 (259004..259678) [675 bp, 224 aa] {ON} Anc_8.34...    40   0.002
YCR088W Chr3 (265068..266846) [1779 bp, 592 aa] {ON}  ABP1Actin-...    41   0.002
CAGL0C03597g Chr3 complement(358731..360473) [1743 bp, 580 aa] {...    40   0.002
NCAS0D04740 Chr4 complement(909728..911512) [1785 bp, 594 aa] {O...    40   0.003
Skud_4.420 Chr4 complement(749749..750450) [702 bp, 233 aa] {ON}...    39   0.003
KNAG0I01580 Chr9 (306534..306580,306733..308431) [1746 bp, 581 a...    40   0.003
Kpol_538.25 s538 (50807..52930) [2124 bp, 707 aa] {ON} (50807..5...    40   0.004
KNAG0I02700 Chr9 complement(531880..533607) [1728 bp, 575 aa] {O...    40   0.004
KAFR0J02650 Chr10 complement(510356..512017) [1662 bp, 553 aa] {...    40   0.004
Kpol_325.12 s325 (19571..21283) [1713 bp, 570 aa] {ON} (19571..2...    40   0.004
Kpol_1072.56 s1072 complement(127771..129684) [1914 bp, 637 aa] ...    39   0.005
Ecym_2316 Chr2 complement(619368..620633) [1266 bp, 421 aa] {ON}...    39   0.007
Suva_15.310 Chr15 (540462..542366) [1905 bp, 634 aa] {ON} YHR114...    39   0.009
ZYRO0F13882g Chr6 complement(1143280..1144146) [867 bp, 288 aa] ...    38   0.011
TDEL0E05520 Chr5 (1015520..1020289) [4770 bp, 1589 aa] {ON} Anc_...    38   0.014
Ecym_2526 Chr2 (1025422..1026996) [1575 bp, 524 aa] {ON} similar...    38   0.018
NCAS0B03360 Chr2 (587093..587794) [702 bp, 233 aa] {ON} Anc_8.34...    37   0.022
ZYRO0D17358g Chr4 (1429127..1431133) [2007 bp, 668 aa] {ON} simi...    37   0.027
YDR162C Chr4 complement(780390..781100) [711 bp, 236 aa] {ON}  N...    37   0.029
ADL288C Chr4 complement(194687..197464) [2778 bp, 925 aa] {ON} S...    37   0.030
Suva_2.564 Chr2 (1002523..1002651) [129 bp, 43 aa] {ON} YDR388W ...    33   0.044
TBLA0F00280 Chr6 complement(58186..59916) [1731 bp, 576 aa] {ON}...    37   0.044
TPHA0H02380 Chr8 (558973..560559) [1587 bp, 528 aa] {ON} Anc_6.3...    36   0.045
KLTH0D08580g Chr4 (719409..721211) [1803 bp, 600 aa] {ON} simila...    36   0.047
NDAI0J00850 Chr10 (189221..189958) [738 bp, 245 aa] {ON} Anc_8.3...    36   0.050
SAKL0H15048g Chr8 (1304135..1304758) [624 bp, 207 aa] {ON} some ...    35   0.060
Smik_4.406 Chr4 complement(738389..739096) [708 bp, 235 aa] {ON}...    35   0.062
SAKL0A00594g Chr1 complement(68426..70336) [1911 bp, 636 aa] {ON...    36   0.064
TPHA0F03100 Chr6 complement(680407..681552) [1146 bp, 381 aa] {O...    36   0.065
NCAS0B06020 Chr2 (1138359..1140953) [2595 bp, 864 aa] {ON} Anc_2...    36   0.066
KLLA0D16874g Chr4 complement(1430953..1431636) [684 bp, 227 aa] ...    35   0.073
Smik_13.202 Chr13 (329496..331487) [1992 bp, 663 aa] {ON} YMR032...    36   0.074
KLLA0C12551g Chr3 complement(1065593..1067416) [1824 bp, 607 aa]...    35   0.082
KAFR0B05860 Chr2 complement(1210822..1211571) [750 bp, 249 aa] {...    35   0.094
Ecym_4228 Chr4 (475985..476770) [786 bp, 261 aa] {ON} similar to...    35   0.10 
AGR306C Chr7 complement(1305647..1308418) [2772 bp, 923 aa] {ON}...    35   0.10 
SAKL0H24222g Chr8 complement(2089734..2094314) [4581 bp, 1526 aa...    35   0.10 
SAKL0E06820g Chr5 complement(556960..559677) [2718 bp, 905 aa] {...    35   0.12 
TDEL0G02490 Chr7 (478524..481076) [2553 bp, 850 aa] {ON} Anc_2.3...    35   0.13 
SAKL0H21912g Chr8 complement(1913307..1917068) [3762 bp, 1253 aa...    35   0.14 
Skud_12.256 Chr12 (483859..485070) [1212 bp, 403 aa] {ON} YLR191...    35   0.16 
NDAI0B03330 Chr2 (848506..851265) [2760 bp, 919 aa] {ON} Anc_2.3...    35   0.16 
CAGL0E01045g Chr5 (94265..94906) [642 bp, 213 aa] {ON} similar t...    34   0.18 
Kpol_2000.2 s2000 complement(1407..2084) [678 bp, 225 aa] {ON} c...    34   0.20 
KLLA0E09043g Chr5 complement(807159..809603) [2445 bp, 814 aa] {...    34   0.22 
KLLA0F23848g Chr6 (2224951..2226900) [1950 bp, 649 aa] {ON} simi...    34   0.23 
Ecym_4710 Chr4 (1391055..1392254) [1200 bp, 399 aa] {ON} similar...    34   0.24 
ZYRO0A02662g Chr1 (213322..215982) [2661 bp, 886 aa] {ON} simila...    34   0.26 
SAKL0F11748g Chr6 complement(915861..917087) [1227 bp, 408 aa] {...    34   0.26 
ZYRO0G10098g Chr7 complement(808399..812577) [4179 bp, 1392 aa] ...    34   0.27 
NCAS0A14570 Chr1 complement(2869713..2870780) [1068 bp, 355 aa] ...    34   0.28 
TBLA0C05560 Chr3 complement(1346488..1348509) [2022 bp, 673 aa] ...    34   0.32 
TBLA0B09620 Chr2 complement(2277581..2280406) [2826 bp, 941 aa] ...    34   0.36 
SAKL0G17600g Chr7 complement(1523623..1524948) [1326 bp, 441 aa]...    33   0.38 
YDL117W Chr4 (248581..251238) [2658 bp, 885 aa] {ON}  CYK3SH3-do...    33   0.38 
YLR191W Chr12 (537272..538432) [1161 bp, 386 aa] {ON}  PEX13Inte...    33   0.44 
ACR230C Chr3 complement(763430..764626) [1197 bp, 398 aa] {ON} S...    33   0.45 
KNAG0A05020 Chr1 (731413..732225) [813 bp, 270 aa] {ON} Anc_8.34...    33   0.51 
Ecym_5426 Chr5 (877285..879303) [2019 bp, 672 aa] {ON} similar t...    33   0.51 
Suva_13.201 Chr13 (325718..327724) [2007 bp, 668 aa] {ON} YMR032...    33   0.52 
TDEL0F04680 Chr6 complement(881920..882714) [795 bp, 264 aa] {ON...    33   0.53 
Smik_4.119 Chr4 (225256..227919) [2664 bp, 887 aa] {ON} YDL117W ...    33   0.54 
KLTH0G11682g Chr7 (984811..985374) [564 bp, 187 aa] {ON} weakly ...    32   0.56 
Smik_12.251 Chr12 (484225..485391) [1167 bp, 388 aa] {ON} YLR191...    33   0.56 
Suva_4.129 Chr4 (237039..239702) [2664 bp, 887 aa] {ON} YDL117W ...    33   0.57 
KNAG0H03500 Chr8 (652236..654140) [1905 bp, 634 aa] {ON} Anc_2.1...    33   0.59 
Skud_4.137 Chr4 (244217..246880) [2664 bp, 887 aa] {ON} YDL117W ...    33   0.60 
Kpol_1024.45 s1024 (120171..121835) [1665 bp, 554 aa] {ON} (1201...    33   0.72 
KLLA0F10175g Chr6 complement(944501..946231) [1731 bp, 576 aa] {...    33   0.72 
Kwal_26.8323 s26 (739043..740926) [1884 bp, 627 aa] {ON} YMR032W...    33   0.79 
Suva_5.239 Chr5 complement(373672..374778) [1107 bp, 368 aa] {ON...    32   0.80 
SAKL0E10780g Chr5 (897714..899591) [1878 bp, 625 aa] {ON} simila...    33   0.81 
TDEL0A07810 Chr1 (1355773..1357449) [1677 bp, 558 aa] {ON} Anc_6...    32   0.82 
AGL237C Chr7 complement(254636..256372) [1737 bp, 578 aa] {ON} S...    32   0.83 
TBLA0A00610 Chr1 complement(119166..120959) [1794 bp, 597 aa] {O...    32   0.83 
TPHA0F00380 Chr6 (85560..90416) [4857 bp, 1618 aa] {ON} Anc_4.45...    33   0.86 
YMR032W Chr13 (335298..337307) [2010 bp, 669 aa] {ON}  HOF1Bud n...    32   0.91 
TPHA0K00680 Chr11 (134675..135742) [1068 bp, 355 aa] {ON} Anc_7....    32   1.1  
KLLA0E06953g Chr5 (629777..630850) [1074 bp, 357 aa] {ON} unipro...    32   1.2  
NCAS0B06980 Chr2 (1328203..1330122) [1920 bp, 639 aa] {ON} Anc_2...    32   1.3  
TDEL0F02380 Chr6 (438262..442029) [3768 bp, 1255 aa] {ON} Anc_4....    32   1.3  
KAFR0L01580 Chr12 complement(286684..287718) [1035 bp, 344 aa] {...    32   1.3  
Suva_10.287 Chr10 (509884..511062) [1179 bp, 392 aa] {ON} YLR191...    32   1.5  
KNAG0C02910 Chr3 complement(577437..581171) [3735 bp, 1244 aa] {...    32   1.5  
TPHA0G00930 Chr7 (179525..181999) [2475 bp, 824 aa] {ON} Anc_2.3...    32   1.6  
ZYRO0F01166g Chr6 complement(90553..92799) [2247 bp, 748 aa] {ON...    32   1.8  
KLLA0E23365g Chr5 complement(2077042..2078760,2078979..2078987) ...    32   1.8  
KAFR0K02000 Chr11 complement(410316..411314) [999 bp, 332 aa] {O...    31   1.9  
NCAS0D01950 Chr4 (358938..361757) [2820 bp, 939 aa] {ON} Anc_5.170     31   2.2  
TDEL0C02810 Chr3 complement(498625..499638) [1014 bp, 337 aa] {O...    31   2.5  
NCAS0B02220 Chr2 (363992..365656) [1665 bp, 554 aa] {ON} Anc_8.539     31   2.5  
Smik_2.113 Chr2 complement(205503..206218,206252..209228) [3693 ...    31   2.6  
NCAS0A05970 Chr1 complement(1177678..1181649) [3972 bp, 1323 aa]...    31   2.6  
Kpol_1045.21 s1045 (44318..45394) [1077 bp, 358 aa] {ON} (44320....    31   2.6  
KLTH0A07348g Chr1 (610049..611929) [1881 bp, 626 aa] {ON} simila...    31   2.6  
Skud_13.188 Chr13 (322010..324019) [2010 bp, 669 aa] {ON} YMR032...    31   2.7  
SAKL0H10098g Chr8 (865874..865882,865987..867645) [1668 bp, 555 ...    31   2.9  
Ecym_7231 Chr7 complement(480473..483913) [3441 bp, 1146 aa] {ON...    31   3.0  
AGL286C Chr7 complement(174535..175527) [993 bp, 330 aa] {ON} Sy...    30   3.1  
Smik_5.263 Chr5 complement(407025..408131) [1107 bp, 368 aa] {ON...    30   3.1  
CAGL0M05357g Chr13 (572309..573982) [1674 bp, 557 aa] {ON} simil...    31   3.2  
Kpol_457.12 s457 complement(23020..24723) [1704 bp, 567 aa] {ON}...    31   3.3  
TBLA0D00450 Chr4 (109529..112546) [3018 bp, 1005 aa] {ON} Anc_7....    31   3.4  
Suva_2.118 Chr2 complement(206707..206754,206785..206832,206899....    31   3.4  
TBLA0C04100 Chr3 (990555..994463) [3909 bp, 1302 aa] {ON} Anc_4....    30   4.1  
CAGL0I02750g Chr9 complement(242879..244738) [1860 bp, 619 aa] {...    30   4.1  
TDEL0B03070 Chr2 (547902..547910,547979..549595) [1626 bp, 541 a...    30   4.2  
KNAG0C03390 Chr3 (667055..668083) [1029 bp, 342 aa] {ON} Anc_7.4...    30   4.3  
KLLA0F14575g Chr6 complement(1351796..1354351) [2556 bp, 851 aa]...    30   4.5  
KLLA0D09306g Chr4 (783852..788465) [4614 bp, 1537 aa] {ON} simil...    30   4.6  
KLTH0F09240g Chr6 (799558..802224) [2667 bp, 888 aa] {ON} simila...    30   4.6  
NDAI0A01470 Chr1 (326531..327634) [1104 bp, 367 aa] {ON} Anc_7.4...    30   4.8  
CAGL0G03597g Chr7 complement(348369..349430) [1062 bp, 353 aa] {...    30   4.9  
Kwal_23.6437 s23 (1581839..1583734) [1896 bp, 631 aa] {ON} YCR08...    30   6.6  
KLTH0E07744g Chr5 complement(710793..714542) [3750 bp, 1249 aa] ...    30   6.8  
Ecym_4226 Chr4 (472701..474929) [2229 bp, 742 aa] {ON} similar t...    30   6.8  
NCAS0A03490 Chr1 complement(689871..693578) [3708 bp, 1235 aa] {...    30   6.9  
KNAG0B05000 Chr2 (955989..958556) [2568 bp, 855 aa] {ON} Anc_5.1...    30   7.0  
NDAI0A03330 Chr1 complement(756761..760441) [3681 bp, 1226 aa] {...    30   7.2  
CAGL0E02783g Chr5 (261665..265276) [3612 bp, 1203 aa] {ON} simil...    30   7.6  
Skud_5.261 Chr5 (422454..423572) [1119 bp, 372 aa] {ON} YER118C ...    29   7.8  
SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly s...    29   8.4  
TPHA0L01660 Chr12 complement(348715..350358) [1644 bp, 547 aa] {...    29   9.4  
Ecym_7134 Chr7 (266402..267400) [999 bp, 332 aa] {ON} similar to...    29   9.6  
Skud_10.200 Chr10 complement(366708..370013) [3306 bp, 1101 aa] ...    29   9.9  

>TBLA0C04530 Chr3 (1097179..1097847) [669 bp, 222 aa] {ON} Anc_3.501
           YPR154W
          Length = 222

 Score =  343 bits (881), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 173/222 (77%), Positives = 173/222 (77%)

Query: 1   MSSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLLPRRAPEVPSRQQSNSSKNEEWV 60
           MSSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLLPRRAPEVPSRQQSNSSKNEEWV
Sbjct: 1   MSSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLLPRRAPEVPSRQQSNSSKNEEWV 60

Query: 61  EAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFSGSNNEK 120
           EAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFSGSNNEK
Sbjct: 61  EAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFSGSNNEK 120

Query: 121 SRSDAAPPQYQQDDXXXXXXXXXXXXMMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 180
           SRSDAAPPQYQQDD            MM                                
Sbjct: 121 SRSDAAPPQYQQDDHHISKHSSHQSSMMPPQPYPQQQQVYQAPPPQQQQAYQAPPQQVVV 180

Query: 181 XXXXXKQHHEHKHLKNFGSKLGNAAIFGAGATLGSDLVNSIF 222
                KQHHEHKHLKNFGSKLGNAAIFGAGATLGSDLVNSIF
Sbjct: 181 EQAPAKQHHEHKHLKNFGSKLGNAAIFGAGATLGSDLVNSIF 222

>Smik_16.406 Chr16 (706485..707123) [639 bp, 212 aa] {ON} YPR154W
           (REAL)
          Length = 212

 Score =  184 bits (467), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 103/222 (46%), Positives = 132/222 (59%), Gaps = 10/222 (4%)

Query: 1   MSSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLLPRRAPEVPSRQQSNSSKNEEWV 60
           MS+SLIN+SL+ I TELDFL +SN I    + +I+  LP R  + PS  ++ SS + E+V
Sbjct: 1   MSASLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRW-DPPSASRNTSSTSLEYV 59

Query: 61  EAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFSGSNNEK 120
           EA+YQFDPQQDGDL L PGDKI + EK SPEW+KG CNG+ G+FP+NYV+PAFSGSN + 
Sbjct: 60  EALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSNGQS 119

Query: 121 SRSDAAPPQYQQDDXXXXXXXXXXXXMMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 180
           +     PPQY+  +                                              
Sbjct: 120 NL--PPPPQYKAQE-------LQPVPTQNSAVSSYQQQPFPPPSTNYYQQPQQAPAPAPQ 170

Query: 181 XXXXXKQHHEHKHLKNFGSKLGNAAIFGAGATLGSDLVNSIF 222
                +Q + H HLK+FGSKLGNAAIFGAGA++GSD+VNSIF
Sbjct: 171 QQQQQQQPNSHNHLKSFGSKLGNAAIFGAGASIGSDIVNSIF 212

>Skud_16.448 Chr16 (788136..788762) [627 bp, 208 aa] {ON} YPR154W
           (REAL)
          Length = 208

 Score =  183 bits (464), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 105/223 (47%), Positives = 132/223 (59%), Gaps = 16/223 (7%)

Query: 1   MSSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLLPRR-APEVPSRQQSNSSKNEEW 59
           MS+SLIN+SL+TI TELDFL +SN I    + +I+  LP R  P   +R  S++S   E+
Sbjct: 1   MSASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPSSAARDTSSASL--EY 58

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFSGSNNE 119
           VEA+YQFDPQQDGDL L PGDK+ + EK SPEW+KG CNG+VG+FP+NYV+PAFSGSN  
Sbjct: 59  VEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPAFSGSNG- 117

Query: 120 KSRSDAAPPQYQQDDXXXXXXXXXXXXMMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 179
            S +   PPQY+  +                                             
Sbjct: 118 -SSNLPPPPQYKAQE-----------LQQAPTQNSAVSSYQQQPFPPPSTNYYQQPQQQP 165

Query: 180 XXXXXXKQHHEHKHLKNFGSKLGNAAIFGAGATLGSDLVNSIF 222
                 +Q   H HLK+FGSKLGNAAIFGAGA++GSD+VNSIF
Sbjct: 166 QQAPPQQQPSSHNHLKSFGSKLGNAAIFGAGASIGSDIVNSIF 208

>KNAG0A07990 Chr1 (1272958..1273623) [666 bp, 221 aa] {ON} Anc_3.501
           YPR154W
          Length = 221

 Score =  174 bits (441), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 103/229 (44%), Positives = 128/229 (55%), Gaps = 15/229 (6%)

Query: 1   MSSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLLPRRAP-----EVPSRQQSNSSK 55
           MS+SLIN+SL+ + TELDFL +S  I ++T++KI   LP++       +  SR  S S  
Sbjct: 1   MSASLINRSLTNVRTELDFLRESEVISEETFNKIMHSLPQKYDPNQHNDNRSRDSSESHA 60

Query: 56  NEEWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFSG 115
             E+VEA+Y F PQQDGDL+L PGDKI V EKPS EW+KGKC G+VG+FPSNYV+PAFSG
Sbjct: 61  KLEYVEALYAFQPQQDGDLELRPGDKIQVLEKPSAEWYKGKCGGQVGMFPSNYVKPAFSG 120

Query: 116 SNNEKSRSDAAPPQYQQDDXXXXXXXXXXXXMMXXXXXXXXXXXXXXXXXXXXXXXXXXX 175
            ++   R    P Q QQ              M                            
Sbjct: 121 ESSAPKRPAGPPYQPQQQH--------LAAPMYQQPQNTGYSQSSNPPFPPQSANYYPPQ 172

Query: 176 XXXXXXXXXXKQHHEHKH--LKNFGSKLGNAAIFGAGATLGSDLVNSIF 222
                     +Q   HKH   K FGS+LGNAAIFGAGAT+GSD+VNSIF
Sbjct: 173 QQQQPQQVVVEQQQPHKHNAFKKFGSQLGNAAIFGAGATIGSDIVNSIF 221

>YPR154W Chr16 (834565..835212) [648 bp, 215 aa] {ON}  PIN3Protein
           that induces appearance of [PIN+] prion when
           overproduced
          Length = 215

 Score =  169 bits (428), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 123/223 (55%), Gaps = 9/223 (4%)

Query: 1   MSSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLLPRR-APEVPSRQQSNSSKNEEW 59
           MS+SLIN+SL+ I TELDFL  SN I    Y +I+  LP +  P    R  S +S   E+
Sbjct: 1   MSASLINRSLTNIRTELDFLKGSNVISNDVYDQINKSLPAKWDPANAPRNASPASL--EY 58

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFSGSNNE 119
           VEA+YQFDPQQDGDL L PGDK+ + EK SPEW+KG CNG+ G+FP+NYV+PAFSGSN  
Sbjct: 59  VEALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSNGP 118

Query: 120 KSRSDAAPPQYQQDDXXXXXXXXXXXXMMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 179
            +     PPQY+  +                                             
Sbjct: 119 SNL--PPPPQYKAQELQQIPTQNSAASSYQQQPFPPPSTNYYQQPQQQPQQAPPPQQQQQ 176

Query: 180 XXXXXXKQHHEHKHLKNFGSKLGNAAIFGAGATLGSDLVNSIF 222
                    H    LK+FGSKLGNAAIFGAGA++GSD+VN+IF
Sbjct: 177 QQQHQSSHSH----LKSFGSKLGNAAIFGAGASIGSDIVNNIF 215

>Kpol_480.8 s480 complement(17610..18329) [720 bp, 239 aa] {ON}
           complement(17610..18329) [720 nt, 240 aa]
          Length = 239

 Score =  164 bits (416), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 81/129 (62%), Positives = 99/129 (76%), Gaps = 1/129 (0%)

Query: 1   MSSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLLP-RRAPEVPSRQQSNSSKNEEW 59
           MSS+ IN+SL+++ TEL+FL  SN I  + + +I++LLP R  P   S   +NSS N E+
Sbjct: 1   MSSASINRSLTSVKTELEFLRDSNVISGEAFDQINNLLPDRHDPSRESLATNNSSPNLEY 60

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFSGSNNE 119
           VEAIY+FDPQQDGDL + PGDKI V EK SPEW+KGKCNGKVGVFPSNYV+PAFSG +NE
Sbjct: 61  VEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGKCNGKVGVFPSNYVKPAFSGGSNE 120

Query: 120 KSRSDAAPP 128
           KSRS    P
Sbjct: 121 KSRSHLTSP 129

 Score = 62.4 bits (150), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 29/31 (93%), Positives = 30/31 (96%)

Query: 192 KHLKNFGSKLGNAAIFGAGATLGSDLVNSIF 222
           KH K+FGSKLGNAAIFGAGATLGSDLVNSIF
Sbjct: 209 KHFKSFGSKLGNAAIFGAGATLGSDLVNSIF 239

