Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0C045103.497ON1307130761050.0
ZYRO0D09790g3.497ON1180129119790.0
Suva_7.4223.497ON1127128919490.0
Smik_6.2303.497ON1124127619460.0
YGR134W (CAF130)3.497ON1122127718820.0
Skud_7.4453.497ON1123127418700.0
KAFR0C020003.497ON1066126218270.0
Kpol_480.123.497ON111493517250.0
SAKL0F02596g3.497ON113295516940.0
AFR316W3.497ON1191132416600.0
Ecym_12323.497ON1204118616150.0
KLTH0G02442g3.497ON1113128616070.0
KNAG0B007703.497ON1038110615700.0
CAGL0I10428g3.497ON116395713001e-157
TDEL0D056503.497ON107761511471e-136
Kwal_47.188863.497ON110568610531e-123
NCAS0E007703.497ON11503169291e-105
KLLA0E03961g3.497ON113211618961e-101
NDAI0G009003.497ON12794408861e-98
TPHA0A056803.497ON10743328205e-91
CAGL0C00110gsingletonON715115781.7
KLLA0D10351g8.872ON85959782.2
KNAG0E027706.8ON50879754.4
Kpol_529.128.426ON1113101754.6
TDEL0H009801.216ON407951755.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0C04510
         (1307 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0C04510 Chr3 (1092230..1096153) [3924 bp, 1307 aa] {ON} Anc_...  2356   0.0  
ZYRO0D09790g Chr4 complement(828446..831988) [3543 bp, 1180 aa] ...   766   0.0  
Suva_7.422 Chr7 (727936..731319) [3384 bp, 1127 aa] {ON} YGR134W...   755   0.0  
Smik_6.230 Chr6 (375653..379027) [3375 bp, 1124 aa] {ON} YGR134W...   754   0.0  
YGR134W Chr7 (757770..761138) [3369 bp, 1122 aa] {ON}  CAF130Par...   729   0.0  
Skud_7.445 Chr7 (736960..740331) [3372 bp, 1123 aa] {ON} YGR134W...   724   0.0  
KAFR0C02000 Chr3 (396123..399323) [3201 bp, 1066 aa] {ON} Anc_3....   708   0.0  
Kpol_480.12 s480 complement(23340..26684) [3345 bp, 1114 aa] {ON...   669   0.0  
SAKL0F02596g Chr6 complement(221983..225381) [3399 bp, 1132 aa] ...   657   0.0  
AFR316W Chr6 (1008188..1011763) [3576 bp, 1191 aa] {ON} Syntenic...   644   0.0  
Ecym_1232 Chr1 complement(477523..481137) [3615 bp, 1204 aa] {ON...   626   0.0  
KLTH0G02442g Chr7 complement(189819..193160) [3342 bp, 1113 aa] ...   623   0.0  
KNAG0B00770 Chr2 complement(142612..145728) [3117 bp, 1038 aa] {...   609   0.0  
CAGL0I10428g Chr9 complement(1031462..1034953) [3492 bp, 1163 aa...   505   e-157
TDEL0D05650 Chr4 (1015679..1018912) [3234 bp, 1077 aa] {ON} Anc_...   446   e-136
Kwal_47.18886 s47 (1013635..1016952) [3318 bp, 1105 aa] {ON} YGR...   410   e-123
NCAS0E00770 Chr5 complement(141832..145284) [3453 bp, 1150 aa] {...   362   e-105
KLLA0E03961g Chr5 complement(358995..362393) [3399 bp, 1132 aa] ...   349   e-101
NDAI0G00900 Chr7 complement(187653..191492) [3840 bp, 1279 aa] {...   345   1e-98
TPHA0A05680 Chr1 (1285934..1289158) [3225 bp, 1074 aa] {ON} Anc_...   320   5e-91
CAGL0C00110g Chr3 complement(2137..4284) [2148 bp, 715 aa] {ON} ...    35   1.7  
KLLA0D10351g Chr4 (873366..875945) [2580 bp, 859 aa] {ON} simila...    35   2.2  
KNAG0E02770 Chr5 (557579..559105) [1527 bp, 508 aa] {ON} Anc_6.8...    33   4.4  
Kpol_529.12 s529 (24687..28028) [3342 bp, 1113 aa] {ON} (24687.....    33   4.6  
TDEL0H00980 Chr8 (159829..172068) [12240 bp, 4079 aa] {ON} Anc_1...    33   5.2  

