Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0C045203.500ON1401407301e-100
YPR153W3.500ON1401404904e-64
Smik_16.4053.500ON1391394801e-62
Suva_16.4813.500ON1391344792e-62
NCAS0F035903.500ON1401334783e-62
Skud_16.4473.500ON1401354723e-61
TPHA0A057103.500ON1411334542e-58
Kpol_480.93.500ON1411394532e-58
CAGL0L08382g3.500ON1401354393e-56
SAKL0F02508g3.500ON1401384351e-55
TDEL0D056803.500ON1401404314e-55
KNAG0A079803.500ON1471334263e-54
KLTH0G02354g3.500ON1401383969e-50
ZYRO0D09724g3.500ON1391283863e-48
KLLA0E03895g3.500ON1401373752e-46
KAFR0G037303.500ON1441283362e-40
AFR319W3.500ON1411232804e-32
Kwal_47.189033.500ON11344941e-04
TBLA0C031805.298ON166858710.43
KLTH0D00308gsingletonON25242643.5
SAKL0G04180g5.502ON54068618.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0C04520
         (140 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0C04520 Chr3 (1096418..1096840) [423 bp, 140 aa] {ON} Anc_3....   285   e-100
YPR153W Chr16 (833689..833693,833828..834245) [423 bp, 140 aa] {...   193   4e-64
Smik_16.405 Chr16 (705749..706165) [417 bp, 139 aa] {ON} YPR153W...   189   1e-62
Suva_16.481 Chr16 (830176..830592) [417 bp, 139 aa] {ON} YPR153W...   189   2e-62
NCAS0F03590 Chr6 (713500..713922) [423 bp, 140 aa] {ON} Anc_3.50...   188   3e-62
Skud_16.447 Chr16 (787264..787268,787400..787817) [423 bp, 140 a...   186   3e-61
TPHA0A05710 Chr1 (1292410..1292835) [426 bp, 141 aa] {ON} Anc_3....   179   2e-58
Kpol_480.9 s480 complement(19229..19649,19756..19760) [426 bp, 1...   179   2e-58
CAGL0L08382g Chr12 complement(924096..924518) [423 bp, 140 aa] {...   173   3e-56
SAKL0F02508g Chr6 complement(217712..217835,217912..218205,21827...   172   1e-55
TDEL0D05680 Chr4 (1021413..1021417,1021479..1021896) [423 bp, 14...   170   4e-55
KNAG0A07980 Chr1 (1272179..1272204,1272292..1272709) [444 bp, 14...   168   3e-54
KLTH0G02354g Chr7 complement(185220..185343,185400..185693,18576...   157   9e-50
ZYRO0D09724g Chr4 complement(825339..825758) [420 bp, 139 aa] {O...   153   3e-48
KLLA0E03895g Chr5 complement(355734..356151,356230..356234) [423...   149   2e-46
KAFR0G03730 Chr7 (766728..766738,766802..767225) [435 bp, 144 aa...   134   2e-40
AFR319W Chr6 (1013960..1014261,1014335..1014458) [426 bp, 141 aa...   112   4e-32
Kwal_47.18903 s47 (1020956..1021297) [342 bp, 113 aa] {ON} YPR15...    41   1e-04
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    32   0.43 
KLTH0D00308g Chr4 complement(28125..28883) [759 bp, 252 aa] {ON}...    29   3.5  
SAKL0G04180g Chr7 (343513..345135) [1623 bp, 540 aa] {ON} simila...    28   8.2  

>TBLA0C04520 Chr3 (1096418..1096840) [423 bp, 140 aa] {ON} Anc_3.500
           YPR153W
          Length = 140

 Score =  285 bits (730), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 140/140 (100%), Positives = 140/140 (100%)

Query: 1   MKSFITNNDIPVGYVTPPFPSLYWPINNQKYNTSFLYDTTDIWKFSIYWCVILNECFYGV 60
           MKSFITNNDIPVGYVTPPFPSLYWPINNQKYNTSFLYDTTDIWKFSIYWCVILNECFYGV
Sbjct: 1   MKSFITNNDIPVGYVTPPFPSLYWPINNQKYNTSFLYDTTDIWKFSIYWCVILNECFYGV 60