>Suva_16.482 Chr16 (830850..831557) [708 bp, 235 aa] {ON} YPR154W
           (REAL)
          Length = 235

 Score =  161 bits (408), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 93/222 (41%), Positives = 124/222 (55%), Gaps = 5/222 (2%)

Query: 1   MSSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLLPRRAPEVPSRQQSNSSKNEEWV 60
           MS+SL+N+SL+ I TELDFL +SN I    + +I+  LP +     + + SNS+ + E+V
Sbjct: 19  MSASLVNRSLTNIRTELDFLKESNVISDDVFDQINKSLPVKWDPSSAPRGSNSA-SLEYV 77

Query: 61  EAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFSGSNNEK 120
           EA+YQFDPQQDGDL L  GDK+ + EK SPEW+KG CNG+ G+FP+NYV+P FS S+ + 
Sbjct: 78  EAVYQFDPQQDGDLGLKQGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPVFSDSDGQH 137

Query: 121 SRSDAAPPQYQQDDXXXXXXXXXXXXMMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 180
                 PPQY+  +                                              
Sbjct: 138 RL--PPPPQYKAQELQQIPTQNSNVSSYQPQPFPPPSTNYYQQPLQQPQLQPQQPPPPQQ 195

Query: 181 XXXXXKQHHEHKHLKNFGSKLGNAAIFGAGATLGSDLVNSIF 222
                   + H  LK+FGSKLGNAAIFGAGA++GSD+VNSIF
Sbjct: 196 QQQQQSSSNNH--LKSFGSKLGNAAIFGAGASIGSDIVNSIF 235

>NDAI0B05920 Chr2 (1429564..1430271) [708 bp, 235 aa] {ON} Anc_3.501
          Length = 235

 Score =  160 bits (406), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 103/133 (77%), Gaps = 2/133 (1%)

Query: 1   MSSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLLPRRAPEVPSRQQ-SNSSKNEEW 59
           MS+SLIN+SL+ I TELDFL +SN I ++T+++I++ LP+R     SR+  S+ +   E+
Sbjct: 1   MSASLINRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPNGSRESVSSQAPTLEY 60

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFSGSNN- 118
           VEAIY F+PQQ+GDL L  GDKI V EKPSPEWFKGKCNG+VG+FPSNYVRPAFSG++  
Sbjct: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFSGTSQP 120

Query: 119 EKSRSDAAPPQYQ 131
            K+R    PPQYQ
Sbjct: 121 SKTRLTPGPPQYQ 133

 Score = 65.9 bits (159), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 29/36 (80%), Positives = 32/36 (88%)

Query: 187 QHHEHKHLKNFGSKLGNAAIFGAGATLGSDLVNSIF 222
            HH  +HLK FGSKLGNAAIFGAGAT+GSD+VNSIF
Sbjct: 200 HHHTGEHLKKFGSKLGNAAIFGAGATIGSDIVNSIF 235

>Kwal_47.18905 s47 (1021428..1022138) [711 bp, 236 aa] {ON} YPR154W
           (PIN3) -  [contig 189] FULL
          Length = 236

 Score =  153 bits (387), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 95/132 (71%), Gaps = 2/132 (1%)

Query: 1   MSSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLLPRRAPEVPSRQQSNSSKNEEWV 60
           MS+S IN+SLST+ TEL+FL +SN I++ +Y  I  +LP R  E P    +  S   E+V
Sbjct: 1   MSASSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERY-EPPRSTPTVPSSQSEFV 59

Query: 61  EAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFSGSNNEK 120
           EAIY F  QQDGDL L  GDKI V EKPSPEW+KG+CNG+VG+FPSNYV+PAFSGSN   
Sbjct: 60  EAIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSGSNASL 119

Query: 121 SRSDA-APPQYQ 131
            R +  APP+YQ
Sbjct: 120 ERPNVPAPPEYQ 131

 Score = 56.6 bits (135), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 25/34 (73%), Positives = 27/34 (79%)

Query: 189 HEHKHLKNFGSKLGNAAIFGAGATLGSDLVNSIF 222
           H     K FG KLGNAAIFGAGAT+GSD+VNSIF
Sbjct: 203 HTGAAFKKFGGKLGNAAIFGAGATIGSDIVNSIF 236

>NCAS0F03600 Chr6 (715784..716497) [714 bp, 237 aa] {ON} Anc_3.501
           YGR136W
          Length = 237

 Score =  150 bits (380), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 103/142 (72%), Gaps = 12/142 (8%)

Query: 1   MSSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLLPRR----APEVPSRQQSNSSKN 56
           MS+S IN+SL+TI TELDFL +SN I ++T+ +I   LP +    A   PS   SN+++ 
Sbjct: 1   MSASSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDPDASRAPSIHSSNNNQP 60

Query: 57  E----EWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPA 112
           +    E+VEAIY F+PQQ GDL L PGDKI V EKPSPEWFKG+CNG+ G+FPSNYV+PA
Sbjct: 61  QDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKPA 120

Query: 113 FSGSN---NEKSRSDAAPPQYQ 131
           FSGS+   N+ +R +  PPQYQ
Sbjct: 121 FSGSSGSVNKVARPN-GPPQYQ 141

 Score = 65.1 bits (157), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 29/35 (82%), Positives = 31/35 (88%)

Query: 188 HHEHKHLKNFGSKLGNAAIFGAGATLGSDLVNSIF 222
           HH H  LK FGSKLGNAAIFGAGAT+GSD+VNSIF
Sbjct: 203 HHSHHGLKKFGSKLGNAAIFGAGATIGSDIVNSIF 237

>TPHA0A05720 Chr1 (1293214..1293876) [663 bp, 220 aa] {ON} Anc_3.501
           YPR154W
          Length = 220

 Score =  149 bits (376), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 88/123 (71%), Gaps = 5/123 (4%)

Query: 1   MSSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLLPRR-----APEVPSRQQSNSSK 55
           MS+SLIN+SL+TI TEL+FL +S  I    + +I+  LP R     AP + S   +  S 
Sbjct: 1   MSTSLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDPSNAPSMLSATTTRDST 60

Query: 56  NEEWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFSG 115
             E+VEAIY+FDPQQDGDL + PGDKI V EK SPEW+KG CNGKVGVFPSNY +PAFSG
Sbjct: 61  ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPAFSG 120

Query: 116 SNN 118
           S N
Sbjct: 121 STN 123

 Score = 63.9 bits (154), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 34/37 (91%), Gaps = 2/37 (5%)

Query: 188 HHEH--KHLKNFGSKLGNAAIFGAGATLGSDLVNSIF 222
           HH +  KHLK+FGSKLGNAAIFGAGAT+GSD+VNSIF
Sbjct: 184 HHSNTGKHLKSFGSKLGNAAIFGAGATIGSDIVNSIF 220

>TDEL0D05690 Chr4 (1022136..1022741) [606 bp, 201 aa] {ON} Anc_3.501
           YPR154W
          Length = 201

 Score =  146 bits (368), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 95/132 (71%), Gaps = 13/132 (9%)

Query: 1   MSSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLLPRRAPEVPSRQQSNSSKNEEWV 60
           MS+S IN+SL+T+ TELDFL +SN I ++ Y  ++  LP+ A          S+K  E++
Sbjct: 1   MSASQINRSLATVRTELDFLRESNVISQEIYDMVNQSLPQNA----------SNKGGEYM 50

Query: 61  EAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFSGSNNEK 120
           EA+YQFDPQQDGDL L PGDKI V EKPS EWFKG+CNG+VG+FP+NYV+ A+SGS+   
Sbjct: 51  EALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAAYSGSDRP- 109

Query: 121 SRSDAAPPQYQQ 132
             S   PPQY+Q
Sbjct: 110 --SVPPPPQYEQ 119

 Score = 70.1 bits (170), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 31/35 (88%), Positives = 32/35 (91%)

Query: 188 HHEHKHLKNFGSKLGNAAIFGAGATLGSDLVNSIF 222
           HH H HLK FGSKLGNAAIFGAGAT+GSDLVNSIF
Sbjct: 167 HHSHNHLKKFGSKLGNAAIFGAGATMGSDLVNSIF 201

>ZYRO0D09702g Chr4 complement(823900..824376) [477 bp, 158 aa] {ON}
           weakly similar to uniprot|Q06449 Saccharomyces
           cerevisiae YPR154W PIN3 Protein that induces appearance
           of [PIN ] prion when overproduced
          Length = 158

 Score =  143 bits (361), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 92/165 (55%), Gaps = 10/165 (6%)

Query: 58  EWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFSGSN 117
           E+VEAIY+FDPQQ+GDL L PGDKI V EKPSPEWF+G+CNG+VG+FPSNYV+PAFSG  
Sbjct: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAFSGGF 63

Query: 118 NEKSRSDAAPPQYQQDDXXXXXXXXXXXXMMXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 177
           +      AAPP  Q D             M                              
Sbjct: 64  DRP----AAPPPPQYDQKAMASQPSGGNAMW------QQPSPYPPPSTNYYQPPPPQQQQ 113

Query: 178 XXXXXXXXKQHHEHKHLKNFGSKLGNAAIFGAGATLGSDLVNSIF 222
                   +Q   H  L  FGSKLGNAAIFGAGATLGSDL+NSIF
Sbjct: 114 PQPMVVQQEQGKRHHGLGKFGSKLGNAAIFGAGATLGSDLINSIF 158

>SAKL0F02486g Chr6 complement(216399..217091) [693 bp, 230 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 230

 Score =  145 bits (367), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 90/117 (76%), Gaps = 1/117 (0%)

Query: 1   MSSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLLPRRAPEVPSRQQSNSSKNEEWV 60
           MS+SLIN+SL+TI TELDFL +S  I ++T+ +I + LP+R     +  +S SS + E+V
Sbjct: 1   MSASLINRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPNANGNRS-SSPSLEYV 59

Query: 61  EAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFSGSN 117
           EAIY F  QQDGDL L PGDKI V EKPS EW+KGKCNG VG+FPSNYV+PAFSGSN
Sbjct: 60  EAIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPAFSGSN 116

 Score = 58.5 bits (140), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 30/35 (85%)

Query: 188 HHEHKHLKNFGSKLGNAAIFGAGATLGSDLVNSIF 222
           H+  +  K FGSKLGNAAIFGAGAT+GSD+VNSIF
Sbjct: 196 HNGSQAFKKFGSKLGNAAIFGAGATIGSDIVNSIF 230

>KLTH0G02332g Chr7 complement(184383..185084) [702 bp, 233 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 233

 Score =  141 bits (355), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 72/119 (60%), Positives = 86/119 (72%), Gaps = 3/119 (2%)

Query: 1   MSSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLLPRRAPEVPSRQ-QSNSSKNEEW 59
           MS+S IN+SLST+ TEL+FL +S+ I + +Y  I   LP R    PSR  Q  S+   E+
Sbjct: 1   MSASSINRSLSTVRTELEFLRESDVITENSYRDILSALPERYD--PSRGPQQPSATQGEF 58

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFSGSNN 118
           VEAIY F  QQDGDL L  GDK+ V EKPSPEWFKGKCNG+VG+FPSNYV+PAFSGS  
Sbjct: 59  VEAIYAFQAQQDGDLNLQVGDKVEVLEKPSPEWFKGKCNGRVGMFPSNYVKPAFSGSTT 117

 Score = 53.9 bits (128), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (89%)

Query: 194 LKNFGSKLGNAAIFGAGATLGSDLVNSIF 222
            K FG KLGNAA+FGAGAT+GSD+VNSIF
Sbjct: 205 FKKFGGKLGNAAVFGAGATIGSDIVNSIF 233

>AFR320W Chr6 (1014675..1015448) [774 bp, 257 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR136W (LSB1) and
           YPR154W (PIN3)
          Length = 257

 Score =  132 bits (331), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 91/136 (66%), Gaps = 16/136 (11%)

Query: 1   MSSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLLP------RRAPEVPSRQQSNSS 54
           MSS+LIN+SL+TI TEL FL+ S  I ++   +I   LP      R AP       +N++
Sbjct: 1   MSSTLINRSLATIRTELAFLVDSGVITRQQSEQIESNLPNPNEALRGAP-------ANNA 53

Query: 55  KNEEWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFS 114
              E+VEA+Y F  QQ GDL    G+KI V EKPSPEW+KG+CNGKVG+FPSNYV+PAFS
Sbjct: 54  GPVEYVEALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPAFS 113

Query: 115 GSNNEKSRSDAAPPQY 130
           G +  K   +A+PP+Y
Sbjct: 114 GGSLMK---EASPPRY 126

 Score = 55.5 bits (132), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 26/28 (92%), Positives = 27/28 (96%)

Query: 195 KNFGSKLGNAAIFGAGATLGSDLVNSIF 222
           K FGSKLGNAAIFGAGATLGSDLV+SIF
Sbjct: 230 KKFGSKLGNAAIFGAGATLGSDLVHSIF 257

>KLLA0E03873g Chr5 complement(354700..355362) [663 bp, 220 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 220

 Score =  121 bits (304), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 64/129 (49%), Positives = 82/129 (63%), Gaps = 7/129 (5%)

Query: 6   INKSLSTIDTELDFLLKSNAIDKKTYSKIHDLLPRRAPEVPSRQQSNSSKNEEWVEAIYQ 65
           + +S++TI +EL +L +  A+ +  Y  I  LLPR  P+ P        +N E VEA+Y 
Sbjct: 4   VEESVATIKSELKYLKEQGALAELAYKDIESLLPRVRPQPPVAD--TMGQNNEIVEALYA 61

Query: 66  FDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFSGSNNEKSRSDA 125
           F PQQDGDL L PGDKI + EK SPEW+KGKCNG+VGVFPSNYV+ +    + EK  S A
Sbjct: 62  FQPQQDGDLALKPGDKIEILEKLSPEWYKGKCNGQVGVFPSNYVK-SVDTKDVEKRSSSA 120

Query: 126 AP----PQY 130
            P    PQY
Sbjct: 121 TPVANLPQY 129

 Score = 58.9 bits (141), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 28/35 (80%)

Query: 188 HHEHKHLKNFGSKLGNAAIFGAGATLGSDLVNSIF 222
           H      K FGSKLGNAAIFGAGAT+GSDLVNSIF
Sbjct: 186 HQGSAAFKKFGSKLGNAAIFGAGATIGSDLVNSIF 220

>Suva_7.424 Chr7 (732619..733368) [750 bp, 249 aa] {ON} YGR136W
           (REAL)
          Length = 249

 Score =  120 bits (300), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 66/141 (46%), Positives = 92/141 (65%), Gaps = 12/141 (8%)

Query: 1   MSSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLLPRRAPEVPSRQQSNSSKNEEWV 60
           MS+SLIN+SL  I  ELDFL +S  I    ++ I+  LP +  +V  R   N+S  EE+V
Sbjct: 1   MSASLINRSLKNIRNELDFLKESEVISDDIFNLINSKLPEKW-DVNLRPVPNASV-EEFV 58

Query: 61  EAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFSGS---- 116
           EA+Y F+PQQ+GDL L  GDKI + EK SP+W++GK N +VG+FP+NYV+PAF+ S    
Sbjct: 59  EALYDFEPQQEGDLPLKTGDKIQILEKISPDWYRGKANNRVGIFPANYVKPAFARSASPE 118

Query: 117 ------NNEKSRSDAAPPQYQ 131
                 +++ SR  A PP Y+
Sbjct: 119 NEGASLSSKVSRPSAPPPSYE 139

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 28/29 (96%)

Query: 194 LKNFGSKLGNAAIFGAGATLGSDLVNSIF 222
            K+FGSKLGNAAIFGAG+T+GSD+V+SIF
Sbjct: 221 FKSFGSKLGNAAIFGAGSTIGSDIVHSIF 249

>Smik_6.232 Chr6 (380319..381044) [726 bp, 241 aa] {ON} YGR136W
           (REAL)
          Length = 241

 Score =  119 bits (299), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 62/141 (43%), Positives = 90/141 (63%), Gaps = 12/141 (8%)

Query: 1   MSSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLLPRRAPEVPSRQQSNSSKNEEWV 60
           MS++L+N+SL  I  EL+FL +SN I    +  I+  LP +  +  + +  N++  EE+V
Sbjct: 1   MSATLVNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWND--NTRSPNNADTEEYV 58

Query: 61  EAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFSGS---- 116
           EA+Y F+ QQDGDL L  GDKI V EK SP+W+KGK N +VG+FP+NYV+PAF+ S    
Sbjct: 59  EALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPAFTRSVLTK 118

Query: 117 ------NNEKSRSDAAPPQYQ 131
                 +++ SR    PP Y+
Sbjct: 119 PEEGDLSSKVSRPSVPPPSYE 139

 Score = 53.1 bits (126), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 27/29 (93%)

Query: 194 LKNFGSKLGNAAIFGAGATLGSDLVNSIF 222
            K+FGSKLGNAAIFGAG+ +GSD+VNSIF
Sbjct: 213 FKSFGSKLGNAAIFGAGSAIGSDIVNSIF 241

>YGR136W Chr7 (762428..763153) [726 bp, 241 aa] {ON}  LSB1Protein
           containing an N-terminal SH3 domain; binds Las17p, which
           is a homolog of human Wiskott-Aldrich Syndrome protein
           involved in actin patch assembly and actin
           polymerization
          Length = 241

 Score =  117 bits (294), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 64/147 (43%), Positives = 89/147 (60%), Gaps = 24/147 (16%)

Query: 1   MSSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLLP------RRAPEVPSRQQSNSS 54
           MS+SL+N+SL  I  EL+FL +SN I    +  I+  LP      +R+P+        ++
Sbjct: 1   MSASLVNRSLKNIRNELEFLKESNVISGDIFELINSKLPEKWDGNQRSPQ--------NA 52

Query: 55  KNEEWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFS 114
             EE+VEA+Y F+ QQDGDL L  GDKI V EK SP+W++GK N K+G+FP+NYV+PAF+
Sbjct: 53  DTEEYVEALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYRGKSNNKIGIFPANYVKPAFT 112

Query: 115 GSNNEK----------SRSDAAPPQYQ 131
            S + K          SR    PP Y+
Sbjct: 113 RSASPKSAEAASSSTVSRPSVPPPSYE 139

 Score = 53.5 bits (127), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 27/29 (93%)

Query: 194 LKNFGSKLGNAAIFGAGATLGSDLVNSIF 222
            K+FGSKLGNAAIFGAG+ +GSD+VNSIF
Sbjct: 213 FKSFGSKLGNAAIFGAGSAIGSDIVNSIF 241

>KAFR0G03740 Chr7 (767426..768130) [705 bp, 234 aa] {ON} Anc_3.501
           YPR154W
          Length = 234

 Score =  115 bits (287), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 62/159 (38%), Positives = 88/159 (55%), Gaps = 33/159 (20%)

Query: 1   MSSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLLPRRAPEVPSRQQSNS------- 53
           MSS+LIN++++ I TELDFL +S  I ++   +I   LP +      + QSN        
Sbjct: 1   MSSALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTV 60

Query: 54  --------------------SKNEEWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWF 93
                               +   E+VEA+Y F+PQQ+GDL+L+ GDK+ + EKPS EW+
Sbjct: 61  NAAANSSSASVDHASATPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY 120

Query: 94  KGKCNGKVGVFPSNYVRPAFSGSNNEKSRSDAAPPQYQQ 132
           KG CNG++G+FP+NYV+P        K      PPQYQQ
Sbjct: 121 KGTCNGQIGMFPANYVKPV------TKDSFAPPPPQYQQ 153

 Score = 61.2 bits (147), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 28/32 (87%), Positives = 30/32 (93%)

Query: 191 HKHLKNFGSKLGNAAIFGAGATLGSDLVNSIF 222
           ++ LK FGSKLGNAAIFGAGATLGSDLVNSIF
Sbjct: 203 NEQLKRFGSKLGNAAIFGAGATLGSDLVNSIF 234

>CAGL0F04829g Chr6 (487684..488292) [609 bp, 202 aa] {ON} similar to
           uniprot|Q06449 Saccharomyces cerevisiae YPR154w
          Length = 202

 Score =  114 bits (284), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 65/131 (49%), Positives = 80/131 (61%), Gaps = 13/131 (9%)

Query: 1   MSSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLLPRR-APEVPSRQQSNSSKNEEW 59
           MS S IN+SL+ I  ELDFL +SN I +  + +I   LP   A  VP         + E+
Sbjct: 1   MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLPSNGASPVPP------PMSLEY 54

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFSGSNNE 119
           VEA+Y F PQQDGDL +  GDKI V EKPS EW++G  NG+ G+FPSNYVRPA + S N 
Sbjct: 55  VEALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVRPAAAPSAN- 113

Query: 120 KSRSDAAPPQY 130
                 APP Y
Sbjct: 114 -----LAPPAY 119

 Score = 62.4 bits (150), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 29/32 (90%), Positives = 30/32 (93%)

Query: 191 HKHLKNFGSKLGNAAIFGAGATLGSDLVNSIF 222
           H  LK+FGSKLGNAAIFGAGATLGSDLVNSIF
Sbjct: 171 HNGLKSFGSKLGNAAIFGAGATLGSDLVNSIF 202

>Skud_7.447 Chr7 (741615..742331) [717 bp, 238 aa] {ON} YGR136W
           (REAL)
          Length = 238

 Score =  114 bits (284), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 90/141 (63%), Gaps = 12/141 (8%)

Query: 1   MSSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLLPRRAPEVPSRQQSNSSKNEEWV 60
           MS+SLIN+SL+ I  EL+FL +SN I  + +  I   LP +  E  + + +N++  EE+V
Sbjct: 1   MSASLINRSLNNIRNELEFLKESNVISGELFHFIDSNLPGKWDE--NSKSANNASTEEYV 58

Query: 61  EAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFSGSNN-- 118
           EA+Y F+ QQDGDL L  GDKI + EK S +W+KGK N  +G+FP+NYV+PAF+ S +  
Sbjct: 59  EALYDFEAQQDGDLSLKTGDKIQILEKISLDWYKGKANDMIGIFPANYVKPAFTRSTSPD 118

Query: 119 -EK-------SRSDAAPPQYQ 131
            EK       SR    PP Y+
Sbjct: 119 FEKTPLSSRVSRPSVPPPSYE 139

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 22/29 (75%), Positives = 28/29 (96%)

Query: 194 LKNFGSKLGNAAIFGAGATLGSDLVNSIF 222
            K+FGSKLG+AAIFGAG+T+GSD++NSIF
Sbjct: 210 FKSFGSKLGDAAIFGAGSTIGSDIINSIF 238

>Ecym_1228 Chr1 complement(473518..474279) [762 bp, 253 aa] {ON}
           similar to Ashbya gossypii AFR320W
          Length = 253

 Score =  110 bits (275), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 85/132 (64%), Gaps = 8/132 (6%)

Query: 1   MSSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLL--PRRAPEVPSRQQSNSSKNEE 58
           MSSSLIN+SL+ I TEL+FL++SN I +    +I  +L  PR      + QQ      +E
Sbjct: 1   MSSSLINRSLANIKTELEFLVESNVISQSQSQQILSMLSNPREGTMKAASQQVL----KE 56

Query: 59  WVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFSGSNN 118
           +VEA+Y F PQQ GDL+   GDKI V EKPS +W+KG+ NG+VG+FPSNYV+   +  N 
Sbjct: 57  YVEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVKSLRTLPNG 116