>TBLA0C04510 Chr3 (1092230..1096153) [3924 bp, 1307 aa] {ON} Anc_3.497
            YGR134W
          Length = 1307

 Score = 2356 bits (6105), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1190/1307 (91%), Positives = 1190/1307 (91%)

Query: 1    MNSFKKLSDLRDSLPIDYKPNIQLLETLIDYAKPDSEYLDSLLFESLILALFTTNCGLSV 60
            MNSFKKLSDLRDSLPIDYKPNIQLLETLIDYAKPDSEYLDSLLFESLILALFTTNCGLSV
Sbjct: 1    MNSFKKLSDLRDSLPIDYKPNIQLLETLIDYAKPDSEYLDSLLFESLILALFTTNCGLSV 60

Query: 61   LNIISTLKSFTNDKQKKNNLVPTTATAAVDSKHNKDENLDTTVIRNATATRNIIAKPNIL 120
            LNIISTLKSFTNDKQKKNNLVPTTATAAVDSKHNKDENLDTTVIRNATATRNIIAKPNIL
Sbjct: 61   LNIISTLKSFTNDKQKKNNLVPTTATAAVDSKHNKDENLDTTVIRNATATRNIIAKPNIL 120

Query: 121  KKQAHHPKLLEKWRNDKITLLKFTKFILKNSNFPLNYNAFFDPVMKLPLEFLLLNDRFCS 180
            KKQAHHPKLLEKWRNDKITLLKFTKFILKNSNFPLNYNAFFDPVMKLPLEFLLLNDRFCS
Sbjct: 121  KKQAHHPKLLEKWRNDKITLLKFTKFILKNSNFPLNYNAFFDPVMKLPLEFLLLNDRFCS 180

Query: 181  NDNNATSQKLFSIYNNTLLMDKNYNLLLDYLHVSTPLLISLLHTNLDPLLFNNIISSYNK 240
            NDNNATSQKLFSIYNNTLLMDKNYNLLLDYLHVSTPLLISLLHTNLDPLLFNNIISSYNK
Sbjct: 181  NDNNATSQKLFSIYNNTLLMDKNYNLLLDYLHVSTPLLISLLHTNLDPLLFNNIISSYNK 240

Query: 241  SFELTNDNKCLWYDFIDSKDTTNFGTITNCIDIINNFLEIFDMHKNFTLNAEXXXXXXXX 300
            SFELTNDNKCLWYDFIDSKDTTNFGTITNCIDIINNFLEIFDMHKNFTLNAE        
Sbjct: 241  SFELTNDNKCLWYDFIDSKDTTNFGTITNCIDIINNFLEIFDMHKNFTLNAEISNSLFNI 300

Query: 301  XXXXXXXXXMHNENEGADLNLLMDENSMGEHTLSFNLFENNINHGILHPDLMAHISKRHD 360
                     MHNENEGADLNLLMDENSMGEHTLSFNLFENNINHGILHPDLMAHISKRHD
Sbjct: 301  SSSSTTKSNMHNENEGADLNLLMDENSMGEHTLSFNLFENNINHGILHPDLMAHISKRHD 360

Query: 361  ILAKILNVGDNDKYYNSPLLHLQFKLLCALVDPLTQPTPNHKNIISIDLLFQLFLGFLKP 420
            ILAKILNVGDNDKYYNSPLLHLQFKLLCALVDPLTQPTPNHKNIISIDLLFQLFLGFLKP
Sbjct: 361  ILAKILNVGDNDKYYNSPLLHLQFKLLCALVDPLTQPTPNHKNIISIDLLFQLFLGFLKP 420