Query: 61  TGTIAGVSHRGKIGCIWIIFIYLFCGAVQGMVAGTIMGYMISAIYTSGLFEMSTWIPFCC 120
           TGTIAGVSHRGKIGCIWIIFIYLFCGAVQGMVAGTIMGYMISAIYTSGLFEMSTWIPFCC
Sbjct: 61  TGTIAGVSHRGKIGCIWIIFIYLFCGAVQGMVAGTIMGYMISAIYTSGLFEMSTWIPFCC 120

Query: 121 AVVQILFDVVQSFPISNLTM 140
           AVVQILFDVVQSFPISNLTM
Sbjct: 121 AVVQILFDVVQSFPISNLTM 140

>YPR153W Chr16 (833689..833693,833828..834245) [423 bp, 140 aa] {ON}
           Putative protein of unknown function
          Length = 140

 Score =  193 bits (490), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 88/140 (62%), Positives = 106/140 (75%)

Query: 1   MKSFITNNDIPVGYVTPPFPSLYWPINNQKYNTSFLYDTTDIWKFSIYWCVILNECFYGV 60
           M+SF+TNNDIPVGYVTP FPSLYWPINN KYNT+FLY  +DIWKFS+YW +I N  FY  
Sbjct: 1   MRSFVTNNDIPVGYVTPKFPSLYWPINNSKYNTAFLYYISDIWKFSLYWTLIFNGAFYVT 60

Query: 61  TGTIAGVSHRGKIGCIWIIFIYLFCGAVQGMVAGTIMGYMISAIYTSGLFEMSTWIPFCC 120
            G  A ++HR K G +WI  +Y+  G VQG+  GT+MG++I AIY SGLF MSTW+P CC
Sbjct: 61  AGVYASLTHRKKAGSVWIFVMYVLYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWVPLCC 120

Query: 121 AVVQILFDVVQSFPISNLTM 140
           AVVQILFDVV S+ +    M
Sbjct: 121 AVVQILFDVVLSYSMVGSVM 140

>Smik_16.405 Chr16 (705749..706165) [417 bp, 139 aa] {ON} YPR153W
           (REAL)
          Length = 139

 Score =  189 bits (480), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 106/139 (76%)

Query: 2   KSFITNNDIPVGYVTPPFPSLYWPINNQKYNTSFLYDTTDIWKFSIYWCVILNECFYGVT 61
           +SF+TNNDIPVGYVTP FPSLYWPINN +YNT+FLY  +DIWKFS+YW +I N  FY VT
Sbjct: 1   RSFVTNNDIPVGYVTPKFPSLYWPINNPRYNTAFLYYISDIWKFSLYWTLIFNGAFYIVT 60

Query: 62  GTIAGVSHRGKIGCIWIIFIYLFCGAVQGMVAGTIMGYMISAIYTSGLFEMSTWIPFCCA 121
           G  A ++HR K G +WI  +Y+  G VQG+  GT+MG++I AIY SGLF MSTWIP CCA
Sbjct: 61  GLYASLTHRKKAGSLWIFSMYVIYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWIPLCCA 120

Query: 122 VVQILFDVVQSFPISNLTM 140
           VVQILFDVV  + +    M
Sbjct: 121 VVQILFDVVLGYSMVGSVM 139

>Suva_16.481 Chr16 (830176..830592) [417 bp, 139 aa] {ON} YPR153W
           (REAL)
          Length = 139

 Score =  189 bits (479), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 87/134 (64%), Positives = 104/134 (77%)

Query: 2   KSFITNNDIPVGYVTPPFPSLYWPINNQKYNTSFLYDTTDIWKFSIYWCVILNECFYGVT 61
           +SFITNNDIPVGY+TP FPSLYWPIN+ +YNT+FLY  +DIWKFS+YW +I N  FY   
Sbjct: 1   RSFITNNDIPVGYITPKFPSLYWPINSSRYNTAFLYYISDIWKFSLYWTLIFNGAFYVAA 60

Query: 62  GTIAGVSHRGKIGCIWIIFIYLFCGAVQGMVAGTIMGYMISAIYTSGLFEMSTWIPFCCA 121
           G  A ++HR K G IWI  +Y+  G VQG+ AGTIMG++I AIY SGLF MSTWIP CCA
Sbjct: 61  GLYASLTHRKKAGSIWIFVMYVAFGGVQGLTAGTIMGFLIGAIYRSGLFSMSTWIPLCCA 120