Query: 119 EKSRSDAAPPQY 130
              R D  PPQY
Sbjct: 117 --GRFDEPPPQY 126

 Score = 51.6 bits (122), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 22/29 (75%), Positives = 26/29 (89%)

Query: 194 LKNFGSKLGNAAIFGAGATLGSDLVNSIF 222
            K FGSKLGNAA+FGAGAT+GS+LV+ IF
Sbjct: 225 FKKFGSKLGNAAVFGAGATMGSELVHHIF 253

>KNAG0B00750 Chr2 complement(140620..141273) [654 bp, 217 aa] {ON}
           Anc_3.501 YPR154W
          Length = 217

 Score = 94.4 bits (233), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 48/121 (39%), Positives = 76/121 (62%), Gaps = 3/121 (2%)

Query: 1   MSSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLLPRR--APEVPSRQQSNSSKNEE 58
           MS   +N+S++ I TEL++LL+S  I + T+ + +  LP       +    + +     E
Sbjct: 1   MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLPDNWDGKPIGGAGEKHPPHEPE 60

Query: 59  WVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPA-FSGSN 117
           +VEAI+++ PQ+  DL+L  GDK+ + EK S +W++GK  GKVGVFPSNYV+   FSG +
Sbjct: 61  YVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAVKFSGVD 120

Query: 118 N 118
           +
Sbjct: 121 D 121

 Score = 37.4 bits (85), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 21/34 (61%)

Query: 188 HHEHKHLKNFGSKLGNAAIFGAGATLGSDLVNSI 221
           HH     KN   + GN+ +FGAG  +GSD+VN I
Sbjct: 180 HHHSGAGKNLLKQFGNSIVFGAGQRIGSDIVNGI 213

>TBLA0D02910 Chr4 complement(717010..717819) [810 bp, 269 aa] {ON}
           Anc_3.501 YPR154W
          Length = 269

 Score = 85.9 bits (211), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 44/114 (38%), Positives = 68/114 (59%), Gaps = 7/114 (6%)

Query: 4   SLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLL--PRRAPEV-----PSRQQSNSSKN 56
           + I  + + I   L+ L+ +  I +  Y +I D+L   RR+P       P++   +    
Sbjct: 8   AAIKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHKRRSPSASSYSNPTKGALSPRNG 67

Query: 57  EEWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVR 110
            ++VEAIY +  +Q GDL+L PGD I V  K SP+W++G+ NGKVGVFP+NYV+
Sbjct: 68  PQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVK 121

 Score = 41.2 bits (95), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 16/23 (69%), Positives = 20/23 (86%)

Query: 200 KLGNAAIFGAGATLGSDLVNSIF 222
           KLGNAA+FGAG+  G+D+VN IF
Sbjct: 247 KLGNAALFGAGSAFGADIVNDIF 269

>ZYRO0G20372g Chr7 (1680364..1680816) [453 bp, 150 aa] {ON} weakly
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 150

 Score = 82.0 bits (201), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 48/68 (70%), Gaps = 1/68 (1%)

Query: 49  QQSNSSKNE-EWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSN 107
             SN  K++ E+VE +Y+F PQ   DL + PGDK+ V EK S +W+KGKCNGK G+FP+N
Sbjct: 5   HHSNKEKSQGEYVEVLYEFKPQNKEDLHIKPGDKVEVVEKLSADWYKGKCNGKEGMFPAN 64

Query: 108 YVRPAFSG 115
           YV+P   G
Sbjct: 65  YVKPVGGG 72

 Score = 53.1 bits (126), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/34 (73%), Positives = 27/34 (79%)

Query: 189 HEHKHLKNFGSKLGNAAIFGAGATLGSDLVNSIF 222
           H H  L   GSKLGNAAIFG GATLG+DLV+SIF
Sbjct: 117 HRHHALGKVGSKLGNAAIFGVGATLGNDLVDSIF 150

>TBLA0D04950 Chr4 complement(1216633..1218039) [1407 bp, 468 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 468

 Score = 56.6 bits (135), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 34/50 (68%), Gaps = 2/50 (4%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPE--WFKGKCNGKVGVFPSNYV 109
           A+Y FD ++ GDL    GD I++ +K   +  W+ G+CNG+ G+FP+NYV
Sbjct: 416 ALYTFDGEERGDLSFRKGDIIVIIKKSESQDDWWSGRCNGEEGIFPANYV 465

>TPHA0C04020 Chr3 complement(861629..863086) [1458 bp, 485 aa] {ON}
           Anc_2.502 YHL002W
          Length = 485

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 35/58 (60%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFSGSN 117
           V A+Y+   Q++ +L    GD I V E+   +W++G  +GK+G+FP NYV P    SN
Sbjct: 234 VRAMYELISQEENELSFRKGDVITVLEQVYRDWWRGTLHGKIGIFPLNYVTPIIELSN 291

>KAFR0D03360 Chr4 complement(658469..659836) [1368 bp, 455 aa] {ON}
           Anc_2.502 YHL002W
          Length = 455

 Score = 53.9 bits (128), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 42/76 (55%)

Query: 44  EVPSRQQSNSSKNEEWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGV 103
           E   +QQ ++S   + V A+Y F   +  +L    GD I+V E+   +W++G   G++G+
Sbjct: 200 ETSQQQQPSTSAGVKKVRAMYDFPSTEADELSFKKGDIIIVLEQVYRDWWRGSLRGRIGI 259

Query: 104 FPSNYVRPAFSGSNNE 119
           FP NYV P    + +E
Sbjct: 260 FPLNYVTPIMDPTPHE 275

>NCAS0A08990 Chr1 complement(1780800..1782036,1782134..1782201)
           [1305 bp, 434 aa] {ON} Anc_1.356 YFR024C-A
          Length = 434

 Score = 53.9 bits (128), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 2/50 (4%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPE--WFKGKCNGKVGVFPSNYV 109
           A+Y+F  +Q GDL    GDKI + ++   +  W+ G+ NGK G+FP+NYV
Sbjct: 382 ALYRFTGEQKGDLSFQKGDKITILKRTESQNDWWSGRVNGKEGIFPANYV 431

>Suva_15.199 Chr15 complement(345409..346735,346904..346950) [1374
           bp, 457 aa] {ON} YHR016C (REAL)
          Length = 457

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPE--WFKGKCNGKVGVFPSNYVR 110
           A+Y F  +Q GDL    GD I + +K   +  W+ G+ NGK G+FP+NYVR
Sbjct: 405 ALYNFAGEQSGDLAFKKGDVITILKKSDSQNDWWTGRVNGKEGIFPANYVR 455

>AEL017W Chr5 (603303..603349,603451..604654) [1251 bp, 416 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR024C-A
           (LSB3) and YHR016C (YSC84); 1-intron
          Length = 416

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 42/78 (53%), Gaps = 8/78 (10%)

Query: 40  RRAPEVPSRQQ------SNSSKNEEWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPE-- 91
           RRAP  P+  +      S SS       A+Y F  +Q GDL    GD I++ ++   +  
Sbjct: 336 RRAPARPTSAKPDFGSHSTSSGAIPKAVALYTFKGEQKGDLPFRKGDVIMILKRTESQDD 395

Query: 92  WFKGKCNGKVGVFPSNYV 109
           W+ G+ NG+ G+FP+NYV
Sbjct: 396 WWTGRINGQEGIFPANYV 413

>Smik_8.81 Chr8 complement(117184..118543,118714..118760) [1407 bp,
           468 aa] {ON} YHR016C (REAL)
          Length = 468

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPE--WFKGKCNGKVGVFPSNYVR 110
           A+Y F  +Q GDL    GD I + +K   +  W+ G+ NGK G+FP+NYVR
Sbjct: 416 ALYNFAGEQSGDLAFKKGDVISILKKSDSQNDWWTGRANGKEGIFPANYVR 466

>Ecym_2440 Chr2 (858070..859449) [1380 bp, 459 aa] {ON} similar to
           Ashbya gossypii ABR008C
          Length = 459

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 44/79 (55%), Gaps = 2/79 (2%)

Query: 46  PSRQQSNSSK--NEEWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGV 103
           P ++Q ++S+    + V A+Y  +  +  +L  + GD I V E+   +W++G   GKVG+
Sbjct: 215 PGQEQRHTSQLFQVKKVRAMYSLNASESDELSFVKGDVITVIEQVYKDWWRGTLRGKVGI 274

Query: 104 FPSNYVRPAFSGSNNEKSR 122
           FP NYV P    +  E +R
Sbjct: 275 FPLNYVTPCPEPTPEELAR 293

>YHR016C Chr8 complement(136881..138240,138409..138455) [1407 bp,
           468 aa] {ON}  YSC84Actin-binding protein involved in
           bundling of actin filaments and endocytosis of actin
           cortical patches; activity stimulated by Las17p;
           contains SH3 domain similar to Rvs167p
          Length = 468

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPE--WFKGKCNGKVGVFPSNYVR 110
           A+Y F  +Q GDL    GD I + +K   +  W+ G+ NGK G+FP+NYVR
Sbjct: 416 ALYNFAGEQPGDLAFKKGDVITILKKSDSQNDWWTGRTNGKEGIFPANYVR 466

>CAGL0K02761g Chr11 (249893..251245) [1353 bp, 450 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002w
          Length = 450

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 35/63 (55%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFSGSNNE 119
           V A+Y  +  +  +L    GD I+V E+   +W++G  +GK+G+FP NYV P    S  E
Sbjct: 217 VRALYDLNANEQDELSFRKGDVIVVLEQVYRDWWRGSLHGKIGIFPLNYVTPITEPSPVE 276

Query: 120 KSR 122
             R
Sbjct: 277 SQR 279

>Ecym_2747 Chr2 complement(1449887..1451198,1451401..1451447) [1359
           bp, 452 aa] {ON} similar to Ashbya gossypii AEL017W
           1-intron
          Length = 452

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 33/50 (66%), Gaps = 2/50 (4%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPE--WFKGKCNGKVGVFPSNYV 109
           A+Y F  +QDGDL    GD I + +K + +  W+ G+ NG+ G+FP+NYV
Sbjct: 400 ALYTFKGEQDGDLPFRTGDVIAILKKSNSQDDWWTGRVNGQEGIFPANYV 449

>Skud_8.68 Chr8 complement(118475..119855,120025..120071) [1428 bp,
           475 aa] {ON} YHR016C (REAL)
          Length = 475

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPE--WFKGKCNGKVGVFPSNYVR 110
           A+Y F  +Q GDL    GD I + +K   +  W+ G+ NGK G+FP+NYVR
Sbjct: 423 ALYNFAGEQPGDLAFKKGDAISILKKSDSQNDWWTGRINGKEGIFPANYVR 473

>KLLA0B13475g Chr2 complement(1178856..1180382) [1527 bp, 508 aa]
           {ON} similar to uniprot|P38753 Saccharomyces cerevisiae
           YHL002W HSE1 Subunit of the endosomal Vps27p-Hse1p
           complex required for sorting of ubiquitinated membrane
           proteins into intralumenal vesicles prior to vacuolar
           degradation, as well as for recycling of Golgi proteins
           and formation of lumenal membranes
          Length = 508

 Score = 50.8 bits (120), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 32/60 (53%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFSGSNNE 119
           V A+Y F+  +  +L    GD I V E+   +W++G   G VG+FP NYV P    S  E
Sbjct: 227 VRAMYDFNSTEQDELSFKKGDLICVVEQVYRDWWRGTLAGSVGIFPLNYVTPVTEPSQQE 286

>CAGL0I08965g Chr9 complement(869942..871255) [1314 bp, 437 aa] {ON}
           highly similar to uniprot|P43603 Saccharomyces
           cerevisiae YFR024ca or uniprot|P32793 Saccharomyces
           cerevisiae YHR016c YSC84
          Length = 437

 Score = 50.4 bits (119), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 39/72 (54%), Gaps = 5/72 (6%)

Query: 40  RRAPEVPSRQQSNSSKNEEWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPE--WFKGKC 97
           R A E P R  S+ +       A+Y F  ++ GDL    GD I + +K   +  W+ GK 
Sbjct: 366 RPADEPPRRDASSGAPK---AVALYSFAGEEAGDLSFRKGDVITIIKKSDSQNDWWTGKV 422

Query: 98  NGKVGVFPSNYV 109
           NG+ G+FP+NYV
Sbjct: 423 NGREGIFPANYV 434

>KAFR0C04400 Chr3 (868668..868714,868802..870134) [1380 bp, 459 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 459

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 34/59 (57%), Gaps = 2/59 (3%)

Query: 53  SSKNEEWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPE--WFKGKCNGKVGVFPSNYV 109
           SS N     A+Y F  ++ GDL    GD I + +K   +  W+ G+ NG+ G+FP+NYV
Sbjct: 398 SSSNAPKAVALYSFAGEESGDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYV 456

>TPHA0O01280 Chr15 complement(252746..254110) [1365 bp, 454 aa] {ON}
           Anc_1.356 YFR024C-A
          Length = 454

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 2/50 (4%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPE--WFKGKCNGKVGVFPSNYV 109
           A+Y F  ++ GDL    GD I + +K   +  W+ G+ NGK G+FP+NYV
Sbjct: 402 ALYTFSGEESGDLSFKKGDVIAILKKSDSQDDWWTGRVNGKEGIFPANYV 451

>TDEL0D02240 Chr4 (431160..431206,431314..432568) [1302 bp, 433 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 433

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 35/61 (57%), Gaps = 2/61 (3%)

Query: 51  SNSSKNEEWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPE--WFKGKCNGKVGVFPSNY 108
           S SS N     A+Y F  ++ GDL    GD I + +K   +  W+ G+ NG+ G+FP+NY
Sbjct: 370 SPSSSNAPKAVALYSFAGEESGDLPFRKGDVITILKKSESQDDWWTGRVNGREGIFPANY 429

Query: 109 V 109
           V
Sbjct: 430 V 430

>NDAI0A04350 Chr1 complement(979014..980393) [1380 bp, 459 aa] {ON}
           Anc_5.470
          Length = 459

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 37/68 (54%), Gaps = 2/68 (2%)

Query: 45  VPSRQQSNSSKNEEWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSP--EWFKGKCNGKVG 102
           +P    S ++   E V A+Y +  Q  GDL    G  I + E+ S   EW+ GK NG+ G
Sbjct: 388 MPPTAGSMAAPGVETVTALYDYQAQAAGDLSFPAGAVIEIVERTSDANEWWTGKYNGQQG 447

Query: 103 VFPSNYVR 110
           VFP NYV+
Sbjct: 448 VFPGNYVQ 455

>Smik_8.47 Chr8 (81503..82846) [1344 bp, 447 aa] {ON} YHL002W (REAL)
          Length = 447

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 48/93 (51%), Gaps = 3/93 (3%)

Query: 36  DLLPRRAPEVPSRQQSNSSKNEEWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKG 95
           ++LP++  + PS   ++     + V A+Y     +  +L    GD I+V E+   +W+KG
Sbjct: 194 EVLPQQRNQ-PSAHTTSRQTVVKKVRALYDLATNESEELSFRKGDVIIVLEQVYRDWWKG 252

Query: 96  KCNGKVGVFPSNYVRPAFSGSNN--EKSRSDAA 126
              GK+G+FP NYV P    S    EK R+  A
Sbjct: 253 ALRGKMGIFPLNYVTPISEPSKEEIEKERTKEA 285

>Kwal_0.371 s0 complement(179002..179655) [654 bp, 217 aa] {ON}
           YFR024C - Hypothetical ORF [contig 89] FULL
          Length = 217

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 32/50 (64%), Gaps = 2/50 (4%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPE--WFKGKCNGKVGVFPSNYV 109
           A+Y F+ +Q GDL    GD I + +K   +  W+ G+ NG+ G+FP+NYV
Sbjct: 165 ALYTFNGEQSGDLPFRKGDVITILKKSESQDDWWTGRNNGQEGIFPANYV 214

>TBLA0A02570 Chr1 complement(622892..624373) [1482 bp, 493 aa] {ON}
           Anc_5.470 YDR388W
          Length = 493

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 34/55 (61%), Gaps = 2/55 (3%)

Query: 58  EWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSP--EWFKGKCNGKVGVFPSNYVR 110
           E V A+Y++  Q +GDL    G  I + ++ +   EW+ GK NG+ GVFP NYV+
Sbjct: 435 ETVTALYEYQAQAEGDLSFPAGAVIEIVQRTADINEWWTGKYNGQQGVFPGNYVK 489

>KLTH0D06138g Chr4 (544661..546130) [1470 bp, 489 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002W HSE1
           Subunit of the endosomal Vps27p- Hse1p complex required
           for sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 489

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 32/53 (60%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPA 112
           V A++    ++  +L    GD I+V E+   +W++G+  G+VG+FP NYV P 
Sbjct: 217 VRALHDLTGRESDELSFRKGDIIVVIEQVYKDWWRGRLRGRVGIFPLNYVTPV 269

>TDEL0A02780 Chr1 (504696..506051) [1356 bp, 451 aa] {ON} Anc_2.502
           YHL002W
          Length = 451

 Score = 49.7 bits (117), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 33/60 (55%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFSGSNNE 119
           V A+Y    ++  +L    GD I+V E+   +W++G   GKVG+FP NYV P    S  E
Sbjct: 228 VRAMYDLSSEEPDELSFRKGDVIVVLEQVYRDWWRGTLCGKVGIFPLNYVTPIEEPSAEE 287

>KNAG0C02040 Chr3 complement(397447..398841) [1395 bp, 464 aa] {ON}
           Anc_1.356 YFR024C-A
          Length = 464

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 2/50 (4%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPE--WFKGKCNGKVGVFPSNYV 109
           A+Y F  ++ GDL    GD I V +K   +  W+ G+ NG+ G+FP+NYV
Sbjct: 412 ALYSFTGEESGDLPFRKGDVITVLKKSDSQNDWWTGRVNGREGIFPANYV 461

>SAKL0E02200g Chr5 complement(171315..172850) [1536 bp, 511 aa] {ON}
           similar to uniprot|P38753 Saccharomyces cerevisiae
           YHL002W HSE1 Subunit of the endosomal Vps27p-Hse1p
           complex required for sorting of ubiquitinated membrane
           proteins into intralumenal vesicles prior to vacuolar
           degradation as well as for recycling of Golgi proteins
           and formation of lumenal membranes
          Length = 511

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 32/63 (50%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFSGSNNE 119
           V A+Y     +  +L    GD I V E+   +W++G   G+VG+FP NYV P    +  E
Sbjct: 233 VRAMYDLTATESDELSFKKGDVITVVEQVYRDWWRGNIRGRVGIFPLNYVTPITEPTKEE 292

Query: 120 KSR 122
             R
Sbjct: 293 LER 295

>TBLA0B05470 Chr2 complement(1301018..1302637) [1620 bp, 539 aa]
           {ON} Anc_2.502 YHL002W
          Length = 539

 Score = 49.3 bits (116), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 29/52 (55%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRP 111
           V A+Y     + G+L    GD I V E+   +W++G   G VG+FP NYV P
Sbjct: 245 VRAMYDLTASEPGELSFKKGDIIKVIEQVYRDWWRGSLRGTVGIFPLNYVNP 296

>SAKL0D09702g Chr4 complement(805912..807151,807326..807372) [1287
           bp, 428 aa] {ON} similar to Saccharomyces cerevisiae
           YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 428

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 37/66 (56%), Gaps = 2/66 (3%)

Query: 46  PSRQQSNSSKNEEWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPE--WFKGKCNGKVGV 103
           P  ++S +S       A+Y F  +Q GDL    GD + + +K   +  W+ G+ NG+ G+
Sbjct: 360 PVSRRSPASSGAPKAVALYTFKGEQSGDLPFRKGDVVTILKKSDSQDDWWTGRVNGQEGI 419

Query: 104 FPSNYV 109
           FP+NYV
Sbjct: 420 FPANYV 425

>KLTH0H12980g Chr8 complement(1110123..1111259,1111344..1111406)
           [1200 bp, 399 aa] {ON} similar to Saccharomyces
           cerevisiae YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 399

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 35/66 (53%), Gaps = 2/66 (3%)

Query: 46  PSRQQSNSSKNEEWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPE--WFKGKCNGKVGV 103
           PS     +S       A+Y F  +Q GDL    GD I + +K   +  W+ G+ NG+ G+
Sbjct: 331 PSAHSRTASSGAPKAVALYTFKGEQSGDLPFRKGDVITILKKSESQDDWWTGRNNGQEGI 390

Query: 104 FPSNYV 109
           FP+NYV
Sbjct: 391 FPANYV 396

>NCAS0B07250 Chr2 complement(1371597..1372875,1373026..1373072)
           [1326 bp, 441 aa] {ON} Anc_1.356 YFR024C-A
          Length = 441

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 2/50 (4%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPE--WFKGKCNGKVGVFPSNYV 109
           A+Y F  ++ GDL    GD I + +K   +  W+ G+ NG+ G+FP+NYV
Sbjct: 389 ALYSFSGEESGDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYV 438

>Smik_7.335 Chr7 complement(563424..564759,564853..564899) [1383 bp,
           460 aa] {ON} YFR024C-A (REAL)
          Length = 460

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 2/50 (4%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPE--WFKGKCNGKVGVFPSNYV 109
           A+Y F  ++ GDL    GD I + +K   +  W+ G+ NG+ G+FP+NYV
Sbjct: 408 ALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYV 457

>Kpol_1056.37 s1056 (92852..94357) [1506 bp, 501 aa] {ON}
           (92852..94357) [1506 nt, 502 aa]
          Length = 501

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 31/60 (51%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFSGSNNE 119
           V A+Y     +  +L    GD I V E+   +W+KG   G +G+FP NYV P    SN E
Sbjct: 240 VRAMYDLSSNEPDELSFKKGDIITVLEQVYRDWWKGTLRGNIGIFPLNYVTPISDLSNAE 299

>KLLA0A08360g Chr1 complement(739092..740316,740718..740764) [1272
           bp, 423 aa] {ON} similar to Saccharomyces cerevisiae
           YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 423

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 2/50 (4%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPE--WFKGKCNGKVGVFPSNYV 109
           A+Y F  ++ GDL    GD I + +K   +  W+ G+ NGK G+FP+NYV
Sbjct: 371 ALYTFKGEESGDLPFRKGDVISIIKKSESQDDWWTGRVNGKEGIFPANYV 420

>YFR024C-A Chr6 complement(201960..203292,203387..203433) [1380 bp,
           459 aa] {ON}  LSB3Protein containing a C-terminal SH3
           domain; binds Las17p, which is a homolog of human
           Wiskott-Aldrich Syndrome protein involved in actin patch
           assembly and actin polymerization
          Length = 459

 Score = 48.5 bits (114), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 31/50 (62%), Gaps = 2/50 (4%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPE--WFKGKCNGKVGVFPSNYV 109
           A+Y F  ++ GDL    GD I + +K   +  W+ G+ NG+ G+FP+NYV
Sbjct: 407 ALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYV 456

>NCAS0A11920 Chr1 (2363750..2365141) [1392 bp, 463 aa] {ON}
           Anc_5.470
          Length = 463

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 34/56 (60%), Gaps = 4/56 (7%)

Query: 58  EWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSP---EWFKGKCNGKVGVFPSNYVR 110
           E V A+Y++  Q  GDL    G  I + E+ +P   EW+ G+ NG+ GVFP NYV+
Sbjct: 405 ETVTALYEYQAQAAGDLSFPAGAVIEIVER-TPDVNEWWTGRYNGQQGVFPGNYVQ 459