Query: 421  ELDRYSSAEDGTNWKFLVCFNMEKIINSVMKKLNCVDFNTLNSINNSDESVHWRTQLHKW 480
            ELDRYSSAEDGTNWKFLVCFNMEKIINSVMKKLNCVDFNTLNSINNSDESVHWRTQLHKW
Sbjct: 421  ELDRYSSAEDGTNWKFLVCFNMEKIINSVMKKLNCVDFNTLNSINNSDESVHWRTQLHKW 480

Query: 481  LPRGFNTQDLELLYMVNILATYTIYKLNEDLPIQLNPFLSSMVSHWKNLSCTILLGLEID 540
            LPRGFNTQDLELLYMVNILATYTIYKLNEDLPIQLNPFLSSMVSHWKNLSCTILLGLEID
Sbjct: 481  LPRGFNTQDLELLYMVNILATYTIYKLNEDLPIQLNPFLSSMVSHWKNLSCTILLGLEID 540

Query: 541  RLEEENETFDTPLIVRATVRSSTALRSIIATILNEHVNAFAHDFKHESLNTFMSPYGRKL 600
            RLEEENETFDTPLIVRATVRSSTALRSIIATILNEHVNAFAHDFKHESLNTFMSPYGRKL
Sbjct: 541  RLEEENETFDTPLIVRATVRSSTALRSIIATILNEHVNAFAHDFKHESLNTFMSPYGRKL 600

Query: 601  CNGALYTDFRSHASTILALTGDLEHVTQLISDLQPGDRFDEDVKYMFEFEDYNTLPNVLG 660
            CNGALYTDFRSHASTILALTGDLEHVTQLISDLQPGDRFDEDVKYMFEFEDYNTLPNVLG
Sbjct: 601  CNGALYTDFRSHASTILALTGDLEHVTQLISDLQPGDRFDEDVKYMFEFEDYNTLPNVLG 660

Query: 661  GEDDETSTDTLKNREMLKEIHNGNFIPXXXXXXXXXXXXYLEQKLREMNCHRRCNCIFSD 720
            GEDDETSTDTLKNREMLKEIHNGNFIP            YLEQKLREMNCHRRCNCIFSD
Sbjct: 661  GEDDETSTDTLKNREMLKEIHNGNFIPDNEENDEREIRNYLEQKLREMNCHRRCNCIFSD 720

Query: 721  DEIKDTSISDKNYMGNSSSNGIESRIALLLNNNSSRKGGNGTNSEDDEDVIRKNIENLTK 780
            DEIKDTSISDKNYMGNSSSNGIESRIALLLNNNSSRKGGNGTNSEDDEDVIRKNIENLTK
Sbjct: 721  DEIKDTSISDKNYMGNSSSNGIESRIALLLNNNSSRKGGNGTNSEDDEDVIRKNIENLTK 780

Query: 781  DQLSSTEMESLRVTGFNKPHAVRTXXXXXXXXXXXXXXXXXIFDFDYNGKDWRDTPRGMN 840
            DQLSSTEMESLRVTGFNKPHAVRT                 IFDFDYNGKDWRDTPRGMN
Sbjct: 781  DQLSSTEMESLRVTGFNKPHAVRTSNLNNNPSSVNNKNNQNIFDFDYNGKDWRDTPRGMN 840

Query: 841  LYYNLNYEFIEKPNLDLVFQLTLKATNMKLDKDDSNLLLRLVASSVKNEQDRIIFSDNQV 900
            LYYNLNYEFIEKPNLDLVFQLTLKATNMKLDKDDSNLLLRLVASSVKNEQDRIIFSDNQV
Sbjct: 841  LYYNLNYEFIEKPNLDLVFQLTLKATNMKLDKDDSNLLLRLVASSVKNEQDRIIFSDNQV 900

Query: 901  SKEVKEIMEQNEDGVENEKLPHNKNRIENGNEKEIITEITPDDIYEIWCEESAFERMMQL 960
            SKEVKEIMEQNEDGVENEKLPHNKNRIENGNEKEIITEITPDDIYEIWCEESAFERMMQL
Sbjct: 901  SKEVKEIMEQNEDGVENEKLPHNKNRIENGNEKEIITEITPDDIYEIWCEESAFERMMQL 960