Query: 122 VVQILFDVVQSFPI 135
           VVQILFDVV  + +
Sbjct: 121 VVQILFDVVLGYSM 134

>NCAS0F03590 Chr6 (713500..713922) [423 bp, 140 aa] {ON} Anc_3.500
           YPR153W
          Length = 140

 Score =  188 bits (478), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 104/133 (78%)

Query: 1   MKSFITNNDIPVGYVTPPFPSLYWPINNQKYNTSFLYDTTDIWKFSIYWCVILNECFYGV 60
           M+SFITNNDIP+GY+TP FPSLYWPINN+KY+ +FLY+ +DIWKF++YW +I N  FYG 
Sbjct: 1   MRSFITNNDIPIGYITPKFPSLYWPINNKKYDITFLYNISDIWKFTLYWTLIFNAAFYGA 60

Query: 61  TGTIAGVSHRGKIGCIWIIFIYLFCGAVQGMVAGTIMGYMISAIYTSGLFEMSTWIPFCC 120
            G +A  SHR   G IWI+ IYL    VQG+  GTIMG++I AIY +GLF MSTWIP CC
Sbjct: 61  AGLLASFSHRRTGGGIWIMVIYLTFAGVQGLAMGTIMGFLIGAIYGAGLFAMSTWIPLCC 120

Query: 121 AVVQILFDVVQSF 133
           AV QILFDV+ ++
Sbjct: 121 AVAQILFDVIMAY 133

>Skud_16.447 Chr16 (787264..787268,787400..787817) [423 bp, 140 aa]
           {ON} YPR153W (REAL)
          Length = 140

 Score =  186 bits (472), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 85/135 (62%), Positives = 104/135 (77%)

Query: 1   MKSFITNNDIPVGYVTPPFPSLYWPINNQKYNTSFLYDTTDIWKFSIYWCVILNECFYGV 60
           M+SF+TNNDIPVGYVTP FPSLYWPIN+ +YN +FLY  +DIWKFS+YW +I N  FY  
Sbjct: 1   MRSFVTNNDIPVGYVTPKFPSLYWPINSSRYNIAFLYYISDIWKFSLYWTLIFNGAFYVT 60

Query: 61  TGTIAGVSHRGKIGCIWIIFIYLFCGAVQGMVAGTIMGYMISAIYTSGLFEMSTWIPFCC 120
           TG  A ++HR K G IWI  +Y+  G VQG+  GT+MG++I AIY SGLF MSTWIP CC
Sbjct: 61  TGLYASLTHRKKGGSIWIFVMYVIYGGVQGLTTGTVMGFLIGAIYRSGLFSMSTWIPLCC 120

Query: 121 AVVQILFDVVQSFPI 135
           AVVQILFDV+  + +
Sbjct: 121 AVVQILFDVILGYSM 135

>TPHA0A05710 Chr1 (1292410..1292835) [426 bp, 141 aa] {ON} Anc_3.500
           YPR153W
          Length = 141

 Score =  179 bits (454), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 103/133 (77%)

Query: 3   SFITNNDIPVGYVTPPFPSLYWPINNQKYNTSFLYDTTDIWKFSIYWCVILNECFYGVTG 62
           +F+T+ND+PVGYVTP FPSLYWPINN KYNT++LYD+  IW F++YW +ILN  FYGV G
Sbjct: 4   NFLTSNDMPVGYVTPSFPSLYWPINNSKYNTAYLYDSYTIWLFTVYWSLILNGFFYGVAG 63

Query: 63  TIAGVSHRGKIGCIWIIFIYLFCGAVQGMVAGTIMGYMISAIYTSGLFEMSTWIPFCCAV 122
            +A  +HR K G  WI+ IYL  G VQG+V GTI+GY+ISA Y S LF MSTWIP CCAV
Sbjct: 64  ALACFTHRKKGGGFWILAIYLVLGGVQGIVLGTIIGYIISATYLSALFSMSTWIPLCCAV 123

Query: 123 VQILFDVVQSFPI 135
            Q+LF+V  S+ +
Sbjct: 124 AQVLFEVTTSYSL 136

>Kpol_480.9 s480 complement(19229..19649,19756..19760) [426 bp, 141
           aa] {ON} complement(19229..19649,19756..19760) [426 nt,
           142 aa]
          Length = 141