>NDAI0G05960 Chr7 (1474282..1475553) [1272 bp, 423 aa] {ON}
           Anc_1.356
          Length = 423

 Score = 47.8 bits (112), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 58  EWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPE--WFKGKCNGKVGVFPSNYV 109
           E V A+Y F  +Q GDL    GD I V +K   +  W+ GK   K G+FP+NYV
Sbjct: 367 EKVVALYTFVGEQKGDLAFKKGDIITVIKKTKSQDDWWTGKLGNKEGIFPANYV 420

>Kpol_1008.25 s1008 complement(50905..52207,52597..52643) [1350 bp,
           449 aa] {ON} complement(50905..52207,52597..52643) [1350
           nt, 450 aa]
          Length = 449

 Score = 47.8 bits (112), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 38/72 (52%), Gaps = 2/72 (2%)

Query: 40  RRAPEVPSRQQSNSSKNEEWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPE--WFKGKC 97
           R A E PS   +  S +     A+Y F  ++ GDL+   GD I + +K   +  W+ G+ 
Sbjct: 375 RPAAEKPSFGGTRQSSSTPKAIALYSFAGEESGDLRFKKGDVITILKKSDSQDDWWTGRV 434

Query: 98  NGKVGVFPSNYV 109
           N   G+FP+NYV
Sbjct: 435 NTSEGIFPANYV 446

>Suva_8.51 Chr8 (98991..100361) [1371 bp, 456 aa] {ON} YHL002W
           (REAL)
          Length = 456

 Score = 47.4 bits (111), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRP 111
           V A+Y     +  +L    GD I V E+   +W+KG   G++G+FP NYV P
Sbjct: 226 VRAMYDLSTNEPDELSFRKGDVITVLEQVYRDWWKGALRGRMGIFPLNYVTP 277

>ZYRO0B01298g Chr2 (110004..111239) [1236 bp, 411 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002W HSE1
           Subunit of the endosomal Vps27p-Hse1p complex required
           for sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 411

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 32/60 (53%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFSGSNNE 119
           V+A+Y     +  +L    GD I+V E+   +W++G   G +G+FP NYV P    +  E
Sbjct: 232 VKALYDLASNEPDELAFKKGDIIVVLEQVYRDWWRGSLRGSIGIFPLNYVTPVAEPTQQE 291

>TBLA0F03490 Chr6 (859156..859202,859415..860903) [1536 bp, 511 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 511

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 39/73 (53%), Gaps = 4/73 (5%)

Query: 39  PRRAPEVPSRQQSNSSKNEEWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPE--WFKGK 96
           P R   +P+R   ++        A+Y F  ++ GDL    GD I + +K   +  W+ G+
Sbjct: 438 PSRMTGIPTRD--DAVPGSPKAVALYSFTGEERGDLSFRKGDVITIIKKSESQNDWWTGR 495

Query: 97  CNGKVGVFPSNYV 109
            +G+ G+FP+NYV
Sbjct: 496 VSGREGIFPANYV 508

>KAFR0E03640 Chr5 complement(731325..732650) [1326 bp, 441 aa] {ON}
           Anc_5.470 YDR388W
          Length = 441

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 58  EWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPE--WFKGKCNGKVGVFPSNYVR 110
           E V A+Y++  Q  GDL    G  I + ++ + E  W+ G+ NG+ GVFP NYV+
Sbjct: 384 ETVTALYEYQAQAAGDLSFPAGAVIEIVQRTANENEWWTGRYNGQQGVFPGNYVQ 438

>KAFR0A00970 Chr1 (181162..182352) [1191 bp, 396 aa] {ON} Anc_1.356
           YFR024C-A
          Length = 396

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 37/61 (60%), Gaps = 4/61 (6%)

Query: 53  SSKNEEWVEAI--YQFDPQQDGDLQLMPGDKILVTEKPSPE--WFKGKCNGKVGVFPSNY 108
           S KN+  ++A+  Y F  +++GDL    GD I + ++   +  W+ G  NGK G+FP+NY
Sbjct: 333 SDKNQSGMKAVALYNFGGKEEGDLIFKRGDIIAIVKRSDSQYDWWTGNLNGKEGLFPANY 392

Query: 109 V 109
           V
Sbjct: 393 V 393

>Skud_8.43 Chr8 (84125..85489) [1365 bp, 454 aa] {ON} YHL002W (REAL)
          Length = 454

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 29/52 (55%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRP 111
           V A+Y     +  +L     D I+V E+   +W+KG   GK+G+FP NYV P
Sbjct: 225 VRALYDLSTNEPDELSFRKDDVIIVLEQVYRDWWKGALRGKMGIFPLNYVTP 276

>SAKL0G03454g Chr7 (284017..285423) [1407 bp, 468 aa] {ON} some
           similarities with uniprot|P39743 Saccharomyces
           cerevisiae YDR388W RVS167 BAR adaptor protein subunit of
           a complex (Rvs161p-Rvs167p) that regulates actin
           endocytosis and viability following starvation or
           osmotic stress
          Length = 468

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 58  EWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPE--WFKGKCNGKVGVFPSNYVR 110
           E V A+Y +  Q +GDL    G  I V E+ +    W+ G+ NG+ GVFP NYV+
Sbjct: 410 ETVTALYDYQAQAEGDLTFPVGAIIEVVERTTDTNGWWTGRYNGQQGVFPGNYVQ 464

>ABR008C Chr2 complement(406780..408111) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHL002W
          Length = 443

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYV 109
           V+AI+  +  +  +L    GD I V E+   +W++G   GKVG+FP NYV
Sbjct: 215 VKAIFDLNASEPDELSFKKGDVITVIEQVYKDWWRGLLRGKVGIFPVNYV 264

>YHR114W Chr8 (338083..339984) [1902 bp, 633 aa] {ON}  BZZ1SH3
           domain protein implicated in the regulation of actin
           polymerization, able to recruit actin polymerization
           machinery through its SH3 domains, colocalizes with
           cortical actin patches and Las17p, interacts with type I
           myosins
          Length = 633

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 39/70 (55%), Gaps = 3/70 (4%)

Query: 42  APEVPSRQQSNSSKNEEWVEAIYQFDPQQDGDLQLMPGDKILVTE-KPSPEWFKGKCNGK 100
           APEVP  ++S        +EAIY ++ Q D ++ + PGD I V        W  G+C+G 
Sbjct: 566 APEVPPPRRSTLPVRT--MEAIYAYEAQGDDEISIDPGDIITVIRGDDGSGWTYGECDGL 623

Query: 101 VGVFPSNYVR 110
            G+FP++Y +
Sbjct: 624 KGLFPTSYCK 633

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 35/73 (47%), Gaps = 5/73 (6%)

Query: 61  EAIYQFDPQQDGDLQLMPGDKI-LVTEKPSPEWFK--GKCNGKVGVFPSNYVR--PAFSG 115
           + +Y +  + D ++ + PGDKI LV       W K      G+ G+ P+ Y+R   A + 
Sbjct: 499 KVLYAYVQKDDDEITITPGDKISLVARDTGSGWTKINNDTTGETGLVPTTYIRISSAATV 558

Query: 116 SNNEKSRSDAAPP 128
             N++  +   PP
Sbjct: 559 KANDRGPAPEVPP 571

>Skud_4.661 Chr4 (1170843..1172225) [1383 bp, 460 aa] {ON} YDR388W
           (REAL)
          Length = 460

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 58  EWVEAIYQFDPQQDGDLQLMPGDKILVTEKP--SPEWFKGKCNGKVGVFPSNYVR 110
           E V A+Y +  Q  GDL    G  I + ++   + EW+ G+ NG+ GVFP NYV+
Sbjct: 402 ETVSALYDYQAQAAGDLSFPAGAVIEIVQRTPDANEWWTGRYNGQQGVFPGNYVQ 456

>Skud_6.108 Chr6 complement(197616..198948,199044..199090) [1380 bp,
           459 aa] {ON} YFR024C-A (REAL)
          Length = 459

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 31/50 (62%), Gaps = 2/50 (4%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPE--WFKGKCNGKVGVFPSNYV 109
           A+Y F  ++ GDL    GD I + +K   +  W+ G+ +G+ G+FP+NYV
Sbjct: 407 ALYTFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVSGREGIFPANYV 456

>YDR388W Chr4 (1250186..1251634) [1449 bp, 482 aa] {ON}
           RVS167Actin-associated protein with roles in endocytosis
           and exocytosis; interacts with Rvs161p to regulate actin
           cytoskeleton, endocytosis, and viability following
           starvation or osmotic stress; recruited to bud tips by
           Gyl1p and Gyp5p during polarized growth; homolog of
           mammalian amphiphysin
          Length = 482

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 33/56 (58%), Gaps = 4/56 (7%)

Query: 58  EWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSP---EWFKGKCNGKVGVFPSNYVR 110
           E V A+Y +  Q  GDL    G  I + ++ +P   EW+ G+ NG+ GVFP NYV+
Sbjct: 424 ETVTALYDYQAQAAGDLSFPAGAVIEIVQR-TPDVNEWWTGRYNGQQGVFPGNYVQ 478

>CAGL0M01650g Chr13 complement(184085..185485) [1401 bp, 466 aa]
           {ON} highly similar to uniprot|P39743 Saccharomyces
           cerevisiae YDR388w RVS167
          Length = 466

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 33/56 (58%), Gaps = 4/56 (7%)

Query: 58  EWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSP---EWFKGKCNGKVGVFPSNYVR 110
           E V A+Y +  Q  GDL    G  I V ++ +P   EW+ G+ NG+ GVFP NYV+
Sbjct: 410 ETVTALYDYQAQAAGDLSFPAGAVIEVVQR-TPDVNEWWTGRYNGQQGVFPGNYVQ 464

>Kwal_55.21287 s55 complement(768495..769880) [1386 bp, 461 aa] {ON}
           YDR388W (RVS167) - 1:1 [contig 130] FULL
          Length = 461

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 33/56 (58%), Gaps = 4/56 (7%)

Query: 58  EWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPE---WFKGKCNGKVGVFPSNYVR 110
           E V A+Y +  Q +GDL    G  I V E+ +P+   W+ G+ NG  GVFP NYV+
Sbjct: 404 ETVTALYDYQAQAEGDLTFPAGAIIEVVER-TPDVNGWWTGRYNGYQGVFPGNYVQ 458

>NCAS0A05080 Chr1 (1011572..1012924) [1353 bp, 450 aa] {ON}
           Anc_2.502
          Length = 450

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 28/52 (53%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRP 111
           V A+Y     +  +L  + GD I V E+   +W++G   G  G+FP NYV P
Sbjct: 220 VRALYDLSSPEADELSFVKGDVITVLEQVYKDWWRGTLRGNTGIFPLNYVTP 271

>KNAG0C04630 Chr3 (908312..909862) [1551 bp, 516 aa] {ON} Anc_5.470
           YDR388W
          Length = 516

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 58  EWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSP--EWFKGKCNGKVGVFPSNYVR 110
           E V A+Y +  Q  GDL    G  I + ++ +   EW+ G+ NG+ GVFP NYV+
Sbjct: 459 ETVTALYDYQAQAAGDLSFPAGATIEIVQRTADVNEWWTGRYNGQQGVFPGNYVQ 513

>YHL002W Chr8 (102612..103970) [1359 bp, 452 aa] {ON}  HSE1Subunit
           of the endosomal Vps27p-Hse1p complex required for
           sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation, as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 452

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 28/52 (53%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRP 111
           V A+Y     +  +L    GD I V E+   +W+KG   G +G+FP NYV P
Sbjct: 222 VRALYDLTTNEPDELSFRKGDVITVLEQVYRDWWKGALRGNMGIFPLNYVTP 273

>Suva_6.96 Chr6 complement(167266..168586,168693..168739) [1368 bp,
           455 aa] {ON} YFR024C-A (REAL)
          Length = 455

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 31/50 (62%), Gaps = 2/50 (4%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPE--WFKGKCNGKVGVFPSNYV 109
           A++ F  ++ GDL    GD + + +K   +  W+ G+ NG+ G+FP+NYV
Sbjct: 403 ALFSFAGEESGDLPFRKGDVVTILKKSDSQNDWWTGRVNGREGIFPANYV 452

>Kpol_440.10 s440 (25697..27109) [1413 bp, 470 aa] {ON}
           (25697..27109) [1413 nt, 471 aa]
          Length = 470

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 41/74 (55%), Gaps = 5/74 (6%)

Query: 39  PRRAPEVPSRQQSNSSKNEEWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSP--EWFKGK 96
           P +AP  P+    +++   E   ++Y++  Q  GDL    G  I + E+ +   EW+ G+
Sbjct: 397 PVQAPGPPAY---SAAPQAETCTSLYEYQAQAAGDLSFPAGVLIEIVERTANVNEWWTGR 453

Query: 97  CNGKVGVFPSNYVR 110
            NG+ GVFP NYV+
Sbjct: 454 YNGQQGVFPGNYVQ 467

>Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W
           (HSE1) - Hypothetical ORF [contig 55] FULL
          Length = 532

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 37/75 (49%), Gaps = 4/75 (5%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFSGS--- 116
           V A++    +   +L    GD I V E+   +W++G   GK+G+FP NYV P    +   
Sbjct: 229 VRALHDLVGRGSDELSFRKGDVIRVMEQVYRDWWRGSLRGKIGIFPLNYVTPVTDKTLEE 288

Query: 117 -NNEKSRSDAAPPQY 130
              EK + DA   QY
Sbjct: 289 ICAEKRQEDAILSQY 303

>NDAI0K02130 Chr11 (481352..482731) [1380 bp, 459 aa] {ON} Anc_2.502
          Length = 459

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPA 112
           V A+Y        +L    GD I+V E+   +W+KGK   + G+FP NYV P 
Sbjct: 233 VRALYDLAGSGSDELSFKKGDVIMVLEQVYKDWWKGKLRDQTGIFPLNYVTPV 285

>Smik_4.658 Chr4 (1170707..1172125) [1419 bp, 472 aa] {ON} YDR388W
           (REAL)
          Length = 472

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 33/56 (58%), Gaps = 4/56 (7%)

Query: 58  EWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSP---EWFKGKCNGKVGVFPSNYVR 110
           E V A+Y +  Q  GDL    G  I + ++ +P   EW+ G+ NG+ GVFP NYV+
Sbjct: 414 ETVTALYDYQAQAAGDLSFPAGAVIEIVQR-TPDVNEWWTGRYNGQQGVFPGNYVQ 468

>KLTH0F15114g Chr6 complement(1238921..1240228) [1308 bp, 435 aa]
           {ON} some similarities with uniprot|P39743 Saccharomyces
           cerevisiae YDR388W RVS167 BAR adaptor protein subunit of
           a complex (Rvs161p-Rvs167p) that regulates actin
           endocytosis and viability following starvation or
           osmotic stress
          Length = 435

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 58  EWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPE--WFKGKCNGKVGVFPSNYVR 110
           E V A+Y +  Q +GDL    G  I V E+ +    W+ G+ NG  GVFP NYV+
Sbjct: 378 ETVTALYDYQAQAEGDLTFPAGAIIEVVERTNDTNGWWTGRYNGYQGVFPGNYVQ 432

>CAGL0A02145g Chr1 (224026..224036,225280..226444) [1176 bp, 391 aa]
           {ON} similar to uniprot|P32793 Saccharomyces cerevisiae
           YHR016c YSC84 and similar to uniprot|P43603
           Saccharomyces cerevisiae YFR024C-A LSB3
          Length = 391

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSP--EWFKGKCNGKVGVFPSNYV 109
           V A+Y F+ QQ GDL     D I+V +K     +W+ G  +G  GVFP+NYV
Sbjct: 337 VRALYDFNGQQQGDLSFKKDDIIVVQKKTDSHNDWWYGVAHGVEGVFPANYV 388

>NDAI0B04580 Chr2 complement(1138779..1140053) [1275 bp, 424 aa]
           {ON} Anc_1.356
          Length = 424

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPE--WFKGKCNGKVGVFPSNYV 109
           A+Y F  ++  DL    GD I + +K   +  W+ G+ NG+ G+FP+NYV
Sbjct: 372 ALYSFAGEETDDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYV 421

>TDEL0A03340 Chr1 (592752..594173) [1422 bp, 473 aa] {ON} Anc_5.470
           YDR388W
          Length = 473

 Score = 45.4 bits (106), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSP--EWFKGKCNGKVGVFPSNYVR 110
           V A+Y +  Q  GDL    G  I V ++     EW+ G+ NG+ GVFP NYV+
Sbjct: 417 VTALYDYQAQAPGDLSFTAGAVIEVVQRTDDPNEWWTGRYNGQQGVFPGNYVQ 469

>TPHA0A02210 Chr1 (455888..457081) [1194 bp, 397 aa] {ON} Anc_1.356
           YFR024C-A
          Length = 397

 Score = 45.1 bits (105), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 31/50 (62%), Gaps = 2/50 (4%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPE--WFKGKCNGKVGVFPSNYV 109
           A+++F  +Q GDL    GD + + +K   +  W+ G+ N + G+FP+NYV
Sbjct: 345 ALFRFKGEQAGDLSFNKGDVVTILKKTDTQNDWWTGRVNNQEGIFPANYV 394

>KNAG0A06710 Chr1 complement(1045213..1046472) [1260 bp, 419 aa]
           {ON} Anc_2.502 YHL002W
          Length = 419

 Score = 45.1 bits (105), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 43/87 (49%), Gaps = 4/87 (4%)

Query: 38  LPRRA--PEVPSRQQSNSSKNEEWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKG 95
           L +RA  PEV  R+   ++  +  V A+Y  +     +L     D I+V E+   +W+ G
Sbjct: 197 LEQRANQPEVTKRETGTNTIKK--VRAMYDLETSDPKELAFRKDDIIVVIEQSYKDWWLG 254

Query: 96  KCNGKVGVFPSNYVRPAFSGSNNEKSR 122
               +VG+FP NYV P    +  +K +
Sbjct: 255 SLGRRVGIFPLNYVTPIIELTPEQKQK 281

>ZYRO0D11110g Chr4 (939064..940443) [1380 bp, 459 aa] {ON} similar
           to DEHA0G12903g and some similarites with YDR388W
           uniprot|P39743 Saccharomyces cerevisiae YDR388W RVS167
           BAR adaptor protein subunit of a complex (Rvs161p-
           Rvs167p) that regulates actin endocytosis and viability
           following starvation or osmotic stress
          Length = 459

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 58  EWVEAIYQFDPQQDGDLQLMPGDKILVTEKP--SPEWFKGKCNGKVGVFPSNYVR 110
           E V A+Y +  Q  GDL       I + ++   + EW+ G+ +G+VGVFP NYV+
Sbjct: 401 ETVTALYDYQAQAPGDLSFPANAVIEIVQRTQDTNEWWTGRYHGQVGVFPGNYVQ 455

>ABR082W Chr2 (537500..539551) [2052 bp, 683 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR032W (HOF1)
          Length = 683

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 31/55 (56%), Gaps = 4/55 (7%)

Query: 59  WVEAIYQFDPQQDGD-LQLMPGDKILVTEKPSPEWFKGKC---NGKVGVFPSNYV 109
           +  AIY F    D D L    GD +L+TEK + +W+ G+    NGK G+ P NYV
Sbjct: 625 YARAIYSFTEPNDNDILYFEMGDHLLLTEKLNTDWYIGEVHNGNGKQGLIPMNYV 679

>ZYRO0G00792g Chr7 (61277..61323,61435..62797) [1410 bp, 469 aa]
           {ON} similar to Saccharomyces cerevisiae YFR024C-A LSB3
           or to YHR016C uniprot|P32793 Saccharomyces cerevisiae
           YHR016C YSC84
          Length = 469

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPE--WFKGKCNGKVGVFPSNYV 109
           A+Y F  ++ GDL    GD I + +K   +  W+ G+  G+ G+FP+NYV
Sbjct: 417 ALYTFSGEEYGDLPFRKGDVITILKKSDSQDDWWTGRVGGREGIFPANYV 466

>NDAI0I00220 Chr9 (32281..34128) [1848 bp, 615 aa] {ON} Anc_6.366
           YCR088W
          Length = 615

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 36/69 (52%), Gaps = 2/69 (2%)

Query: 43  PEVPSRQQSNSSKNEEWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKC--NGK 100
           P  P R      + + W  A Y +D  ++ +L  +  DKI+  E    +W+ G+   NG+
Sbjct: 543 PPPPRRTMEPKEETKPWATAEYDYDAGEENELTFVENDKIINIEFVDDDWWLGELEKNGE 602

Query: 101 VGVFPSNYV 109
            G+FPSNYV
Sbjct: 603 KGLFPSNYV 611

>Kwal_47.17894 s47 (597826..599691) [1866 bp, 621 aa] {ON} YHR114W
           (BZZ1) - Myo3/5p-Bee1p-Vrp1p actin assembly complex
           component [contig 204] FULL
          Length = 621

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 41/82 (50%), Gaps = 4/82 (4%)

Query: 30  TYSKIHDLLPRRAPEVPSRQQSNSSKNEEWVEAIYQFDPQQDGDLQLMPGDKILVTEKPS 89
           TY  I +     AP  P  ++  +++    VEA+Y +  Q + +  L  GD I V +   
Sbjct: 543 TYVDIKEKARSSAPRAPPPRKGGATRT---VEAVYSYQAQGEDETSLTEGDVITVLKADD 599

Query: 90  PE-WFKGKCNGKVGVFPSNYVR 110
              W  G+ NG+ G+FP++Y +
Sbjct: 600 GSGWTYGEVNGEKGLFPTSYCK 621

 Score = 33.9 bits (76), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 35/72 (48%), Gaps = 11/72 (15%)

Query: 62  AIYQFDPQQDGDLQLMPGDKI-LVTEKPSPEWFKGKCN--GKVGVFPSNYVRPAFSGSNN 118
            +Y +  Q D ++ + PGD I L+       W K K +  G+ G+ P+ YV         
Sbjct: 495 VLYLYQKQDDDEVSISPGDPITLLVADTGSGWTKIKNDRTGQTGLVPTTYVDI------K 548

Query: 119 EKSRSDA--APP 128
           EK+RS A  APP
Sbjct: 549 EKARSSAPRAPP 560

>TPHA0E01500 Chr5 complement(304130..305503) [1374 bp, 457 aa] {ON}
           Anc_5.470 YDR388W
          Length = 457

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 58  EWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSP--EWFKGKCNGKVGVFPSNYVR 110
           E+  ++Y++  Q  GDL    G  I + ++ +   +W+ G  NG+ GVFP NYV+
Sbjct: 400 EYCTSLYEYQAQAQGDLSFPAGAVIQIVQRSADVNDWWTGVYNGQQGVFPGNYVQ 454

>TDEL0B05220 Chr2 complement(918098..919939) [1842 bp, 613 aa] {ON}
           Anc_2.159 YHR114W
          Length = 613

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 46/83 (55%), Gaps = 4/83 (4%)

Query: 30  TYSKIHDLLP-RRAPEVPSRQQSNSSKNEEWVEAIYQFDPQQDGDLQLMPGDKI-LVTEK 87
           TY +I++    + AP+VP  +++N       ++A Y ++ Q D +L L P D + ++   
Sbjct: 533 TYVEINEAAKIKEAPKVPPPRRTNMPTRT--MQAQYDYEAQGDDELSLTPNDVVNVIRGD 590