Query: 961  NYEVTFRLMDEMLMCYGYRRVLIWFITHLELSHSVIHYIFELVMGFRGTSEENGATEDKH 1020
            NYEVTFRLMDEMLMCYGYRRVLIWFITHLELSHSVIHYIFELVMGFRGTSEENGATEDKH
Sbjct: 961  NYEVTFRLMDEMLMCYGYRRVLIWFITHLELSHSVIHYIFELVMGFRGTSEENGATEDKH 1020

Query: 1021 TNTKGXXXXXXXXXXXXXXXXXXXDYSKIFDLQLPFSRQGNIELSEIERKMLIQEFLTNA 1080
            TNTKG                   DYSKIFDLQLPFSRQGNIELSEIERKMLIQEFLTNA
Sbjct: 1021 TNTKGNVNELENKNENELVNMLLNDYSKIFDLQLPFSRQGNIELSEIERKMLIQEFLTNA 1080

Query: 1081 AIHFNERNNLKHNPXXXXXXXXXXXXXXXXXXXXXXXLYSIGLMRLICFMIQAFLDNNKL 1140
            AIHFNERNNLKHNP                       LYSIGLMRLICFMIQAFLDNNKL
Sbjct: 1081 AIHFNERNNLKHNPNSNDNSNSNEDNINKDEDEDEISLYSIGLMRLICFMIQAFLDNNKL 1140

Query: 1141 KIEVDDSIFELQTLLMNWITIIPEAKKLFFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXT 1200
            KIEVDDSIFELQTLLMNWITIIPEAKKLFF                             T
Sbjct: 1141 KIEVDDSIFELQTLLMNWITIIPEAKKLFFQIKDIISNNQIDNNNFNNNLILDLDQDNNT 1200

Query: 1201 IENQTSKDNNDKMDESSKVDSNSSFNKKLIELFPKMSHTNKEENTAIDTLKNYLKKFRFH 1260
            IENQTSKDNNDKMDESSKVDSNSSFNKKLIELFPKMSHTNKEENTAIDTLKNYLKKFRFH
Sbjct: 1201 IENQTSKDNNDKMDESSKVDSNSSFNKKLIELFPKMSHTNKEENTAIDTLKNYLKKFRFH 1260

Query: 1261 QEVPIIGRKVIYEDGKILKIPINIIDEYNQWNDQIYDYNDTASDVEM 1307
            QEVPIIGRKVIYEDGKILKIPINIIDEYNQWNDQIYDYNDTASDVEM
Sbjct: 1261 QEVPIIGRKVIYEDGKILKIPINIIDEYNQWNDQIYDYNDTASDVEM 1307

>ZYRO0D09790g Chr4 complement(828446..831988) [3543 bp, 1180 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily-conserved CCR4-
            NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1180

 Score =  766 bits (1979), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/1291 (37%), Positives = 672/1291 (52%), Gaps = 220/1291 (17%)

Query: 17   DYKPNIQLLETLIDYAKP--DSEYLDSLLFESLILALFTTNCGLSVLNIISTLKSFTNDK 74
            DY    + L+ L+  +K   D +   SLL E +I+AL TT  GLSVL ++          
Sbjct: 60   DYDARFEFLDRLLRDSKSWKDPQLKYSLLLEMVIVALLTTRAGLSVLALL---------- 109

Query: 75   QKKNNLVPTTATAAVDSKHNKDENLDTTVIRNATATRNIIAKPNILKKQAHHPKLLEKWR 134
                                K    + ++ +  +  R  +A+  + +K   H  L+ +W+
Sbjct: 110  --------------------KPSGSNPSIPKCISNQRKWLAQ--VERKGKLHSDLISQWQ 147

Query: 135  NDKITLLKFTKFILKNSNFPLNYNAFFDPVMKLPLEFLLLNDRFCSNDNNATSQKLFSIY 194
            +D    LKF  F+LKN +  L          K+PL FL+ +    +              
Sbjct: 148  SDDDIFLKFLHFLLKNEDVWLPCENVNQCEWKVPLSFLIQSKYRAAE------------- 194