 Score =  179 bits (453), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 79/139 (56%), Positives = 105/139 (75%)

Query: 2   KSFITNNDIPVGYVTPPFPSLYWPINNQKYNTSFLYDTTDIWKFSIYWCVILNECFYGVT 61
            SF+T+ DIPVGY  PPFPSLYWPI+++KY+ S+LYDT  IW+F++YW VILN  FY ++
Sbjct: 3   SSFLTSEDIPVGYHKPPFPSLYWPISSKKYHVSYLYDTKTIWEFTVYWSVILNGGFYLIS 62

Query: 62  GTIAGVSHRGKIGCIWIIFIYLFCGAVQGMVAGTIMGYMISAIYTSGLFEMSTWIPFCCA 121
           G +A  +HR + G +WI+ IYLF G  QG+V GT+ GY++S IY SGLF MSTWIP CCA
Sbjct: 63  GLMASYTHRKRAGGLWIMVIYLFIGCAQGVVFGTVTGYLVSQIYISGLFAMSTWIPLCCA 122

Query: 122 VVQILFDVVQSFPISNLTM 140
           + Q+LFD+  SF +  + M
Sbjct: 123 ITQVLFDLCSSFSLGGMVM 141

>CAGL0L08382g Chr12 complement(924096..924518) [423 bp, 140 aa] {ON}
           highly similar to uniprot|Q06537 Saccharomyces
           cerevisiae YPR153w
          Length = 140

 Score =  173 bits (439), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 78/135 (57%), Positives = 100/135 (74%)

Query: 1   MKSFITNNDIPVGYVTPPFPSLYWPINNQKYNTSFLYDTTDIWKFSIYWCVILNECFYGV 60
           MKSFIT+ D+P+GY TP FPSLYWPIN+++Y+T+FLY   DIWKF++YW  I N  FYG 
Sbjct: 1   MKSFITSTDVPIGYKTPSFPSLYWPINDRRYDTAFLYFIEDIWKFTLYWTFIFNGAFYGG 60

Query: 61  TGTIAGVSHRGKIGCIWIIFIYLFCGAVQGMVAGTIMGYMISAIYTSGLFEMSTWIPFCC 120
            G  A ++H  + G +WI  IY+    VQGM+ GT+MG++I AIY SGLF MSTW+P CC
Sbjct: 61  AGLYASLTHWKRGGGLWIFGIYMLYAGVQGMIIGTVMGFLIGAIYRSGLFSMSTWVPMCC 120

Query: 121 AVVQILFDVVQSFPI 135
           AVVQIL DV  S+ +
Sbjct: 121 AVVQILLDVTMSYSM 135

>SAKL0F02508g Chr6
           complement(217712..217835,217912..218205,218273..218277)
           [423 bp, 140 aa] {ON} similar to uniprot|Q06HN0
           Saccharomyces cerevisiae YPR153W Hypothetical ORF
          Length = 140

 Score =  172 bits (435), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 74/138 (53%), Positives = 104/138 (75%)

Query: 1   MKSFITNNDIPVGYVTPPFPSLYWPINNQKYNTSFLYDTTDIWKFSIYWCVILNECFYGV 60
           MKSF+T  D+P+GYVTP FPSLYWP+NN+K++ S+LY T+DIW+F++YW +IL   FYG 
Sbjct: 1   MKSFVTTGDVPLGYVTPSFPSLYWPLNNEKFSLSYLYYTSDIWRFTVYWTLILFAGFYGS 60

Query: 61  TGTIAGVSHRGKIGCIWIIFIYLFCGAVQGMVAGTIMGYMISAIYTSGLFEMSTWIPFCC 120
            G IA  SHR   G IWI+F YL  G +Q + +GT++G +I+ IY +GLF MSTW+P  C
Sbjct: 61  AGLIASYSHRKTAGGIWIMFFYLVAGGIQAIASGTVVGLLIAVIYKAGLFAMSTWVPLSC 120

Query: 121 AVVQILFDVVQSFPISNL 138
           A++QILF+V  S+ ++ +
Sbjct: 121 ALMQILFNVSTSYLMAGV 138

>TDEL0D05680 Chr4 (1021413..1021417,1021479..1021896) [423 bp, 140
           aa] {ON} Anc_3.500 YPR153W
          Length = 140