Query: 88  PSPEWFKGKCNGKVGVFPSNYVR 110
               W  G+ NG+ G+FP++Y R
Sbjct: 591 DGSGWTYGELNGEKGLFPTSYCR 613

>Ecym_2308 Chr2 complement(597163..599199) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii ABR082W
          Length = 678

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 35/56 (62%), Gaps = 4/56 (7%)

Query: 59  WVEAIYQF-DPQQDGDLQLMPGDKILVTEKPSPEWFKGKC---NGKVGVFPSNYVR 110
           + +A+Y F +P ++  L    GD +L+TEK + +W+ G+    NG+ G+ P NYV+
Sbjct: 620 YAKALYSFTEPNENDILNFQMGDHLLLTEKLNTDWYIGEVHNSNGRQGLIPMNYVK 675

>Skud_8.175 Chr8 (311857..313758) [1902 bp, 633 aa] {ON} YHR114W
           (REAL)
          Length = 633

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTE-KPSPEWFKGKCNGKVGVFPSNYVR 110
           +EA+Y ++ Q D ++ +  GD+I V        W  G+C+G  G+FP++Y R
Sbjct: 582 MEAVYAYEAQGDDEMSIDVGDEITVIRGDDGSGWTYGECDGLKGLFPTSYCR 633

 Score = 36.2 bits (82), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 3/59 (5%)

Query: 61  EAIYQFDPQQDGDLQLMPGDKI-LVTEKPSPEWFK--GKCNGKVGVFPSNYVRPAFSGS 116
           + +Y +  Q D ++ + PGDKI LV       W K      G+ G+ P+ Y+R + + S
Sbjct: 499 KVLYAYVKQDDDEIDITPGDKISLVARDTGSGWTKINNGNTGETGLVPTTYIRVSSAAS 557

>KLTH0E09790g Chr5 (881284..883152) [1869 bp, 622 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 622

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 41/71 (57%), Gaps = 6/71 (8%)

Query: 41  RAPEVPSRQQSNSSKNEEWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPE-WFKGKCNG 99
           RAP  P R+  N+++    V+A++ ++ Q D ++ +  GD I V +      W  G+ NG
Sbjct: 557 RAP--PPRKSGNAART---VKALFDYEAQGDDEISIRQGDLISVLKADDGSGWTYGELNG 611

Query: 100 KVGVFPSNYVR 110
           + G+FP+NY +
Sbjct: 612 QKGLFPTNYCQ 622

>TPHA0B02890 Chr2 complement(659614..661518) [1905 bp, 634 aa] {ON}
           Anc_2.159 YHR114W
          Length = 634

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 39/66 (59%), Gaps = 4/66 (6%)

Query: 46  PSRQQSNSSKNEEWVEAIYQFDPQQDGDLQLMPGDKILVTE-KPSPEWFKGKCNGKVGVF 104
           PSR+++ +++    V+A+Y ++ Q D ++ +  GD I V +      W  G+ NG  G+F
Sbjct: 572 PSRRKTTTTRK---VQALYDYEAQGDDEISISVGDTITVIKGDDGSGWTFGELNGIKGLF 628

Query: 105 PSNYVR 110
           PS+Y +
Sbjct: 629 PSSYCK 634

>AFR140C Chr6 complement(692042..693208) [1167 bp, 388 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR388W
           (RVS167)
          Length = 388

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 58  EWVEAIYQFDPQQDGDLQLMPGDKILVTEKP-SPEWFKGKCNGKVGVFPSNYV 109
           E   A+Y F  Q DGDL       I + ++  +  W+ G+ NG+ G+FP+NYV
Sbjct: 332 ETCIALYDFAAQADGDLSFPVNAIIEILDRSDAAGWWTGRYNGREGLFPANYV 384

>Smik_8.192 Chr8 (314456..316357) [1902 bp, 633 aa] {ON} YHR114W
           (REAL)
          Length = 633

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 38/70 (54%), Gaps = 3/70 (4%)

Query: 42  APEVPSRQQSNSSKNEEWVEAIYQFDPQQDGDLQLMPGDKILVTE-KPSPEWFKGKCNGK 100
           APEVP  ++S        +EA+Y ++ Q D ++ +  GD I V        W  G+C+G 
Sbjct: 566 APEVPPPRRSTLPIRT--LEAMYAYEAQGDDEISIDVGDVITVIRGDDGSGWTYGECDGL 623

Query: 101 VGVFPSNYVR 110
            G+FP++Y +
Sbjct: 624 KGLFPTSYCK 633

 Score = 35.4 bits (80), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 35/73 (47%), Gaps = 5/73 (6%)

Query: 61  EAIYQFDPQQDGDLQLMPGDKI-LVTEKPSPEWFK--GKCNGKVGVFPSNYVRPAFSGSN 117
           + +Y +  Q D ++ + PGD+I LV       W K      G+ G+ P+ Y+R + + + 
Sbjct: 499 KVLYAYVKQDDDEISISPGDRISLVARDTGSGWTKINNDSTGESGLVPTTYIRISTTDTA 558

Query: 118 NEKSRSDA--APP 128
              +R  A   PP
Sbjct: 559 TANNRGPAPEVPP 571

>Smik_3.186 Chr3 (264667..266442) [1776 bp, 591 aa] {ON} YCR088W
           (REAL)
          Length = 591

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 55  KNEEWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKC--NGKVGVFPSNYV 109
           K   W  A Y +D  +D +L  +  DKI+  E    +W+ G+   +G  G+FPSNYV
Sbjct: 531 KENPWATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 587

>ACR266W Chr3 (838689..840569) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR114W (BZZ1)
          Length = 626

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 27/51 (52%), Gaps = 1/51 (1%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPE-WFKGKCNGKVGVFPSNYV 109
           V AIY +  Q D ++ +  GD I V    +   W  G+ NG  G+FPSNY 
Sbjct: 575 VTAIYDYSAQDDDEISIRAGDVIKVLRGDTGNGWTYGEVNGSKGLFPSNYC 625

>Suva_3.124 Chr3 (182459..184261) [1803 bp, 600 aa] {ON} YCR088W
           (REAL)
          Length = 600

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 55  KNEEWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKC--NGKVGVFPSNYV 109
           K   W  A Y +D  +D +L  +  DKI+  E    +W+ G+   +G  G+FPSNYV
Sbjct: 540 KENPWATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 596

>KLLA0E03059g Chr5 (281543..282829) [1287 bp, 428 aa] {ON} similar
           to uniprot|P39743 Saccharomyces cerevisiae YDR388W
           RVS167 BAR adaptor protein subunit of a complex
           (Rvs161p-Rvs167p) that regulates actin endocytosis and
           viability following starvation or osmotic stress
          Length = 428

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 53  SSKNEEWVEAIYQFDPQQDGDLQLMPGDKILVTEKP-SPEWFKGKCNGKVGVFPSNYV 109
           +S   E   A+Y +  Q +GDL    G  I V ++  +  W+ G  NG  GVFP NYV
Sbjct: 366 TSAGVETCTALYDYTAQAEGDLTFPAGAIIQVVDRSDAAGWWVGVYNGVQGVFPGNYV 423

>Skud_3.160 Chr3 (249584..251344) [1761 bp, 586 aa] {ON} YCR088W
           (REAL)
          Length = 586

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 55  KNEEWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKC--NGKVGVFPSNYV 109
           K   W  A Y +D  +D +L  +  DKI+  E    +W+ G+   +G  G+FPSNYV
Sbjct: 526 KENPWATAEYDYDAAEDNELTFVENDKIVNIEFVDDDWWLGELEKDGSKGLFPSNYV 582

>Suva_2.326 Chr2 complement(574424..575146) [723 bp, 240 aa] {ON}
           YDR162C (REAL)
          Length = 240

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 37/74 (50%), Gaps = 9/74 (12%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPEWF--KGKCNGKVGVFPS---NYVRPAFSGS 116
           A+Y F+P+ D +L+L  GD + ++ K    W   + +   K G+ P     Y++P     
Sbjct: 117 ALYDFEPENDNELKLTEGDLVFISYKHGQGWLVAENESRSKTGLVPEEFVTYIQP----E 172

Query: 117 NNEKSRSDAAPPQY 130
           + E+ + D A P Y
Sbjct: 173 DGEEEKDDTARPFY 186

>TBLA0H01160 Chr8 (259004..259678) [675 bp, 224 aa] {ON} Anc_8.344
           YDR162C
          Length = 224

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGK--CNGKVGVFPSNYV 109
           A+Y F P+ D +LQL+ GD I +  K    W   +   N K+G+ P  +V
Sbjct: 105 ALYDFVPENDNELQLVEGDIIFINYKHGQGWLVAQNLNNNKIGLVPEEFV 154

>YCR088W Chr3 (265068..266846) [1779 bp, 592 aa] {ON}
           ABP1Actin-binding protein of the cortical actin
           cytoskeleton, important for activation of the Arp2/3
           complex that plays a key role actin in cytoskeleton
           organization; phosphorylation within its PRR
           (Proline-Rich Region), mediated by Cdc28p and Pho85p,
           protects Abp1p from proteolysis mediated by its own PEST
           sequences
          Length = 592

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 31/57 (54%), Gaps = 2/57 (3%)

Query: 55  KNEEWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKC--NGKVGVFPSNYV 109
           K   W  A Y +D  +D +L  +  DKI+  E    +W+ G+   +G  G+FPSNYV
Sbjct: 532 KENPWATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 588

>CAGL0C03597g Chr3 complement(358731..360473) [1743 bp, 580 aa] {ON}
           similar to uniprot|P15891 Saccharomyces cerevisiae
           YCR088w ABP1
          Length = 580

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 41/82 (50%), Gaps = 14/82 (17%)

Query: 42  APEVPSRQ----------QSNSSKNEE--WVEAIYQFDPQQDGDLQLMPGDKILVTEKPS 89
           AP +P+R+          ++   K EE  W  A Y ++  +D +L     DKI+  E   
Sbjct: 494 APSLPTRETNAVPPPPPRRATEEKKEEKPWATAEYDYEAAEDNELTFEENDKIINIEFVD 553

Query: 90  PEWFKGKC--NGKVGVFPSNYV 109
            +W+ G+    G+ G+FPSNYV
Sbjct: 554 DDWWLGELEKTGEKGLFPSNYV 575

>NCAS0D04740 Chr4 complement(909728..911512) [1785 bp, 594 aa] {ON}
           Anc_6.366 YCR088W
          Length = 594

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 41/80 (51%), Gaps = 8/80 (10%)

Query: 38  LPRR----APEVPSRQQSNSSKNEE--WVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPE 91
           LP R     P  P R+ +   K +E  W  A Y ++  +D +L     DKI+  E    +
Sbjct: 511 LPSRNTEAVPPPPPRRSAEPEKKKEEPWAIAEYDYEAGEDNELTFSENDKIINIEFVDDD 570

Query: 92  WFKG--KCNGKVGVFPSNYV 109
           W+ G  + +G+ G+FPSNYV
Sbjct: 571 WWLGELESSGEKGLFPSNYV 590

>Skud_4.420 Chr4 complement(749749..750450) [702 bp, 233 aa] {ON}
           YDR162C (REAL)
          Length = 233

 Score = 39.3 bits (90), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 38/74 (51%), Gaps = 9/74 (12%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPEWF--KGKCNGKVGVFPS---NYVRPAFSGS 116
           A+Y F+P+ D +L+L  GD + ++ K    W   + +   K G+ P    +Y++P     
Sbjct: 117 ALYDFEPENDNELKLTEGDIVFISYKHGQGWLVAENESRSKTGLVPEEFVSYIQP----E 172

Query: 117 NNEKSRSDAAPPQY 130
           + E+ + D A P Y
Sbjct: 173 DGEEEQEDTARPFY 186

>KNAG0I01580 Chr9 (306534..306580,306733..308431) [1746 bp, 581 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 581

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 41/85 (48%), Gaps = 3/85 (3%)

Query: 27  DKKTYSKIHDLLPRRAPEVPSRQQSNSSKNEEWVEAIYQFDPQQDGDLQLMPGDKILVTE 86
           D + +S   +  P + P  PS     S  N     A++ F   + GDL    GD I + +
Sbjct: 495 DPRGFSTYQNAPPSQDPVSPSLGHP-SEPNIAKAVALFDFGGAEPGDLTFKKGDVITIIK 553

Query: 87  KPSPE--WFKGKCNGKVGVFPSNYV 109
           +   +  W+ G+ N + G+FP+NYV
Sbjct: 554 RSQSQNDWWLGRINEREGLFPANYV 578

>Kpol_538.25 s538 (50807..52930) [2124 bp, 707 aa] {ON}
           (50807..52930) [2124 nt, 708 aa]
          Length = 707

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 38/72 (52%), Gaps = 7/72 (9%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGK-----VGVFPSNYVRPAFS 114
           V A+  ++PQ   DL++  GDKI V       W+ G+   K      G+FPS++V+    
Sbjct: 11  VVAVQAYEPQFTADLKISKGDKITVLYVEDDRWYYGRYVDKDGFTNSGIFPSSHVK-VIE 69

Query: 115 GSNNEKSRSDAA 126
           G +  KS SDAA
Sbjct: 70  GKDG-KSASDAA 80

>KNAG0I02700 Chr9 complement(531880..533607) [1728 bp, 575 aa] {ON}
           Anc_6.366 YCR088W
          Length = 575

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 59  WVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKC--NGKVGVFPSNYV 109
           W  A Y +D  ++ +L  +  DKI+  E    +W+ G+   NG+ G+FPSNYV
Sbjct: 519 WALAEYDYDAGEENELTFVEKDKIINIEFVDDDWWLGELERNGEKGLFPSNYV 571

>KAFR0J02650 Chr10 complement(510356..512017) [1662 bp, 553 aa] {ON}
           Anc_6.366 YCR088W
          Length = 553

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 59  WVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKC--NGKVGVFPSNYV 109
           W  A Y ++  +D +L     DKI+  E    +W+ G+   NG+ G+FPSNYV
Sbjct: 496 WAIAEYDYEAGEDNELTFEENDKIINIEFVDDDWWLGELEKNGEKGLFPSNYV 548

>Kpol_325.12 s325 (19571..21283) [1713 bp, 570 aa] {ON}
           (19571..21283) [1713 nt, 571 aa]
          Length = 570

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKC--NGKVGVFPSNYV 109
           A Y +D  +D +L  + GDKI+  E    +W+ G+    G+ G+FPSNYV
Sbjct: 517 AEYDYDAAEDNELTFVEGDKIVNIEFVDDDWWLGELEKTGEKGLFPSNYV 566

>Kpol_1072.56 s1072 complement(127771..129684) [1914 bp, 637 aa]
           {ON} complement(127771..129684) [1914 nt, 638 aa]
          Length = 637

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTE-KPSPEWFKGKCNGKVGVFPSNYVR 110
           VEAIY ++   D +L +  G+ I V        W  G+ NG  G+FPS+Y +
Sbjct: 586 VEAIYDYEAAGDDELSISQGETIKVIRGDDGSGWTYGESNGAKGLFPSSYCK 637

 Score = 29.3 bits (64), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 31/65 (47%), Gaps = 3/65 (4%)

Query: 56  NEEWVEAIYQFDPQQDGDLQLMPGDKI-LVTEKPSPEWFKGKCN--GKVGVFPSNYVRPA 112
           N E  + ++ +  Q D ++ +   D I LVT      W + K N  G+ G+ P++YV   
Sbjct: 500 NSEQNKVLFSYTRQDDDEIDISLEDSISLVTADTGSGWTRIKNNTTGETGLVPTSYVEIN 559

Query: 113 FSGSN 117
              SN
Sbjct: 560 QKASN 564

>Ecym_2316 Chr2 complement(619368..620633) [1266 bp, 421 aa] {ON}
           similar to Ashbya gossypii AFR140C
          Length = 421

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 1/54 (1%)

Query: 58  EWVEAIYQFDPQQDGDLQLMPGDKILVTEKP-SPEWFKGKCNGKVGVFPSNYVR 110
           E   ++Y F  Q   DL       I + ++  S  W+ G+ NG+ G+FP NYVR
Sbjct: 364 ETCTSLYAFAAQDKADLTFPANAVIEILDRADSSGWWTGRYNGQEGLFPGNYVR 417

>Suva_15.310 Chr15 (540462..542366) [1905 bp, 634 aa] {ON} YHR114W
           (REAL)
          Length = 634

 Score = 38.5 bits (88), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 38/70 (54%), Gaps = 3/70 (4%)

Query: 42  APEVPSRQQSNSSKNEEWVEAIYQFDPQQDGDLQLMPGDKILVTE-KPSPEWFKGKCNGK 100
           APEVP  +++  +     +EA Y ++ + D ++ +  GD I V        W  G+C+G 
Sbjct: 567 APEVPPPRRT--ALPVRTLEAAYAYEAKGDDEMSIDVGDVITVIRGDDGSGWTYGECDGL 624

Query: 101 VGVFPSNYVR 110
            G+FP++Y +
Sbjct: 625 KGLFPTSYCK 634

 Score = 34.3 bits (77), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 3/53 (5%)

Query: 61  EAIYQFDPQQDGDLQLMPGDKI-LVTEKPSPEWFK--GKCNGKVGVFPSNYVR 110
           + +Y +  Q   ++ + PGDKI LV       W K      G+ G+ P+ YVR
Sbjct: 499 KVLYAYSKQDTDEISISPGDKISLVARDSGSGWTKINNDSTGETGLVPTTYVR 551

>ZYRO0F13882g Chr6 complement(1143280..1144146) [867 bp, 288 aa]
           {ON} similar to uniprot|Q12163 Saccharomyces cerevisiae
           YDR162C NBP2 Protein involved in the HOG (high
           osmolarity glycerol) pathway negatively regulates Hog1p
           by recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex found in the nucleus and cytoplasm contains an
           SH3 domain that binds Pbs2p
          Length = 288

 Score = 37.7 bits (86), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 35/75 (46%), Gaps = 6/75 (8%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPEWF--KGKCNGKVGVFPSNYVRPAFSGSNN- 118
           A+Y F+P+ D +L+L  GD + ++ +    W   + +   K G+ P  +V  A     N 
Sbjct: 133 ALYDFEPENDNELELQEGDVVFISYRHGQGWLVAENQNRTKTGLVPEEFVTYANEDDENW 192

Query: 119 ---EKSRSDAAPPQY 130
              E+   D A P Y
Sbjct: 193 AEYEEGFQDTARPFY 207

>TDEL0E05520 Chr5 (1015520..1020289) [4770 bp, 1589 aa] {ON}
           Anc_4.45 Scer_YGOB_SDC25
          Length = 1589

 Score = 38.1 bits (87), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 31/60 (51%), Gaps = 5/60 (8%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKG---KCNGKV--GVFPSNYVRPAFS 114
           V AI+ ++ +   +L L  GD I V  K    W+ G   + NGKV  G FP NY R + S
Sbjct: 51  VVAIFDYNRKGKNELNLQQGDTIYVIGKNESGWWDGLSIEANGKVHRGWFPQNYCRSSHS 110

>Ecym_2526 Chr2 (1025422..1026996) [1575 bp, 524 aa] {ON} similar to
           Ashbya gossypii AGL237C
          Length = 524

 Score = 37.7 bits (86), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKG--KCNGKVGVFPSNYVR 110
           A Y ++  +D +L    GD+I+  E    +W+ G  K  G+ G+FPSNYV+
Sbjct: 471 AEYDYEAGEDNELTFKEGDRIIDIEFVDDDWWLGVLKNTGEKGLFPSNYVK 521

>NCAS0B03360 Chr2 (587093..587794) [702 bp, 233 aa] {ON} Anc_8.344
           YDR162C
          Length = 233

 Score = 37.0 bits (84), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 44/104 (42%), Gaps = 7/104 (6%)

Query: 29  KTYSKIHDLLPRRAPEVPSRQQSNSSKNEEWVEAIYQFDPQQDGDLQLMPGDKILVTEKP 88
           +T++   DL  R++  +P+    N     +W  AIY F P+ + +L L   D + ++ K 
Sbjct: 87  ETHTDGDDLYKRQSVVLPNDYVVN-----QWAVAIYDFVPENENELDLKENDIVFISYKH 141

Query: 89  SPEWF--KGKCNGKVGVFPSNYVRPAFSGSNNEKSRSDAAPPQY 130
              W   + +   K G+ P  +V         +    D A P Y
Sbjct: 142 GQGWLVAENEARTKTGLVPEEFVSYLQPEEEADMLHEDKARPFY 185

>ZYRO0D17358g Chr4 (1429127..1431133) [2007 bp, 668 aa] {ON} similar
           to uniprot|P15891 Saccharomyces cerevisiae YCR088W ABP1
           Actin-binding protein of the cortical actin cytoskeleton
           important for activation of the Arp2/3 complex that
           plays a key role actin in cytoskeleton organization
          Length = 668

 Score = 37.0 bits (84), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 39/75 (52%), Gaps = 9/75 (12%)

Query: 43  PEVPSR------QQSNSSKNEEWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGK 96
           P +P+R      +  N+S N   + A Y +D  +D +L     DKI+  E    +W+ G+
Sbjct: 591 PTLPARHVENENESGNTSSNPSAI-AEYDYDAAEDNELTFRENDKIVNIEFVDEDWWLGE 649

Query: 97  --CNGKVGVFPSNYV 109
               G+ G+FPSNYV
Sbjct: 650 LGSTGEKGLFPSNYV 664

>YDR162C Chr4 complement(780390..781100) [711 bp, 236 aa] {ON}
           NBP2Protein involved in the HOG (high osmolarity
           glycerol) pathway, negatively regulates Hog1p by
           recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex, found in the nucleus and cytoplasm, contains an
           SH3 domain that binds Pbs2p
          Length = 236

 Score = 36.6 bits (83), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPEWF--KGKCNGKVGVFPSNYV 109
           A+Y F+P+ D +L+L  GD + ++ K    W   + +   K G+ P  +V
Sbjct: 117 ALYDFEPENDNELRLAEGDIVFISYKHGQGWLVAENESGSKTGLVPEEFV 166

>ADL288C Chr4 complement(194687..197464) [2778 bp, 925 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL117W
           (CYK3)
          Length = 925

 Score = 37.0 bits (84), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 33/68 (48%), Gaps = 3/68 (4%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKC--NGKVGVFPSNYVRPAFSGSN 117
           V+A+Y +  + + DL  +  D I VT K    W  G+   N K G FP NYV+  +   N
Sbjct: 12  VKAVYSWSGEHEQDLGFLESDIIEVT-KVKGNWLYGRLLRNKKSGYFPVNYVQVLYEVPN 70

Query: 118 NEKSRSDA 125
               RS A
Sbjct: 71  GYIERSPA 78

>Suva_2.564 Chr2 (1002523..1002651) [129 bp, 43 aa] {ON} YDR388W
           (REAL)
          Length = 43

 Score = 33.1 bits (74), Expect = 0.044,   Method: Composition-based stats.
 Identities = 12/20 (60%), Positives = 16/20 (80%)

Query: 91  EWFKGKCNGKVGVFPSNYVR 110
           EW+ G+ NG+ GVFP NYV+
Sbjct: 20  EWWTGRYNGQQGVFPGNYVQ 39

>TBLA0F00280 Chr6 complement(58186..59916) [1731 bp, 576 aa] {ON}
           Anc_6.366 YCR088W
          Length = 576

 Score = 36.6 bits (83), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 40/73 (54%), Gaps = 6/73 (8%)

Query: 43  PEVPSRQQSNS--SKNEEWVEAIYQFDPQ--QDGDLQLMPGDKILVTEKPSPEWFKG--K 96
           P +PSR+ +    SK      AI Q+D +  +D +L     DKI+  E    +W+ G  +
Sbjct: 500 PSLPSRENATEEPSKPAGGATAIAQYDYEAAEDNELTFNENDKIINIEFVDDDWWLGELE 559

Query: 97  CNGKVGVFPSNYV 109
            +G+ G+FPSNYV
Sbjct: 560 SSGEKGLFPSNYV 572

>TPHA0H02380 Chr8 (558973..560559) [1587 bp, 528 aa] {ON} Anc_6.366
           YCR088W
          Length = 528

 Score = 36.2 bits (82), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 6/78 (7%)

Query: 38  LPRR---APEVPSRQQSNSSKNE-EWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWF 93
           LP R   AP  P R+ +   K       A Y +D  +D +L  + G KI+  E    +W+
Sbjct: 447 LPARESSAPPPPPRKVATQEKPALATAVAEYDYDAAEDNELTFVEGTKIINIEFVDDDWW 506

Query: 94  KGK--CNGKVGVFPSNYV 109
            G+    G+ G+FP+NYV
Sbjct: 507 LGENGTTGEKGLFPANYV 524

>KLTH0D08580g Chr4 (719409..721211) [1803 bp, 600 aa] {ON} similar
           to uniprot|Q05080 Saccharomyces cerevisiae YMR032W HOF1
           Bud neck-localized SH3 domain- containing protein
           required for cytokinesis
          Length = 600

 Score = 36.2 bits (82), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 35/69 (50%), Gaps = 12/69 (17%)

Query: 53  SSKNEE---WVEAIYQF-DPQQDGDLQLMPGDKILVTEKPSPEWFKGKC--------NGK 100
           SSK EE   + +A+Y F +P +   +    GD +L+TE+   +WF G+           +
Sbjct: 528 SSKGEEVLRYAKALYTFMEPNEQQIVNFHVGDYLLLTEQLDQDWFIGEVLDSQNVDPEYR 587

Query: 101 VGVFPSNYV 109
            G+ P NY+
Sbjct: 588 YGIIPRNYI 596

>NDAI0J00850 Chr10 (189221..189958) [738 bp, 245 aa] {ON} Anc_8.344
           YDR162C
          Length = 245

 Score = 35.8 bits (81), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 29/60 (48%), Gaps = 2/60 (3%)

Query: 58  EWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWF--KGKCNGKVGVFPSNYVRPAFSG 115
           +W  A+Y F+P+ D +L L   D + ++ K    W   + +   + G+ P  YV    SG
Sbjct: 107 QWAVALYDFEPENDNELGLKENDIVFISYKHGQGWLVAENEKRTQTGLVPEEYVSYLESG 166

>SAKL0H15048g Chr8 (1304135..1304758) [624 bp, 207 aa] {ON} some
           similarities with uniprot|Q12163 Saccharomyces
           cerevisiae YDR162C NBP2 Protein involved in the HOG
           (high osmolarity glycerol) pathway negatively regulates
           Hog1p by recruitment of phosphatase Ptc1p the
           Pbs2p-Hog1p complex found in the nucleus and cytoplasm
           contains an SH3 domain that binds Pbs2p
          Length = 207

 Score = 35.4 bits (80), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 31/71 (43%), Gaps = 2/71 (2%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPEWF--KGKCNGKVGVFPSNYVRPAFSGSNNE 119
           AIY F P+ D +L L  GD + ++ K    W   + +   K G+ P  YV       + +
Sbjct: 95  AIYDFIPENDNELALKEGDVVYISYKHGQGWLVAENEERTKTGLVPEEYVSFIEDDEDTQ 154

Query: 120 KSRSDAAPPQY 130
               + A P Y
Sbjct: 155 SGAEEEARPFY 165

>Smik_4.406 Chr4 complement(738389..739096) [708 bp, 235 aa] {ON}
           YDR162C (REAL)
          Length = 235

 Score = 35.4 bits (80), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPEWF--KGKCNGKVGVFPSNYV 109
           A+Y F+P+ D +L+L  G+ + ++ K    W   + +   K G+ P  +V
Sbjct: 117 ALYDFEPENDNELKLAEGEIVFISYKHGQGWLVAENESRSKTGLVPEEFV 166

>SAKL0A00594g Chr1 complement(68426..70336) [1911 bp, 636 aa] {ON}
           some similarities with uniprot|P15891 Saccharomyces
           cerevisiae YCR088W ABP1 Actin-binding protein of the
           cortical actin cytoskeleton important for activation of
           the Arp2/3 complex that plays a key role actin in
           cytoskeleton organization
          Length = 636

 Score = 35.8 bits (81), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKC--NGKVGVFPSNYV 109
           A Y ++  ++ +L    GDKI+  E    +W+ G+    G+ G+FPSNYV
Sbjct: 583 AEYDYEAGEENELTFTEGDKIINIEFVDDDWWLGELEKTGEKGLFPSNYV 632

>TPHA0F03100 Chr6 complement(680407..681552) [1146 bp, 381 aa] {ON}
           Anc_7.365 YLR191W
          Length = 381

 Score = 35.8 bits (81), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 7/61 (11%)

Query: 56  NEEWVEAIYQFDPQ-QDGDLQLMPGDKILVTEKPSP-----EWFKGKC-NGKVGVFPSNY 108
           N E+  A++ F+P+ +  +L L  GD + +  K  P     +W+K +  NG  G  PSNY
Sbjct: 305 NLEFARALFDFNPENRKIELTLTKGDLMAILTKKDPYGNTSKWWKVRTKNGDTGYVPSNY 364

Query: 109 V 109
           +
Sbjct: 365 I 365

>NCAS0B06020 Chr2 (1138359..1140953) [2595 bp, 864 aa] {ON}
           Anc_2.319 YDL117W
          Length = 864

 Score = 35.8 bits (81), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 4/55 (7%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKC--NGKV-GVFPSNYVRP 111
           V A Y +  Q  GDL  + GD + VT + + +WF G+   N K  G FP+N+V P
Sbjct: 13  VRARYGWSGQTKGDLGFLEGDIMEVT-RVAGDWFYGRLLRNKKCAGYFPNNFVIP 66

>KLLA0D16874g Chr4 complement(1430953..1431636) [684 bp, 227 aa]
           {ON} similar to uniprot|Q12163 Saccharomyces cerevisiae
           YDR162C NBP2 Protein involved in the HOG (high
           osmolarity glycerol) pathway negatively regulates Hog1p
           by recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex found in the nucleus and cytoplasm contains an
           SH3 domain that binds Pbs2p
          Length = 227

 Score = 35.4 bits (80), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCN--GKVGVFPSNYVR 110
           A+Y F P+ D +L+L  GD + ++ K    W   + +   K G+ P  YV+
Sbjct: 67  AMYAFVPENDNELELKEGDVVYISYKHGQGWLVAENHDRSKTGLVPEEYVQ 117

>Smik_13.202 Chr13 (329496..331487) [1992 bp, 663 aa] {ON} YMR032W
           (REAL)
          Length = 663

 Score = 35.8 bits (81), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 8/46 (17%)

Query: 79  GDKILVTEKPSPEWFKGKC--------NGKVGVFPSNYVRPAFSGS 116
           GD IL+TE  + +W+KG+         N +VG+ P N+++    GS
Sbjct: 618 GDYILITEIVNKDWYKGEVYDNDRINRNHRVGLIPYNFIQLLHQGS 663

>KLLA0C12551g Chr3 complement(1065593..1067416) [1824 bp, 607 aa]
           {ON} weakly similar to uniprot|Q05080 Saccharomyces
           cerevisiae YMR032W HOF1 Bud neck-localized SH3 domain-
           containing protein required for cytokinesis
          Length = 607

 Score = 35.4 bits (80), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 34/57 (59%), Gaps = 4/57 (7%)

Query: 58  EWVEAIYQF-DPQQDGDLQLMPGDKILVTEKPSPEWFKGKC---NGKVGVFPSNYVR 110
           ++V+A+Y + +P ++  L    GD +L+ E  + +W+ G+    N + G+ P NYV+
Sbjct: 548 KYVKAMYSYTEPNENNILLFNSGDILLLVECINDDWYVGEVYQGNKQHGLVPMNYVK 604

>KAFR0B05860 Chr2 complement(1210822..1211571) [750 bp, 249 aa] {ON}
           Anc_8.344 YDR162C
          Length = 249

 Score = 35.0 bits (79), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 36/72 (50%), Gaps = 5/72 (6%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPEWF--KGKCNGKVGVFPSNYVRPAFSGSNNE 119
           A+Y F+P+ D +L L  GD + ++ +    W   + +   K G+ P  +V  +F  ++ E
Sbjct: 117 ALYDFEPENDNELGLHEGDIVFISYRHGQGWLVAENQPRTKTGLVPEEFV--SFLDNDEE 174

Query: 120 -KSRSDAAPPQY 130
            K   D A P Y
Sbjct: 175 DKEAHDMARPFY 186

>Ecym_4228 Chr4 (475985..476770) [786 bp, 261 aa] {ON} similar to
           Ashbya gossypii AGL169C
          Length = 261

 Score = 35.0 bits (79), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGK-CNG-KVGVFPSNYV 109
           V A+Y F P+ D +L+L  GD I ++ K    W   +  +G + G+ P  YV
Sbjct: 119 VVALYDFVPENDNELELKEGDVIYISYKHGQGWLVAENIDGTRTGLVPEEYV 170

>AGR306C Chr7 complement(1305647..1308418) [2772 bp, 923 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL020C
           (BBC1)
          Length = 923

 Score = 35.4 bits (80), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 27/58 (46%), Gaps = 5/58 (8%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWF-----KGKCNGKVGVFPSNYVRPA 112
           V A Y ++   DGDL    G +I V      +W+      G  N + G+FP NYV  A
Sbjct: 13  VIAKYTYESIHDGDLNFEDGQRIEVISIEDNQWYYGHFVDGAGNEQEGIFPKNYVEVA 70

>SAKL0H24222g Chr8 complement(2089734..2094314) [4581 bp, 1526 aa]
           {ON} similar to uniprot|P04821 Saccharomyces cerevisiae
           YLR310C CDC25 Membrane bound guanine nucleotide exchange
           factor (GEF or GDP-release factor) indirectly regulates
           adenylate cyclase through activation of Ras1p and Ras2p
           by stimulating the exchange of GDP for GTP required for
           progression through G1
          Length = 1526

 Score = 35.4 bits (80), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 35/74 (47%), Gaps = 10/74 (13%)

Query: 45  VPSRQQSNSSKNE-----EWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKG---K 96
           VPS +++ SS +      + V A Y + P +   L+L+ GD + V  K    W+ G    
Sbjct: 6   VPSHEETGSSGSTLVRPVDVVVATYDYVPSRKSQLRLIQGDTVYVLSKQDSGWWDGIILD 65

Query: 97  CNGKV--GVFPSNY 108
            N K   G FP NY
Sbjct: 66  SNNKASRGWFPCNY 79

>SAKL0E06820g Chr5 complement(556960..559677) [2718 bp, 905 aa] {ON}
           similar to uniprot|Q07533 Saccharomyces cerevisiae
           YDL117W CYK3 SH3-domain protein located in the
           mother-bud neck and the cytokinetic actin ring mutant
           phenotype and genetic interactions suggest a role in
           cytokinesis
          Length = 905

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (57%), Gaps = 3/52 (5%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKC--NGKVGVFPSNYV 109
           V+AIY +  +++ DL  +  D I VT K    W+ G+   N K G FP+NYV
Sbjct: 12  VKAIYSWSGEKEYDLGFIEEDIIEVT-KAKGGWYYGRLLRNKKSGSFPANYV 62

>TDEL0G02490 Chr7 (478524..481076) [2553 bp, 850 aa] {ON} Anc_2.319
           YDL117W
          Length = 850

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 4/53 (7%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKC--NGKV-GVFPSNYV 109
           V+A Y +  Q  GDL  + GD + VT + + +WF GK   N K  G FP+N+V
Sbjct: 13  VKARYGWSGQTKGDLGFLEGDVMEVT-RITGDWFYGKLLRNKKCSGYFPNNFV 64

>SAKL0H21912g Chr8 complement(1913307..1917068) [3762 bp, 1253 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1253

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 6/75 (8%)

Query: 60  VEAIYQFDPQQDGDLQLM--PGDKILVTEKPSPEWF--KGKCNGKVGVFPSNYVRPAFSG 115
            +A+Y +D  Q+ D +L+   GD+  V +   P+W     K +G++G  P NYV    S 
Sbjct: 74  AKALYDYDQVQNPDEELLFHEGDEFDVYDNRDPDWILCSSKTSGEIGFVPGNYVE--ISE 131

Query: 116 SNNEKSRSDAAPPQY 130
           +    S S   PPQ+
Sbjct: 132 ATPVGSNSFPPPPQH 146

>Skud_12.256 Chr12 (483859..485070) [1212 bp, 403 aa] {ON} YLR191W
           (REAL)
          Length = 403

 Score = 34.7 bits (78), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 7/59 (11%)

Query: 58  EWVEAIYQFDPQQ-DGDLQLMPGDKILVTEKPSP-----EWFKGKC-NGKVGVFPSNYV 109
           E+  A+Y F P+    ++ L  GD + +  K  P     +W+K +  NGK+G  P NY+
Sbjct: 326 EFARALYDFVPENPQIEVALTKGDLMAILSKKDPIGKNSDWWKVRTKNGKIGYIPYNYI 384

>NDAI0B03330 Chr2 (848506..851265) [2760 bp, 919 aa] {ON} Anc_2.319
           YDL117W
          Length = 919

 Score = 34.7 bits (78), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 4/53 (7%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKC--NGKV-GVFPSNYV 109
           V A Y +  Q  GDL  + GD + VT + + +WF GK   N K  G FP+N+V
Sbjct: 15  VRAKYGWSGQAKGDLGFLEGDIMEVT-RVAGDWFYGKLLRNRKCAGYFPNNFV 66

>CAGL0E01045g Chr5 (94265..94906) [642 bp, 213 aa] {ON} similar to
           uniprot|Q12163 Saccharomyces cerevisiae YDR162c NBP2
           NAP1P-binding protein
          Length = 213

 Score = 33.9 bits (76), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPEWF--KGKCNGKVGVFPSNYV 109
           A+Y F+P+ D +L L  GD I ++ +    W   +     K G+ P  +V
Sbjct: 101 ALYDFEPENDNELGLKEGDVIFISYRHCQGWLVAQNDTQTKTGLVPEEFV 150

>Kpol_2000.2 s2000 complement(1407..2084) [678 bp, 225 aa] {ON}
           complement(1407..2084) [678 nt, 226 aa]
          Length = 225

 Score = 33.9 bits (76), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNG--KVGVFPSNYV 109
           A+Y F P+ D +L L  GD + ++ K    W   +  G  K G+ P  +V
Sbjct: 107 ALYDFVPENDSELGLEEGDIVFISYKHGQGWLVAENQGRTKTGLVPEEFV 156

>KLLA0E09043g Chr5 complement(807159..809603) [2445 bp, 814 aa] {ON}
           similar to uniprot|Q07533 Saccharomyces cerevisiae
           YDL117W CYK3 SH3-domain protein located in the
           mother-bud neck and the cytokinetic actin ring mutant
           phenotype and genetic interactions suggest a role in
           cytokinesis
          Length = 814

 Score = 34.3 bits (77), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 3/52 (5%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKC--NGKVGVFPSNYV 109
           V+  + +  ++  DL  + GD I VT + + +W+ GK   N K G FPSNYV
Sbjct: 11  VKTNFAWSGEKKDDLGFLEGDFIEVT-RVTGDWYFGKLIRNKKQGYFPSNYV 61

>KLLA0F23848g Chr6 (2224951..2226900) [1950 bp, 649 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 649

 Score = 34.3 bits (77), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 1/49 (2%)

Query: 62  AIYQFDPQQDGDLQLMPGDKI-LVTEKPSPEWFKGKCNGKVGVFPSNYV 109
           A Y +  Q   +L L  GDKI ++ E     W  G+ NG  G+FP+ Y 
Sbjct: 600 AAYPYQSQGPDELSLQVGDKIKVLKEDEGNGWTFGELNGTQGLFPTTYC 648

>Ecym_4710 Chr4 (1391055..1392254) [1200 bp, 399 aa] {ON} similar to
           Ashbya gossypii ACR230C
          Length = 399

 Score = 33.9 bits (76), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 37/79 (46%), Gaps = 9/79 (11%)

Query: 40  RRAPEVPSRQQSNSS--KNEEWVEAIYQFDPQQDG-DLQLMPGDKILVTEKPSP-----E 91
           RR    P++ Q       N E+  A+Y F P+    +  L  GD + +  K  P     +
Sbjct: 295 RRIAGGPAQHQLQGIDLNNLEFARAVYDFTPENPRIECSLKKGDLMAIISKLDPTGNESQ 354

Query: 92  WFKGKCN-GKVGVFPSNYV 109
           W+K +   G+VG  PSNY+
Sbjct: 355 WWKVRTKKGEVGYIPSNYI 373

>ZYRO0A02662g Chr1 (213322..215982) [2661 bp, 886 aa] {ON} similar
           to uniprot|Q07533 Saccharomyces cerevisiae YDL117W CYK3
           SH3-domain protein located in the mother-bud neck and
           the cytokinetic actin ring mutant phenotype and genetic
           interactions suggest a role in cytokinesis
          Length = 886

 Score = 34.3 bits (77), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 4/53 (7%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKC--NGKV-GVFPSNYV 109
           V+A Y +  Q  GDL  + GD + VT + + +WF G+   N K  G FP+N+V
Sbjct: 14  VKARYGWSGQTKGDLGFLEGDVMEVT-RITGDWFYGRLLRNKKCSGYFPNNFV 65

>SAKL0F11748g Chr6 complement(915861..917087) [1227 bp, 408 aa] {ON}
           similar to uniprot|P80667 Saccharomyces cerevisiae
           YLR191W PEX13 Integral peroxisomal membrane receptor
          Length = 408

 Score = 33.9 bits (76), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 7/62 (11%)

Query: 55  KNEEWVEAIYQFDPQQ-DGDLQLMPGDKILVTEKPSP-----EWFKGKC-NGKVGVFPSN 107
           KN E+  A+Y F P+    ++ L  GD + +  K  P     +W+K +   G +G  P N
Sbjct: 321 KNLEFARAVYDFTPENPQIEVTLKKGDLMAIISKQDPIGNESQWWKVRTKKGDIGYVPYN 380

Query: 108 YV 109
           Y+
Sbjct: 381 YI 382

>ZYRO0G10098g Chr7 complement(808399..812577) [4179 bp, 1392 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1392

 Score = 34.3 bits (77), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 8/61 (13%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPS-PEWFKGK-------CNGKVGVFPSNYVRP 111
           V+A+Y ++PQ D +L +   D + + EK    EW+  K            G+ PSNYV P
Sbjct: 8   VKALYDYEPQTDEELAIKEDDILYLLEKSDVDEWWTVKKRVIGLDAEEPTGLVPSNYVEP 67

Query: 112 A 112
           A
Sbjct: 68  A 68

>NCAS0A14570 Chr1 complement(2869713..2870780) [1068 bp, 355 aa]
           {ON} Anc_7.419 YER118C
          Length = 355

 Score = 33.9 bits (76), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 60  VEAIYQF--DPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVR 110
           V+A+Y +  D     +L    GD + V++     W   K NG+ G+ PSNYV+
Sbjct: 300 VKALYSYKADDSDAYELSFEQGDILKVSDIEGRWWKARKENGQTGIIPSNYVK 352

>TBLA0C05560 Chr3 complement(1346488..1348509) [2022 bp, 673 aa]
           {ON} Anc_2.159 YHR114W
          Length = 673

 Score = 33.9 bits (76), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 3/51 (5%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKP--SPEWFKGKCNGKVGVFPSNYVR 110
           A+Y ++ Q D ++ L  GD I V  KP     W  G+ N K  +FP++Y +
Sbjct: 619 ALYPYEAQGDDEMSLAVGDTIKVI-KPDDGSGWTFGELNNKQSLFPTSYCK 668

>TBLA0B09620 Chr2 complement(2277581..2280406) [2826 bp, 941 aa]
           {ON} Anc_2.319 YDL117W
          Length = 941

 Score = 33.9 bits (76), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 4/54 (7%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKC--NGKV-GVFPSNYVR 110
           V+A Y +  Q  GDL  + GD + VT K + +W+ G+   N K  G FP+N+V+
Sbjct: 15  VKAKYGWSGQAKGDLGFLEGDVMEVT-KITGDWYYGRLLRNRKCSGYFPNNFVK 67

>SAKL0G17600g Chr7 complement(1523623..1524948) [1326 bp, 441 aa]
           {ON} conserved hypothetical protein
          Length = 441

 Score = 33.5 bits (75), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 7/58 (12%)

Query: 59  WVEAIYQF--DPQQDG---DLQLMPGDKILVTEKPSPEWFKGKC--NGKVGVFPSNYV 109
           +  A+Y +  DP Q G   DL    GD I V +K    W+ G+     + G FP N+V
Sbjct: 378 YATALYDYSPDPNQQGTGEDLTFKNGDMIRVIKKTENNWWYGEVLRTKRRGYFPVNFV 435

>YDL117W Chr4 (248581..251238) [2658 bp, 885 aa] {ON}
           CYK3SH3-domain protein located in the mother-bud neck
           and the cytokinetic actin ring; mutant phenotype and
           genetic interactions suggest a role in cytokinesis
          Length = 885

 Score = 33.5 bits (75), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKC--NGKV-GVFPSNYV 109
           V+A Y +  Q  GDL  + GD + VT + +  WF GK   N K  G FP N+V
Sbjct: 14  VKARYGWSGQTKGDLGFLEGDIMEVT-RIAGSWFYGKLLRNKKCSGYFPHNFV 65

>YLR191W Chr12 (537272..538432) [1161 bp, 386 aa] {ON}
           PEX13Integral peroxisomal membrane protein required for
           translocation of peroxisomal matrix proteins, interacts
           with the PTS1 signal recognition factor Pex5p and the
           PTS2 signal recognition factor Pex7p, forms a complex
           with Pex14p and Pex17p
          Length = 386

 Score = 33.1 bits (74), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 7/59 (11%)

Query: 58  EWVEAIYQFDPQQ-DGDLQLMPGDKILVTEKPSP-----EWFKGKC-NGKVGVFPSNYV 109
           E+  A+Y F P+  + ++ L  GD + +  K  P     +W+K +  NG +G  P NY+
Sbjct: 309 EFARALYDFVPENPEMEVALKKGDLMAILSKKDPLGRDSDWWKVRTKNGNIGYIPYNYI 367

>ACR230C Chr3 complement(763430..764626) [1197 bp, 398 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR191W
           (PEX13)
          Length = 398

 Score = 33.1 bits (74), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 38/84 (45%), Gaps = 7/84 (8%)

Query: 33  KIHDLLPRRAPEVPSRQQSNSSKNEEWVEAIYQFDPQQDG-DLQLMPGDKILVTEKPSP- 90
           K+ ++  R     P + QS    + E+  AIY F P+    +  L  GD + +  +  P 
Sbjct: 290 KLQEMQNRGRIATPHQPQSLDLNSLEFARAIYDFTPENPRIECALKKGDLMAIISRQDPT 349