 Score =  170 bits (431), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 103/140 (73%)

Query: 1   MKSFITNNDIPVGYVTPPFPSLYWPINNQKYNTSFLYDTTDIWKFSIYWCVILNECFYGV 60
           M+SFITNND+P+GYVTP FPSL+WPI+N K++ + LYD   IWKF++YW +I N  FYG+
Sbjct: 1   MRSFITNNDVPIGYVTPSFPSLHWPISNGKFSLAVLYDVVVIWKFTLYWSLIFNGAFYGI 60

Query: 61  TGTIAGVSHRGKIGCIWIIFIYLFCGAVQGMVAGTIMGYMISAIYTSGLFEMSTWIPFCC 120
            G  A  SHR + G +WI+ IYL  G +Q + AGT++G++I +IY++GLF MSTWIP CC
Sbjct: 61  AGLWASYSHRRRAGGLWIMAIYLVYGGIQAVAAGTVIGFLIGSIYSAGLFSMSTWIPPCC 120

Query: 121 AVVQILFDVVQSFPISNLTM 140
            +VQILFD   S+  S   M
Sbjct: 121 VIVQILFDFSVSYLSSGTIM 140

>KNAG0A07980 Chr1 (1272179..1272204,1272292..1272709) [444 bp, 147
           aa] {ON} Anc_3.500 YPR153W
          Length = 147

 Score =  168 bits (426), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 99/133 (74%)

Query: 1   MKSFITNNDIPVGYVTPPFPSLYWPINNQKYNTSFLYDTTDIWKFSIYWCVILNECFYGV 60
           +++F+ NN+IPVGY TP FPSLYWPI+N+ Y+ +FLY+  DIWKF++YWC+ILN  FYG 
Sbjct: 8   LRTFVANNEIPVGYHTPSFPSLYWPISNESYSLAFLYNIEDIWKFTMYWCLILNGAFYGT 67

Query: 61  TGTIAGVSHRGKIGCIWIIFIYLFCGAVQGMVAGTIMGYMISAIYTSGLFEMSTWIPFCC 120
           +G +A +SH      I I+ +YL    +QG+V G I G ++ AIY +GLF MSTWIP CC
Sbjct: 68  SGLVATISHWKNPHAILIVGLYLLYAGIQGVVIGIIAGLLLGAIYRAGLFTMSTWIPLCC 127

Query: 121 AVVQILFDVVQSF 133
           AV QILFDVV S+
Sbjct: 128 AVAQILFDVVMSY 140

>KLTH0G02354g Chr7
           complement(185220..185343,185400..185693,185765..185769)
           [423 bp, 140 aa] {ON} similar to uniprot|Q06HN0
           Saccharomyces cerevisiae YPR153W Hypothetical ORF
          Length = 140

 Score =  157 bits (396), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 95/138 (68%)

Query: 1   MKSFITNNDIPVGYVTPPFPSLYWPINNQKYNTSFLYDTTDIWKFSIYWCVILNECFYGV 60
           MKSF+T  D+P+GY TP FPSL+WPINN++Y  S+LY T DIWKF+++W +IL   FY  
Sbjct: 1   MKSFVTIGDVPIGYTTPKFPSLFWPINNKRYTLSYLYYTNDIWKFTVFWTLILFMGFYTA 60

Query: 61  TGTIAGVSHRGKIGCIWIIFIYLFCGAVQGMVAGTIMGYMISAIYTSGLFEMSTWIPFCC 120
            G  A +SHR K   +WI+  Y+  G  Q + AGT+ G +++  Y +GLFEMSTWIP C 
Sbjct: 61  AGLWASISHRKKASGLWIMAFYILVGGFQALAAGTVTGLILAVTYKAGLFEMSTWIPLCS 120

Query: 121 AVVQILFDVVQSFPISNL 138
           AVV ILF V  ++ ++ +
Sbjct: 121 AVVLILFHVSTTYSMAGI 138

>ZYRO0D09724g Chr4 complement(825339..825758) [420 bp, 139 aa] {ON}
           similar to uniprot|Q06HN0 Saccharomyces cerevisiae
           YPR153W Hypothetical ORF
          Length = 139