Query: 91  ----EWFKGKC-NGKVGVFPSNYV 109
               +W+K +   G VG  P NY+
Sbjct: 350 GKESQWWKVRTKKGDVGYVPCNYI 373

>KNAG0A05020 Chr1 (731413..732225) [813 bp, 270 aa] {ON} Anc_8.344
           YDR162C
          Length = 270

 Score = 32.7 bits (73), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 30/71 (42%), Gaps = 2/71 (2%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPEWF--KGKCNGKVGVFPSNYVRPAFSGSNNE 119
           A+Y F+P+ D +L+L   D + ++ K    W   + +   K G+ P  +V    S     
Sbjct: 141 ALYDFEPENDNELELKEEDVVYISYKHGQGWLVAENEQRTKTGLVPEEFVSYIESDEAER 200

Query: 120 KSRSDAAPPQY 130
               D   P Y
Sbjct: 201 TQDEDVVRPFY 211

>Ecym_5426 Chr5 (877285..879303) [2019 bp, 672 aa] {ON} similar to
           Ashbya gossypii ACR266W
          Length = 672

 Score = 33.1 bits (74), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 1/51 (1%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKI-LVTEKPSPEWFKGKCNGKVGVFPSNYV 109
           V A+Y +  +   ++ +  GD I ++ +     W  G+  G  G+FPSNY 
Sbjct: 621 VIAVYDYAAKDFDEISIRAGDVIKVIRDDTGNGWTYGEVRGSRGLFPSNYC 671

>Suva_13.201 Chr13 (325718..327724) [2007 bp, 668 aa] {ON} YMR032W
           (REAL)
          Length = 668

 Score = 33.1 bits (74), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 9/67 (13%)

Query: 58  EWVEAIYQFDPQQD-GDLQLMPGDKILVTEKPSPEWFKGKC--------NGKVGVFPSNY 108
           E+ +A+Y     +  G      GD IL+TE  + +WFKG+         + +VG+ P N+
Sbjct: 601 EYAKAMYPLVGNEAPGLANFHKGDYILITEIVNKDWFKGEVYNNDRIERDHRVGLIPYNF 660

Query: 109 VRPAFSG 115
           ++    G
Sbjct: 661 IQLLHQG 667

>TDEL0F04680 Chr6 complement(881920..882714) [795 bp, 264 aa] {ON}
           Anc_8.344 YDR162C
          Length = 264

 Score = 32.7 bits (73), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPEWF--KGKCNGKVGVFPSNYV 109
           A+Y F+P+ D +L L  GD + ++ +    W   + +   K G+ P  +V
Sbjct: 121 ALYDFEPENDNELGLTEGDIVYISYRHGQGWLVAENQEGTKTGLVPEEFV 170

>Smik_4.119 Chr4 (225256..227919) [2664 bp, 887 aa] {ON} YDL117W
           (REAL)
          Length = 887

 Score = 33.1 bits (74), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKC--NGKV-GVFPSNYV 109
           V+A Y +  Q  GDL  + GD + VT + +  WF G+   N K  G FP N+V
Sbjct: 14  VKARYGWSGQTKGDLGFLEGDIMEVT-RIAGSWFYGRLLRNKKCSGYFPHNFV 65

>KLTH0G11682g Chr7 (984811..985374) [564 bp, 187 aa] {ON} weakly
           similar to uniprot|Q12163 Saccharomyces cerevisiae
           YDR162C NBP2 Protein involved in the HOG (high
           osmolarity glycerol) pathway negatively regulates Hog1p
           by recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex found in the nucleus and cytoplasm contains an
           SH3 domain that binds Pbs2p
          Length = 187

 Score = 32.3 bits (72), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKC--NGKVGVFPSNYV 109
           A+Y F P+ D +L+L  GD + +  +    W   +     + G+ P  YV
Sbjct: 73  ALYDFVPENDNELELREGDVLFIGYRHGQGWLVAENAERTRTGLVPEEYV 122

>Smik_12.251 Chr12 (484225..485391) [1167 bp, 388 aa] {ON} YLR191W
           (REAL)
          Length = 388

 Score = 32.7 bits (73), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 31/59 (52%), Gaps = 7/59 (11%)

Query: 58  EWVEAIYQFDPQQ-DGDLQLMPGDKILVTEKPSP-----EWFKGKC-NGKVGVFPSNYV 109
           E+  A+Y F P+  + ++ L  GD + +  K  P     +W+K +  NG +G  P NY+
Sbjct: 311 EFARALYDFVPENPEMEVALKKGDLMAILSKKDPVGRDSDWWKVRTKNGNIGYIPYNYI 369

>Suva_4.129 Chr4 (237039..239702) [2664 bp, 887 aa] {ON} YDL117W
           (REAL)
          Length = 887

 Score = 33.1 bits (74), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKC--NGKV-GVFPSNYV 109
           V+A Y +  Q  GDL  + GD + VT + +  WF G+   N K  G FP N+V
Sbjct: 14  VKARYGWSGQTKGDLGFLEGDIMEVT-RIAGSWFYGRLLRNKKCSGYFPHNFV 65

>KNAG0H03500 Chr8 (652236..654140) [1905 bp, 634 aa] {ON} Anc_2.159
           YHR114W
          Length = 634

 Score = 33.1 bits (74), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 3/66 (4%)

Query: 53  SSKNEEWVEAIYQFDPQQDGDLQLMPGDKI-LVTEKPSPEW--FKGKCNGKVGVFPSNYV 109
           +S ++E  + +Y +  Q D ++ + PGD I LVT      W   +    G  G+ P+ Y+
Sbjct: 499 ASSSDEENKVLYAYTQQDDDEISVTPGDVIELVTPDSGSGWTQIRNVTTGAEGLVPTTYI 558

Query: 110 RPAFSG 115
               SG
Sbjct: 559 SVRESG 564

>Skud_4.137 Chr4 (244217..246880) [2664 bp, 887 aa] {ON} YDL117W
           (REAL)
          Length = 887

 Score = 33.1 bits (74), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKC--NGKV-GVFPSNYV 109
           V+A Y +  Q  GDL  + GD + VT + +  WF G+   N K  G FP N+V
Sbjct: 14  VKARYGWSGQTKGDLGFLEGDIMEVT-RIAGSWFYGRLLRNKKCSGYFPHNFV 65

>Kpol_1024.45 s1024 (120171..121835) [1665 bp, 554 aa] {ON}
           (120171..121835) [1665 nt, 555 aa]
          Length = 554

 Score = 32.7 bits (73), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 5/67 (7%)

Query: 48  RQQSNSSKNEEWVEAI--YQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKV---G 102
           RQQSN S     + AI  Y F  ++  +L +  G+ + +    + EWF  K  G++   G
Sbjct: 143 RQQSNESSKMGSLYAIVLYDFQAEKSDELTVYVGENLFICAHHNYEWFIAKPIGRLGGPG 202

Query: 103 VFPSNYV 109
           + P ++V
Sbjct: 203 LVPVDFV 209

>KLLA0F10175g Chr6 complement(944501..946231) [1731 bp, 576 aa] {ON}
           similar to uniprot|P15891 Saccharomyces cerevisiae
           YCR088W ABP1 Actin-binding protein of the cortical actin
           cytoskeleton important for activation of the Arp2/3
           complex that plays a key role actin in cytoskeleton
           organization
          Length = 576

 Score = 32.7 bits (73), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 43/85 (50%), Gaps = 9/85 (10%)

Query: 29  KTYSKIHDLLPRRAPEV--PSRQQSNSSKNEEWVEAIYQFDPQQDGDLQLMPGDKILVTE 86
           + +SK  +  P  AP    P +++S  S       A Y ++  +D +L     ++I+  +
Sbjct: 493 RAFSKSQNTPPSPAPRASKPGKKESGPS-----AIAEYDYEAGEDNELTFEENERIINIQ 547

Query: 87  KPSPEWFKGK--CNGKVGVFPSNYV 109
               +W+ G+   +G+ G+FPSNYV
Sbjct: 548 FVDDDWWLGELESSGEKGLFPSNYV 572

>Kwal_26.8323 s26 (739043..740926) [1884 bp, 627 aa] {ON} YMR032W
           (HOF1) - SH3 domain containing-protein [contig 59] FULL
          Length = 627

 Score = 32.7 bits (73), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 34/69 (49%), Gaps = 12/69 (17%)

Query: 53  SSKNEE---WVEAIYQF-DPQQDGDLQLMPGDKILVTEKPSPEWFKGKC--------NGK 100
           SSK E+   + +A+Y F +  +   +    GD +L+TE+   +WF G+           +
Sbjct: 555 SSKEEKVLKYAKALYTFMEANEQQIVNFRAGDYLLLTEQLDQDWFIGEVLDSHDVEPEYR 614

Query: 101 VGVFPSNYV 109
            G+ P NY+
Sbjct: 615 YGIIPRNYI 623

>Suva_5.239 Chr5 complement(373672..374778) [1107 bp, 368 aa] {ON}
           YER118C (REAL)
          Length = 368

 Score = 32.3 bits (72), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 60  VEAIYQFDPQQDGDLQL-MPGDKILVTEKPSPEWFKGK-CNGKVGVFPSNYVR 110
            +A+Y +D   D   ++    ++IL        W+K +  NG+ G+ PSNYV+
Sbjct: 306 AKALYPYDADGDDAYEISFEQNEILQVSDIEGRWWKARRANGETGIIPSNYVQ 358

>SAKL0E10780g Chr5 (897714..899591) [1878 bp, 625 aa] {ON} similar
           to uniprot|Q75BK5 Ashbya gossypii ACR266W ACR266Wp and
           some similarites with YHR114W uniprot|P38822
           Saccharomyces cerevisiae YHR114W BZZ1 SH3 domain protein
           implicated in the regulation of actin polymerization
           able to recruit actin polymerization machinery through
           its SH3 domains colocalizes with cortical actin patches
           and Las17p interacts with type I myosins
          Length = 625

 Score = 32.7 bits (73), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 3/61 (4%)

Query: 52  NSSKNEEWVEAIYQFDPQQDGDLQLMPGDKI-LVTEKPSPEWFKGK--CNGKVGVFPSNY 108
           NSS        +Y +  Q   ++ + PGD I LVT+     W K K    G++G+ PS+Y
Sbjct: 489 NSSVESSINRVLYPYAKQDADEVTINPGDLISLVTKDTGSGWTKIKNSTTGEMGLVPSSY 548

Query: 109 V 109
           V
Sbjct: 549 V 549

>TDEL0A07810 Chr1 (1355773..1357449) [1677 bp, 558 aa] {ON}
           Anc_6.366 YCR088W
          Length = 558

 Score = 32.3 bits (72), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKC--NGKVGVFPSNYV 109
           A Y ++  ++ +L     DKI+  +    +W+ G+   NG+ G+FPSNYV
Sbjct: 506 AEYDYEAAEENELTFNENDKIINIDFVDDDWWLGELERNGEKGLFPSNYV 555

>AGL237C Chr7 complement(254636..256372) [1737 bp, 578 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR088W
           (ABP1)
          Length = 578

 Score = 32.3 bits (72), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKC--NGKVGVFPSNYV 109
           A Y ++  +D +L    GD I+  +    +W+ G+    G+ G+FPSNYV
Sbjct: 525 AEYDYEAGEDNELTFEEGDVIVNIDFVDDDWWLGELQKTGQKGLFPSNYV 574

>TBLA0A00610 Chr1 complement(119166..120959) [1794 bp, 597 aa] {ON}
           Anc_8.539 YBR200W
          Length = 597

 Score = 32.3 bits (72), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 38/76 (50%), Gaps = 2/76 (2%)

Query: 27  DKKTYSKIHDLLPRRAPEVPSRQQSNSSKNEEWVEAIYQFDPQQDGDLQLMPGDKILVTE 86
           DK   + I +LLP  + E+   ++    K+  +   +Y F+  ++ +L +  G+ + +  
Sbjct: 135 DKIEMTDIENLLPD-SKEISGDKKKKIFKSL-YALCLYDFEAAKEDELTVYAGETLFIYA 192

Query: 87  KPSPEWFKGKCNGKVG 102
               EWF G+  G++G
Sbjct: 193 HYEEEWFIGRPLGRIG 208

>TPHA0F00380 Chr6 (85560..90416) [4857 bp, 1618 aa] {ON} Anc_4.45
           Scer_YGOB_SDC25
          Length = 1618

 Score = 32.7 bits (73), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 25/45 (55%), Gaps = 4/45 (8%)

Query: 71  DGDLQLMPGDKILVTEKPSPEWFKGKC-NGKV---GVFPSNYVRP 111
           D  L+  PGDKI V  K    W+ G   +GKV   G FP ++V+P
Sbjct: 50  DTYLRFNPGDKIYVLNKNDNGWWDGIVLHGKVVTRGWFPLHFVKP 94

>YMR032W Chr13 (335298..337307) [2010 bp, 669 aa] {ON}  HOF1Bud
           neck-localized, SH3 domain-containing protein required
           for cytokinesis; regulates actomyosin ring dynamics and
           septin localization; interacts with the formins, Bni1p
           and Bnr1p, and with Cyk3p, Vrp1p, and Bni5p
          Length = 669

 Score = 32.3 bits (72), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 33/67 (49%), Gaps = 9/67 (13%)

Query: 58  EWVEAIYQFDPQQD-GDLQLMPGDKILVTEKPSPEWFKGKC--------NGKVGVFPSNY 108
           E+ +A+Y     +  G      GD +L+TE  + +W+KG+         N ++G+ P N+
Sbjct: 602 EYAKAMYPLIGNEAPGLANFHKGDYLLITEIVNKDWYKGEVYDNDRIDRNHRIGLIPYNF 661

Query: 109 VRPAFSG 115
           ++    G
Sbjct: 662 IQLLHQG 668

>TPHA0K00680 Chr11 (134675..135742) [1068 bp, 355 aa] {ON} Anc_7.419
           YER118C
          Length = 355

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 25/47 (53%)

Query: 64  YQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVR 110
           YQ D     ++    G+ + V++     W   + NG+VG+ PSNYV+
Sbjct: 305 YQADDADGYEISFEQGEILKVSDIEGRWWKSKRENGQVGIIPSNYVQ 351

>KLLA0E06953g Chr5 (629777..630850) [1074 bp, 357 aa] {ON}
           uniprot|Q9P863 Kluyveromyces lactis sho1 Putative
           membrane protein
          Length = 357

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 61  EAIYQFDPQQDG--DLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVR 110
           EA+Y +   Q    ++    G+ + V +     W   K NG+ G+ PSNYV+
Sbjct: 299 EALYTYQADQTDAYEISFEQGEILRVGDIEGRWWKAKKSNGETGIIPSNYVK 350

>NCAS0B06980 Chr2 (1328203..1330122) [1920 bp, 639 aa] {ON}
           Anc_2.159 YHR114W
          Length = 639

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 33/72 (45%), Gaps = 12/72 (16%)

Query: 39  PRRAPEVPSRQQSNSSKNEEWVEAIYQFDPQQDGDLQLMPGDKILVTE-KPSPEWFKGKC 97
           PRR+  +P+R  +          A Y +  Q D ++ +  GD I V        W  G+ 
Sbjct: 578 PRRST-LPTRTMT----------AKYPYVAQGDDEMSINAGDTISVIRGDDGSGWTYGEL 626

Query: 98  NGKVGVFPSNYV 109
           NG  G+FP++Y 
Sbjct: 627 NGVKGLFPTSYC 638

>TDEL0F02380 Chr6 (438262..442029) [3768 bp, 1255 aa] {ON} Anc_4.108
           YBL007C
          Length = 1255

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 27/60 (45%), Gaps = 4/60 (6%)

Query: 60  VEAIYQFDPQQ--DGDLQLMPGDKILVTEKPSPEWF--KGKCNGKVGVFPSNYVRPAFSG 115
           V A+Y +D  Q  D +L     ++  V +   P+W   + K  G  G  P NYV P   G
Sbjct: 74  VRALYDYDQAQNPDEELTFHENEEFDVYDDQDPDWLLVQQKSTGACGFVPGNYVEPCGQG 133

>KAFR0L01580 Chr12 complement(286684..287718) [1035 bp, 344 aa] {ON}
           Anc_7.365 YLR191W
          Length = 344

 Score = 31.6 bits (70), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 7/59 (11%)

Query: 58  EWVEAIYQFDPQQ-DGDLQLMPGDKILVTEKPSP-----EWFKGKC-NGKVGVFPSNYV 109
           E+  AIY F P+  + ++ L  GD + +  K        +W+K +  NG VG  P NY+
Sbjct: 260 EFARAIYNFVPENPNIEVNLQKGDLMAILSKKDSFGNDSQWWKVRTKNGSVGFVPFNYI 318

>Suva_10.287 Chr10 (509884..511062) [1179 bp, 392 aa] {ON} YLR191W
           (REAL)
          Length = 392

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 7/59 (11%)

Query: 58  EWVEAIYQFDPQQ-DGDLQLMPGDKILVTEKPSP-----EWFKGKC-NGKVGVFPSNYV 109
           E+  A+Y F P+    ++ L  GD + +  K  P     +W+K +  NG +G  P NY+
Sbjct: 315 EFARALYDFIPENPQMEVALKKGDLMAILSKKDPLGKDSDWWKVRTKNGSIGYIPYNYI 373

>KNAG0C02910 Chr3 complement(577437..581171) [3735 bp, 1244 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1244

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 32/71 (45%), Gaps = 5/71 (7%)

Query: 45  VPSRQQSNSSKNEEWVEAIYQFDPQQ--DGDLQLMPGDKILVTEKPSPEWF--KGKCNGK 100
           VPS     S    +W  A+Y +D  Q  D +L     D   + +   P+W   + + +G 
Sbjct: 60  VPSNYIEESPVIGQW-RALYDYDQPQNPDEELAFKENDTFDLFDAQDPDWLLVRSQRDGS 118

Query: 101 VGVFPSNYVRP 111
           VG  P NYV P
Sbjct: 119 VGFVPGNYVEP 129

>TPHA0G00930 Chr7 (179525..181999) [2475 bp, 824 aa] {ON} Anc_2.319
           YDL117W
          Length = 824

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 4/53 (7%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKG---KCNGKVGVFPSNYV 109
           V+A Y +  Q  GDL  + GD + VT K + +W+ G   +     G FP N+V
Sbjct: 7   VKARYGWSGQAKGDLGFLEGDIMNVT-KTTGDWYYGFLLRNKKSKGYFPKNFV 58

>ZYRO0F01166g Chr6 complement(90553..92799) [2247 bp, 748 aa] {ON}
           similar to uniprot|Q05080 Saccharomyces cerevisiae
           YMR032W HOF1 Bud neck-localized SH3 domain-containing
           protein required for cytokinesis
          Length = 748

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 34/63 (53%), Gaps = 9/63 (14%)

Query: 58  EWVEAIYQFDPQQDGDL-QLMPGDKILVTEKPSPEWFKGKC--NGKV------GVFPSNY 108
           ++ +A+Y    +   +L Q   GD +L+T + + EW++G+   N  V      G+ P N+
Sbjct: 684 KYAKAVYPLYEENVPELAQFQRGDYLLITGEVNDEWYRGEVYSNDYVSQGSSSGLIPHNF 743

Query: 109 VRP 111
           ++P
Sbjct: 744 IKP 746

>KLLA0E23365g Chr5 complement(2077042..2078760,2078979..2078987)
           [1728 bp, 575 aa] {ON} similar to uniprot|P29366
           Saccharomyces cerevisiae YBR200W BEM1 Protein containing
           SH3-domains involved in establishing cell polarity and
           morphogenesis functions as a scaffold protein for
           complexes that include Cdc24p Ste5p Ste20p and Rsr1p
          Length = 575

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 3/54 (5%)

Query: 57  EEWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGK--CNGKVGVFPSNY 108
           E+ ++A+Y +  Q  G+L    GD   V ++ + +W++     +GK G+ P NY
Sbjct: 65  EKVIKALYNYQAQSAGELSFNKGDFFHVQQEEN-DWYEASNPADGKRGMVPKNY 117

>KAFR0K02000 Chr11 complement(410316..411314) [999 bp, 332 aa] {ON}
           Anc_7.419 YER118C
          Length = 332

 Score = 31.2 bits (69), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 24/47 (51%)

Query: 64  YQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVR 110
           YQ D     ++    G+ + V++     W   + NG+ G+ PSNYV+
Sbjct: 278 YQADESDQYEISFEQGEILRVSDIEGRWWKAKRENGETGIIPSNYVQ 324

>NCAS0D01950 Chr4 (358938..361757) [2820 bp, 939 aa] {ON} Anc_5.170
          Length = 939

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 26/51 (50%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVR 110
           V+A + +  + + DL       I VT     EW+ G+   K G+FP ++V+
Sbjct: 10  VQAQFPYKSEYEDDLNFGKDQIITVTNVEDDEWYYGEYADKEGIFPKSFVK 60

>TDEL0C02810 Chr3 complement(498625..499638) [1014 bp, 337 aa] {ON}
           Anc_7.419 YER118C
          Length = 337

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 24/47 (51%)

Query: 64  YQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVR 110
           YQ D     ++    G+ + V++     W   + NG+ G+ PSNYV+
Sbjct: 284 YQADAGDAYEISFDQGEILKVSDIEGRWWKAKRANGETGIIPSNYVQ 330

>NCAS0B02220 Chr2 (363992..365656) [1665 bp, 554 aa] {ON} Anc_8.539
          Length = 554

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 30/66 (45%), Gaps = 2/66 (3%)

Query: 37  LLPRRAPEVPSRQQSNSSKNEEWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGK 96
           L P+R  +  S +QS       +   +Y F  ++  +L    G+ + +    + EWF  K
Sbjct: 139 LNPKRTSQTSSMEQSK--MGSLYAIVLYDFKAEKSDELTAYAGENLFICAHHNYEWFIAK 196

Query: 97  CNGKVG 102
             G++G
Sbjct: 197 PIGRLG 202

>Smik_2.113 Chr2 complement(205503..206218,206252..209228) [3693 bp,
           1230 aa] {ON} YBL007C (REAL)
          Length = 1230

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 33/71 (46%), Gaps = 5/71 (7%)

Query: 60  VEAIYQFDPQQDGDLQLM--PGDKILVTEKPSPEWF--KGKCNGKVGVFPSNYVRPAFSG 115
           V AIY +   Q+ D +L     D   V +    +W   K   + + G  P NYV PA  G
Sbjct: 74  VRAIYDYGQVQNADEELTFHENDTFDVFDDNDADWLLVKSTVSNEFGFIPGNYVEPA-DG 132

Query: 116 SNNEKSRSDAA 126
           S  ++ RS AA
Sbjct: 133 SAPKQERSPAA 143

>NCAS0A05970 Chr1 complement(1177678..1181649) [3972 bp, 1323 aa]
           {ON} Anc_4.45
          Length = 1323

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 24/57 (42%), Gaps = 7/57 (12%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKG-------KCNGKVGVFPSNYV 109
           V  +Y F P     LQL   + + V  KP+  W+ G       +   K G FP  +V
Sbjct: 63  VRVVYDFTPSSSDQLQLRQNEIVYVLNKPNTGWWDGITISESPQQQIKRGWFPQTFV 119

>Kpol_1045.21 s1045 (44318..45394) [1077 bp, 358 aa] {ON}
           (44320..45396) [1077 nt, 359 aa]
          Length = 358

 Score = 30.8 bits (68), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 24/47 (51%)

Query: 64  YQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVR 110
           YQ D     ++    G+ + V++     W   K  G+VG+ PSNYV+
Sbjct: 304 YQADDADGYEVSFEQGEILKVSDIEGRWWKSKKETGEVGIIPSNYVQ 350

>KLTH0A07348g Chr1 (610049..611929) [1881 bp, 626 aa] {ON} similar
           to uniprot|P15891 Saccharomyces cerevisiae YCR088W ABP1
           Actin-binding protein of the cortical actin cytoskeleton
           important for activation of the Arp2/3 complex that
           plays a key role actin in cytoskeleton organization
          Length = 626

 Score = 30.8 bits (68), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 39/70 (55%), Gaps = 9/70 (12%)

Query: 50  QSNSSKNEEWVE-----AIYQFD--PQQDGDLQLMPGDKILVTEKPSPEWFKGKC--NGK 100
           Q N++++E  +E     AI ++D   ++  +L    GDKI+       +W+ G+    G+
Sbjct: 554 QKNAAEDELQLEEKLPSAIAEYDNEAEEHNELAFEEGDKIINISFVDDDWWLGELEKTGE 613

Query: 101 VGVFPSNYVR 110
            G+FPSNYV+
Sbjct: 614 KGLFPSNYVQ 623

>Skud_13.188 Chr13 (322010..324019) [2010 bp, 669 aa] {ON} YMR032W
           (REAL)
          Length = 669

 Score = 30.8 bits (68), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 33/67 (49%), Gaps = 9/67 (13%)

Query: 58  EWVEAIYQFDPQQD-GDLQLMPGDKILVTEKPSPEWFKGKC--------NGKVGVFPSNY 108
           E+ +A+Y     +  G      GD +L+TE  + +W+KG+         + +VG+ P N+
Sbjct: 602 EYAKAMYPLVGNEAPGLANFHKGDYMLITEIVNKDWYKGEVYDNDRIDRDHRVGLIPYNF 661

Query: 109 VRPAFSG 115
           ++    G
Sbjct: 662 IQLLHQG 668

>SAKL0H10098g Chr8 (865874..865882,865987..867645) [1668 bp, 555 aa]
           {ON} similar to uniprot|P29366 Saccharomyces cerevisiae
           YBR200W BEM1 Protein containing SH3-domains involved in
           establishing cell polarity and morphogenesis functions
           as a scaffold protein for complexes that include Cdc24p
           Ste5p Ste20p and Rsr1p
          Length = 555

 Score = 30.8 bits (68), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 41/87 (47%), Gaps = 13/87 (14%)

Query: 54  SKNEEWVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGK--CNGKVGVFPSNY--- 108
           S  E+ ++A+Y +  Q  G+L  + GD   V  +   EW+      +GK G+ P +Y   
Sbjct: 65  SSPEKVIKAMYNYQAQSPGELSFVKGDFFHVLTEDR-EWYDASNPSDGKRGMVPKSYFEI 123

Query: 109 ---VRPAFSGSNNEKSRSDAAPPQYQQ 132
               RP   GS N     D +P Q+QQ
Sbjct: 124 FGRTRP---GSVNGSGSFD-SPLQHQQ 146

>Ecym_7231 Chr7 complement(480473..483913) [3441 bp, 1146 aa] {ON}
           similar to Ashbya gossypii AGR170C
          Length = 1146

 Score = 30.8 bits (68), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 8/60 (13%)

Query: 61  EAIYQFDPQQDGDLQLMPGDKILVTEKPS-PEWFKGK-------CNGKVGVFPSNYVRPA 112
           +AIY ++PQ D +L++   D + V EK    +W+  K           VG+ P+NY+  A
Sbjct: 9   KAIYSYEPQTDEELRIEEDDLLYVLEKSEVDDWWTVKKREIGTDTEELVGLVPNNYIEEA 68

>AGL286C Chr7 complement(174535..175527) [993 bp, 330 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER118C
           (SHO1)
          Length = 330

 Score = 30.4 bits (67), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 22/46 (47%)

Query: 64  YQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYV 109
           Y+ D     ++    G+ + V +     W   K NG+ G+ PSNYV
Sbjct: 276 YEADASDAYEISFQQGEILRVGDIEGRWWKAKKANGETGIIPSNYV 321

>Smik_5.263 Chr5 complement(407025..408131) [1107 bp, 368 aa] {ON}
           YER118C (REAL)
          Length = 368

 Score = 30.4 bits (67), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 61  EAIYQFDPQQDGDLQL-MPGDKILVTEKPSPEWFKGK-CNGKVGVFPSNYVR 110
           +A+Y +D   +   ++    ++IL        W+K +  NG+ G+ PSNYV+
Sbjct: 307 KALYPYDADDEDAYEISFEQNEILQVSDIEGRWWKARRANGETGIIPSNYVQ 358

>CAGL0M05357g Chr13 (572309..573982) [1674 bp, 557 aa] {ON} similar
           to uniprot|P29366 Saccharomyces cerevisiae YBR200w BEM1
           bud emergence mediator
          Length = 557

 Score = 30.8 bits (68), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 19/75 (25%), Positives = 34/75 (45%), Gaps = 8/75 (10%)

Query: 36  DLLPRRAP---EVPSRQQSNSSKNEE-----WVEAIYQFDPQQDGDLQLMPGDKILVTEK 87
           D++ R  P   +   R  S SS+N E     +   +Y F  ++  +L    G+ + +   
Sbjct: 118 DVIDRTRPSSSDALGRSVSTSSRNGEKMGTLYAIVLYDFKAEKSDELDTFVGENLFICAH 177

Query: 88  PSPEWFKGKCNGKVG 102
            + EWF  K  G++G
Sbjct: 178 HNYEWFIAKPIGRLG 192

>Kpol_457.12 s457 complement(23020..24723) [1704 bp, 567 aa] {ON}
           complement(23020..24723) [1704 nt, 568 aa]
          Length = 567

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 26/51 (50%), Gaps = 3/51 (5%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGK---CNGKVGVFPSNYV 109
            +Y F P++  +L+   GDKI +    + EWF       +GK  + P ++V
Sbjct: 169 VLYDFKPERPDELEANAGDKITIYAHHNDEWFIASHTDSSGKPYLIPIDFV 219

>TBLA0D00450 Chr4 (109529..112546) [3018 bp, 1005 aa] {ON} Anc_7.413
           YER114C
          Length = 1005

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 5/54 (9%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPS---PEWFKG--KCNGKVGVFPSNYVR 110
           A+ ++  + D +L +MPGDKI V    S     W+ G      + G++P N+ +
Sbjct: 26  AVAEYQKRMDDELNMMPGDKIQVLNDDSLYNDGWYLGINLTTNEKGLYPLNFTQ 79

>Suva_2.118 Chr2
           complement(206707..206754,206785..206832,206899..207209,
           207250..207279,207310..207393,207427..210403) [3498 bp,
           1166 aa] {ON} YBL007C (REAL)
          Length = 1166

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 48/102 (47%), Gaps = 10/102 (9%)

Query: 30  TYSKIHDLL-----PRRAPEVPSRQQSNSSKNEEWVEAIYQFDPQQDGDLQLMPGDKI-L 83
           T  +I D++       R P +   + +  SK    V+  Y F  +   +L +  GDK+ +
Sbjct: 317 TCEEIMDIIGEYKGASRDPGLKEVEMATKSKKRGVVQ--YDFLAESQDELTIKSGDKVYI 374

Query: 84  VTEKPSPEWFKGKC--NGKVGVFPSNYVRPAFSGSNNEKSRS 123
           + +K S +W+  +   +GK G+ P+ +V P     + E + S
Sbjct: 375 LDDKKSSDWWMCQLIDSGKSGLVPAQFVEPVRDKKHTESTAS 416

 Score = 29.3 bits (64), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 31/74 (41%), Gaps = 14/74 (18%)

Query: 60  VEAIYQFDPQQDGDLQLM--PGDKILVTEKPSPEWF--KGKCNGKVGVFPSNYVRPAFSG 115
           V AIY ++  Q+ D +L     D   V +   P+W   K   + + G  P NYV  A   
Sbjct: 74  VRAIYDYEQVQNADEELTFHENDVFNVLDDKDPDWLLVKSTVSNEFGFIPGNYVEGA--- 130

Query: 116 SNNEKSRSDAAPPQ 129
                   DAAP Q
Sbjct: 131 -------DDAAPKQ 137

>TBLA0C04100 Chr3 (990555..994463) [3909 bp, 1302 aa] {ON} Anc_4.108
           YBL007C
          Length = 1302

 Score = 30.4 bits (67), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 4/60 (6%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKIL--VTEKPSPEWF--KGKCNGKVGVFPSNYVRPAFSG 115
           V+AIY +D  Q+ D +L+  +  +  V +    +W   K +   +VG  P NYV P   G
Sbjct: 74  VKAIYNYDEAQNPDEELLFNENEIFDVFDDRDQDWLLVKSRSANQVGFVPGNYVEPISGG 133

>CAGL0I02750g Chr9 complement(242879..244738) [1860 bp, 619 aa] {ON}
           similar to uniprot|P38822 Saccharomyces cerevisiae
           YHR114w BZZ1
          Length = 619

 Score = 30.4 bits (67), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 32/67 (47%), Gaps = 9/67 (13%)

Query: 46  PSRQQSNSSKNEEWVEAIYQFDPQQDGDLQLMPGDKI-LVTEKPSPEWFK--GKCNGKVG 102
           P+R+QSN ++       +Y +  Q   ++ +  GD   ++T      W K      GK G
Sbjct: 478 PTREQSNKNR------VLYAYAEQDTDEVSVSVGDSFTVITADDGSGWTKITNTTTGKSG 531

Query: 103 VFPSNYV 109
           + PS+Y+
Sbjct: 532 LVPSSYI 538

>TDEL0B03070 Chr2 (547902..547910,547979..549595) [1626 bp, 541 aa]
           {ON} Anc_8.539 YBR200W
          Length = 541

 Score = 30.4 bits (67), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 23/101 (22%), Positives = 42/101 (41%), Gaps = 10/101 (9%)

Query: 12  TIDTELDFLLKSN-------AIDKKTYSKIHDLLPR-RAPEVPSRQQSN--SSKNEEWVE 61
            ++ E D+ L SN        + K  +  I    P  R   + SR+ S+  S     +  
Sbjct: 95  VVNEEKDWFLASNPSSGKQGMVPKSYFEVIDKTRPHSRNGSIVSRRSSHDQSKMGTLYAI 154

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVG 102
            +Y F  ++  +L    G+ + +    + EWF  K  G++G
Sbjct: 155 VLYDFQAEKSDELTAYAGENLFICAHHNYEWFIAKPIGRLG 195

>KNAG0C03390 Chr3 (667055..668083) [1029 bp, 342 aa] {ON} Anc_7.419
           YER118C
          Length = 342

 Score = 30.0 bits (66), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 14/51 (27%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 61  EAIYQFDPQQDG--DLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYV 109
           +A+Y +D   +   ++    G+ + V++     W   + NG+ G+ PSNYV
Sbjct: 287 KALYSYDADSNDQYEVSFEQGEILKVSDIEGRWWKARRANGETGIIPSNYV 337

>KLLA0F14575g Chr6 complement(1351796..1354351) [2556 bp, 851 aa]
           {ON} some similarities with uniprot|P47068 Saccharomyces
           cerevisiae YJL020C/YJL021C BBC1 Protein possibly
           involved in assembly of actin patches
          Length = 851

 Score = 30.4 bits (67), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 5/55 (9%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGK---CNGKV--GVFPSNYV 109
           VEA++ +    + DL    G  I V E    EWF G+    +GK   G+FP  +V
Sbjct: 7   VEALFPYTSDFEDDLPFSKGQIITVLEIEDDEWFFGEFKDADGKTKQGIFPKGFV 61

>KLLA0D09306g Chr4 (783852..788465) [4614 bp, 1537 aa] {ON} similar
           to uniprot|P04821 Saccharomyces cerevisiae YLR310C CDC25
           Membrane bound guanine nucleotide exchange factor (GEF
           or GDP-release factor) indirectly regulates adenylate
           cyclase through activation of Ras1p and Ras2p by
           stimulating the exchange of GDP for GTP required for
           progression through G1
          Length = 1537

 Score = 30.4 bits (67), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 28/66 (42%), Gaps = 5/66 (7%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKG-----KCNGKVGVFPSNYVRPAFS 114
           V A Y F+P +   L+   GD I V  K    W+ G     K     G FP +Y +    
Sbjct: 26  VIAQYDFNPLRKSQLRFFAGDIIYVISKSDSGWWDGILYYNKSLVLRGWFPRSYTKSIKD 85

Query: 115 GSNNEK 120
            S++ K
Sbjct: 86  TSSSRK 91

>KLTH0F09240g Chr6 (799558..802224) [2667 bp, 888 aa] {ON} similar
           to uniprot|Q07533 Saccharomyces cerevisiae YDL117W CYK3
           SH3-domain protein located in the mother-bud neck and
           the cytokinetic actin ring mutant phenotype and genetic
           interactions suggest a role in cytokinesis
          Length = 888

 Score = 30.4 bits (67), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 35/73 (47%), Gaps = 4/73 (5%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKG---KCNGKVGVFPSNYVRPAFSGS 116
           V+A Y +  +   DL  +  D I VT K    WF G   + + K G FP+N+V       
Sbjct: 12  VKAHYSWSGETKNDLGFLENDVIQVT-KIKGNWFYGTLLRNSKKYGYFPTNFVTIIQEKY 70

Query: 117 NNEKSRSDAAPPQ 129
           N+ K   +++ P+
Sbjct: 71  NDFKQDGESSEPR 83

>NDAI0A01470 Chr1 (326531..327634) [1104 bp, 367 aa] {ON} Anc_7.419
           YER118C
          Length = 367

 Score = 30.0 bits (66), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 4/53 (7%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDK--ILVTEKPSPEWFKGKC-NGKVGVFPSNYV 109
           V+A+Y +    D D   +  D+  IL        W+K K  NG+ G+ PSNYV
Sbjct: 311 VKALYSYQAD-DADAYEISFDQGEILKVSDIEGRWWKAKRENGQTGIIPSNYV 362

>CAGL0G03597g Chr7 complement(348369..349430) [1062 bp, 353 aa] {ON}
           similar to uniprot|P40073 Saccharomyces cerevisiae
           YER118c SSU81
          Length = 353

 Score = 30.0 bits (66), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 60  VEAIYQF--DPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYV 109
           V+A+Y +  D     ++    G+ ++V++     W   K +G+ G+ PSNYV
Sbjct: 293 VKALYSYEADSADAYEMSFEQGEILMVSDIEGRWWKAKKESGETGIIPSNYV 344

>Kwal_23.6437 s23 (1581839..1583734) [1896 bp, 631 aa] {ON} YCR088W
           (ABP1) - 1:1 [contig 17] FULL
          Length = 631

 Score = 29.6 bits (65), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 4/60 (6%)

Query: 55  KNEEWVEAIYQFD--PQQDGDLQLMPGDKILVTEKPSPEWFKGKC--NGKVGVFPSNYVR 110
           + E+   AI ++D   ++  +L    GDKI+       +W+ G+    G+ G+FPSNYV+
Sbjct: 569 QGEQLHSAIAEYDNEAEEHNELAFKEGDKIVNIVFVDDDWWLGELEKTGEKGLFPSNYVQ 628

>KLTH0E07744g Chr5 complement(710793..714542) [3750 bp, 1249 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1249

 Score = 29.6 bits (65), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 32/60 (53%), Gaps = 8/60 (13%)

Query: 61  EAIYQFDPQQDGDLQLMPGDKILVTEKPS-PEWFKGK-------CNGKVGVFPSNYVRPA 112
           +A++Q++PQ D +L +  GD + + +K    +W+  K           VG+ P+NY+  A
Sbjct: 9   KAVFQYEPQSDEELAIDEGDMLYLLQKSDVDDWWTVKKRVIGSDAEEPVGLVPNNYIEEA 68

>Ecym_4226 Chr4 (472701..474929) [2229 bp, 742 aa] {ON} similar to
           Ashbya gossypii AGL167C
          Length = 742

 Score = 29.6 bits (65), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 14/70 (20%), Positives = 31/70 (44%)

Query: 65  QFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFSGSNNEKSRSD 124
           +  P+ D  L L P    ++ ++  P +FK     ++ +     + P+FS   +   ++ 
Sbjct: 80  KLQPENDHFLVLDPQQTGILKKRSIPTYFKQNQQKRLSILQGMEINPSFSAKGSNAKKNS 139

Query: 125 AAPPQYQQDD 134
           A   ++  DD
Sbjct: 140 ATAKKFSSDD 149

>NCAS0A03490 Chr1 complement(689871..693578) [3708 bp, 1235 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1235

 Score = 29.6 bits (65), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 34/64 (53%), Gaps = 10/64 (15%)

Query: 61  EAIYQFDPQQDGDLQLMPGDKILVTEKPS-PEWF--KGKCNGK-----VGVFPSNYVR-- 110
           +AIY ++PQ   +L++   D + + EK    EW+  K +  G      VG+ PSNY+   
Sbjct: 9   KAIYDYEPQTPEELEIHEDDLLYLLEKSEVDEWWTVKKRVIGSDVVEPVGLVPSNYIEEA 68

Query: 111 PAFS 114
           PA S
Sbjct: 69  PAIS 72

>KNAG0B05000 Chr2 (955989..958556) [2568 bp, 855 aa] {ON} Anc_5.170
           YJL020C
          Length = 855

 Score = 29.6 bits (65), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 5/53 (9%)

Query: 62  AIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKC---NGKV--GVFPSNYV 109
           A + ++ + + DL    G KI VT     EW+ G+     G V  G+FP ++V
Sbjct: 12  AQFAYESEFEDDLNFKAGQKITVTAIEDDEWYAGEYEADGGTVASGIFPKSFV 64

>NDAI0A03330 Chr1 complement(756761..760441) [3681 bp, 1226 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1226

 Score = 29.6 bits (65), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 60  VEAIYQFDPQQDGDLQLM--PGDKILVTEKPSPEWF--KGKCNGKVGVFPSNYVRPA 112
           V+A+Y ++  Q+ + +L+    D   V +   P+W   K + + +VG  P NYV+P 
Sbjct: 74  VKALYDYEQIQNPEEELIFHENDLFSVYDDKDPDWLLVKSQISNEVGFVPGNYVQPV 130

 Score = 29.6 bits (65), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 30/60 (50%), Gaps = 8/60 (13%)

Query: 61  EAIYQFDPQQDGDLQLMPGDKILVTEKPS-PEWFKGK-------CNGKVGVFPSNYVRPA 112
           +AIY ++PQ   +L+L   D + + EK    +W+  K           VG+ PSNY+  A
Sbjct: 9   KAIYDYEPQTPEELELKENDLLYLLEKSEVDDWWTVKKRVIGSDAEEPVGLVPSNYIEEA 68

>CAGL0E02783g Chr5 (261665..265276) [3612 bp, 1203 aa] {ON} similar
           to uniprot|P32790 Saccharomyces cerevisiae YBL007c SLA1
          Length = 1203

 Score = 29.6 bits (65), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 37/65 (56%), Gaps = 3/65 (4%)

Query: 48  RQQSNSSKNEEWVEAIYQFDPQQDGDLQLMPGDKI-LVTEKPSPEWFKGKC--NGKVGVF 104
           R+   ++K+ +   A+Y F+ +   +L +  GD + ++ +K S +W+  +   NGK G+ 
Sbjct: 363 REVEMATKSSKRGVALYDFEAESPDELTIRQGDAVYVINDKKSKDWWMVELISNGKKGLV 422

Query: 105 PSNYV 109
           P+ ++
Sbjct: 423 PAQFI 427

>Skud_5.261 Chr5 (422454..423572) [1119 bp, 372 aa] {ON} YER118C
           (REAL)
          Length = 372

 Score = 29.3 bits (64), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 1/32 (3%)

Query: 80  DKILVTEKPSPEWFKG-KCNGKVGVFPSNYVR 110
           ++IL        W+K  K NG+ G+ PSNYV+
Sbjct: 331 NEILQVSDIEGRWWKARKANGETGIIPSNYVQ 362

>SAKL0E00946g Chr5 (72220..73701) [1482 bp, 493 aa] {ON} highly
           similar to uniprot|P08417 Saccharomyces cerevisiae
           YPL262W FUM1 Fumarase converts fumaric acid to L-malic
           acid in the TCA cycle cytosolic and mitochondrial
           localization determined by the N-terminal mitochondrial
           targeting sequence and protein conformation
          Length = 493

 Score = 29.3 bits (64), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 38/79 (48%), Gaps = 1/79 (1%)

Query: 2   SSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLLPRRAPEVPSRQQSNSSKNEEWVE 61
           S++++N+SL T+D E+   ++  A D+    K+ D  P    +  S  QSN + NE    
Sbjct: 84  SAAIVNESLGTLDPEISKPIQ-KAADEVIQGKLMDHFPLVVFQTGSGTQSNMNANEVISN 142

Query: 62  AIYQFDPQQDGDLQLMPGD 80
              +    + G  Q+ P +
Sbjct: 143 RAIEIIGGEKGSKQVHPNN 161

>TPHA0L01660 Chr12 complement(348715..350358) [1644 bp, 547 aa] {ON}
           Anc_8.539 YBR200W
          Length = 547

 Score = 29.3 bits (64), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 33/69 (47%), Gaps = 6/69 (8%)

Query: 47  SRQQSNSSKNEE---WVEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKV-- 101
           SRQQSN    +    +   +Y F  ++  +L    G+ + +    + EWF  K  G++  
Sbjct: 135 SRQQSNEISTQPSSLYGIVLYDFQAEKADELTAYVGENLFICAHHNYEWFIAKPIGRLGG 194

Query: 102 -GVFPSNYV 109
            G+ P ++V
Sbjct: 195 PGLVPIDFV 203

>Ecym_7134 Chr7 (266402..267400) [999 bp, 332 aa] {ON} similar to
           Ashbya gossypii AGL286C
          Length = 332

 Score = 28.9 bits (63), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 22/46 (47%)

Query: 64  YQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYV 109
           Y+ D     ++    G+ + V +     W   + NG+ G+ PSNYV
Sbjct: 278 YEADESDAYEISFQQGEILRVGDIEGRWWKAKRSNGETGIIPSNYV 323

>Skud_10.200 Chr10 complement(366708..370013) [3306 bp, 1101 aa]
           {ON} YJL020C (REAL)
          Length = 1101

 Score = 29.3 bits (64), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 37/76 (48%), Gaps = 6/76 (7%)

Query: 60  VEAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGK---CNGKV--GVFPSNYVRPAFS 114
           V A + +    + DL      +I +T     EW+ G+    +G +  G+FP ++V    S
Sbjct: 10  VVAQFPYKSDYEDDLNFEKDQEITITSVEDAEWYYGEYRDSSGDIVEGIFPKSFVAIQTS 69

Query: 115 GSNNE-KSRSDAAPPQ 129
           GS  E +S + AAP Q
Sbjct: 70  GSLKESESAATAAPTQ 85

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.130    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,099,050
Number of extensions: 801382
Number of successful extensions: 2324
Number of sequences better than 10.0: 256
Number of HSP's gapped: 2222
Number of HSP's successfully gapped: 298
Length of query: 222
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 117
Effective length of database: 41,441,469
Effective search space: 4848651873
Effective search space used: 4848651873
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 63 (28.9 bits)