 Score =  153 bits (386), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 92/128 (71%), Gaps = 1/128 (0%)

Query: 1   MKSFITNNDIPVGYVTPPFPSLYWPINNQKYNTSFLYDTTDIWKFSIYWCVILNECFYGV 60
           M+SFIT ND+PVGY TP FPSLYWP  ++  +   +YD + IWKF++YW +I N  FY +
Sbjct: 1   MRSFITTNDVPVGYETPSFPSLYWPTESRT-SLHVIYDVSAIWKFTLYWSLIFNFGFYAL 59

Query: 61  TGTIAGVSHRGKIGCIWIIFIYLFCGAVQGMVAGTIMGYMISAIYTSGLFEMSTWIPFCC 120
           TG  A  SHR + G +WI+ +Y   G VQG+  GTI G++I  IY+SGLF MSTWIPFCC
Sbjct: 60  TGLWASFSHRKQAGGLWIMALYCTYGGVQGVAVGTITGFLIGNIYSSGLFSMSTWIPFCC 119

Query: 121 AVVQILFD 128
           AV Q+L+D
Sbjct: 120 AVAQVLYD 127

>KLLA0E03895g Chr5 complement(355734..356151,356230..356234) [423
           bp, 140 aa] {ON} similar to uniprot|Q06HN0 Saccharomyces
           cerevisiae YPR153W Hypothetical ORF
          Length = 140

 Score =  149 bits (375), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 68/137 (49%), Positives = 96/137 (70%)

Query: 1   MKSFITNNDIPVGYVTPPFPSLYWPINNQKYNTSFLYDTTDIWKFSIYWCVILNECFYGV 60
           MK+F    D+PVGY  P FPSLYWP+NN K++ ++LY   DIW+F+I+W +IL    YG 
Sbjct: 1   MKTFFITGDVPVGYQVPDFPSLYWPMNNGKFSVAYLYYLPDIWRFTIFWTMILFAIVYGT 60

Query: 61  TGTIAGVSHRGKIGCIWIIFIYLFCGAVQGMVAGTIMGYMISAIYTSGLFEMSTWIPFCC 120
           TG IA  +H+  +   W+I +Y+  G  Q  V+GT++G +I+ IY +GLF MSTWIP CC
Sbjct: 61  TGAIAWTTHKKILFGFWMIPLYIMIGMAQAFVSGTVVGILIAIIYKAGLFAMSTWIPLCC 120

Query: 121 AVVQILFDVVQSFPISN 137
           AVVQILF+V  S+ +++
Sbjct: 121 AVVQILFNVSTSYSMTS 137

>KAFR0G03730 Chr7 (766728..766738,766802..767225) [435 bp, 144 aa]
           {ON} Anc_3.500 YPR153W Intron coordinates are guessed,
           not conserved begining when aligned with the rest of the
           pillar proteins.
          Length = 144

 Score =  134 bits (336), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 86/128 (67%), Gaps = 1/128 (0%)

Query: 7   NNDIPVGYVTPPFPSLYWPIN-NQKYNTSFLYDTTDIWKFSIYWCVILNECFYGVTGTIA 65
              +P+GY+TP FPSLYWPI  ++ ++ +FLY   DIWKF++YW +I N  FY   G +A
Sbjct: 10  EQSVPIGYITPKFPSLYWPIGFDESFDNAFLYSVVDIWKFTLYWSLIFNGAFYVSAGAVA 69

Query: 66  GVSHRGKIGCIWIIFIYLFCGAVQGMVAGTIMGYMISAIYTSGLFEMSTWIPFCCAVVQI 125
            ++ + K   + I   Y   G +QG++ GT+MG+++  IY +GLF MS WIP CCAV QI
Sbjct: 70  CLTTKKKSRSLLIFATYTVFGGLQGVIVGTVMGFLVGTIYRAGLFGMSCWIPMCCAVAQI 129

Query: 126 LFDVVQSF 133
           L+DV+ S+
Sbjct: 130 LYDVLVSY 137

>AFR319W Chr6 (1013960..1014261,1014335..1014458) [426 bp, 141 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YPR153W; 1-intron
          Length = 141

 Score =  112 bits (280), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 55/123 (44%), Positives = 76/123 (61%), Gaps = 1/123 (0%)

Query: 11  PVGYVTPPFPSLYWPINNQKYNTSFLYDTTDIWKFSIYWCVILNECFYGVTGTIAGVSHR 70
           P GY++P FPSL W  +++  N + LY T DI +F+I+W +IL    YG  G IAG SHR
Sbjct: 13  PAGYISPSFPSLLWTADDRA-NGALLYYTKDIVRFTIFWTLILVGGMYGAVGLIAGYSHR 71

Query: 71  GKIGCIWIIFIYLFCGAVQGMVAGTIMGYMISAIYTSGLFEMSTWIPFCCAVVQILFDVV 130
              G + I+ IYL  GA+  ++ GT  G + +AIY + L  MSTWIP   AVVQ L+ + 
Sbjct: 72  RITGGVGILAIYLLLGALHAILGGTFSGLITAAIYRAALIAMSTWIPLASAVVQALYLLC 131

Query: 131 QSF 133
            +F
Sbjct: 132 AAF 134

>Kwal_47.18903 s47 (1020956..1021297) [342 bp, 113 aa] {ON} YPR153W
           - Hypothetical ORF [contig 189] FULL
          Length = 113

 Score = 40.8 bits (94), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 24/44 (54%)

Query: 57  FYGVTGTIAGVSHRGKIGCIWIIFIYLFCGAVQGMVAGTIMGYM 100
           FY   G  A VSHR   G +WI+  Y+  G  Q + AGT+ G M
Sbjct: 3   FYAAAGLWASVSHRRTAGGLWIMAFYVLVGGFQAVAAGTVTGLM 46

>TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {ON}
           Anc_5.298 YDR283C
          Length = 1668

 Score = 32.0 bits (71), Expect = 0.43,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 8/58 (13%)

Query: 1   MKSFITNNDIPVGYVTPPFPSLYWP----INNQKYNTSFLYDTTDIWKFSIYWCVILN 54
           M S   N  +P    T   P L W      NN   N++ +Y TTDIW+  + +  I+N
Sbjct: 426 MLSSYPNKHLP----TSELPVLQWRPPELKNNTSTNSAKIYRTTDIWQLGVTFLQIIN 479

>KLTH0D00308g Chr4 complement(28125..28883) [759 bp, 252 aa] {ON}
          similar to uniprot|Q12512 Saccharomyces cerevisiae
          YOL154W ZPS1 Putative GPI-anchored protein
          transcription is induced under low-zinc conditions as
          mediated by the Zap1p transcription factor and at
          alkaline pH
          Length = 252

 Score = 29.3 bits (64), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 7  NNDIPVGYVTPPFPSLYWPINNQKYN--TSFLYDTTDIWKFS 46
          N+DIP G+  P FP LY   N+ K     SF+ D+ ++  ++
Sbjct: 44 NSDIP-GWARPTFPELYQTCNSTKRRILQSFIEDSLEVSAYA 84

>SAKL0G04180g Chr7 (343513..345135) [1623 bp, 540 aa] {ON} similar
           to uniprot|Q12412 Saccharomyces cerevisiae YOR161C PNS1
          Length = 540

 Score = 28.1 bits (61), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 16/68 (23%), Positives = 35/68 (51%), Gaps = 15/68 (22%)

Query: 82  YLFCGAVQGMVAG--TIMGYMISAIYTSGL-------------FEMSTWIPFCCAVVQIL 126
           +++CG V  +V+G  T + Y+    +++G+             F M + IP   A+++ +
Sbjct: 159 FIYCGMVVNIVSGLATAIAYLSMGYWSAGIVFLVFTVITAFCYFGMRSRIPLSVAILKTV 218

Query: 127 FDVVQSFP 134
            DV++ +P
Sbjct: 219 VDVMKKYP 226

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.330    0.144    0.493 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 15,555,831
Number of extensions: 636607
Number of successful extensions: 1611
Number of sequences better than 10.0: 25
Number of HSP's gapped: 1608
Number of HSP's successfully gapped: 25
Length of query: 140
Length of database: 53,481,399
Length adjustment: 98
Effective length of query: 42
Effective length of database: 42,244,131
Effective search space: 1774253502
Effective search space used: 1774253502
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 60 (27.7 bits)