Query: 195  NNTLLMDKNYNLLLDYLHVSTPLLISLLHTNL---DPLLFNNIISSYNKSFELTNDNKCL 251
               L++D +YNLL+DY     PL    L   +   + +     + +YN+ ++ +      
Sbjct: 195  ---LILDPSYNLLVDYFLAVVPLCEKWLRRAISYGNGVHLKRTVINYNRVYDFSG--YFT 249

Query: 252  WYDFIDSKDTTNFGTITNCIDIINN---------FLEIFDMHKNFTLNAEXXXXXXXXXX 302
            WY          F +     D+I++          +E  D  +   +  +          
Sbjct: 250  WYTLQTRGSNHPFVSQQILFDLIDSDDKEIEAVSQIESNDQEERIQIIDQIRSAIQDISS 309

Query: 303  XXXXXXXMHNENEGADLNLLMDENS--------MGEHTLSFNLFENNINHGILHPDLMAH 354
                     +E+  A     ++E S          E   SF+L   N +  +  P+LM+H
Sbjct: 310  ASLNSGFYGDEDRSA-----LEEYSDNYHHQVNQNEQVFSFDL---NQDGSLELPNLMSH 361

Query: 355  ISKRHDILAKILNVGDNDKYYNSPLLHLQFKLLCALVDPLTQPTPNHKNIISIDLLFQLF 414
             + RH+IL K+L + ++    +SPLL LQFK++  LVDPLTQP PN K++IS+DLL+Q+F
Sbjct: 362  AAVRHEILMKVLKLNNS----SSPLLQLQFKIVAGLVDPLTQPAPNDKHVISLDLLYQMF 417

Query: 415  LGFLKPELDRYSSAEDGTNWKFLVCFNMEKIINSVMKKLNCVDFNTLNSINNSDESVHWR 474
            LGFL PE+ +    E+G +W+F VCFNM+KII++ + +LN  DF  LNSINNSD++V WR
Sbjct: 418  LGFLTPEIQQTLEFEEGCDWRFHVCFNMQKIIDASLVRLNFDDFERLNSINNSDDNVDWR 477

Query: 475  TQLHKWLPRGFNTQDLELLYMVNILATYTIYKLNEDLPIQLNPFLSSMVSHWKNLSCTIL 534
            +QL KWLP GFNTQDLEL+ MV+I+A YTIYKL E LPIQLNPFLSS++S WKNL+C IL
Sbjct: 478  SQLDKWLPHGFNTQDLELICMVDIIAVYTIYKLYEHLPIQLNPFLSSLISLWKNLTCVIL 537

Query: 535  LGLEIDRLEEENETFDTPLIVRATVRSSTALRSIIATILNEHVNAFAHDFKHESLNTFMS 594
            LGLEIDR+EEE ETFDTPL+VRAT+R + ALR+I+AT+LN HV A  HD KHESLNTFMS
Sbjct: 538  LGLEIDRIEEELETFDTPLMVRATIRGAAALRAIVATVLNGHVEATKHDIKHESLNTFMS 597

Query: 595  PYGRKLCNGALYTDFRSHASTILALTGDLEHVTQLISDLQPGDRFDEDVKYMF--EFEDY 652
            P+GRKLC GALY + RSHA+ +LAL  +LE VT L SDLQPGDRFDEDV+YMF  EFEDY
Sbjct: 598  PHGRKLCQGALYAELRSHAAALLALGSELEDVTSLFSDLQPGDRFDEDVRYMFEYEFEDY 657

Query: 653  NTLPNVLGGEDDETSTDTLKNREMLKEIHNGNFIPXXXXXXXXXXXXYLEQKLREMNCHR 712
            N L +    E+D +  D   +     + H                              R
Sbjct: 658  NDLSS---REEDYSGFDKYDDYTDSSKTH------------------------ARKGFGR 690

Query: 713  RCNCIFSDDEIKDTSISDKNYMGNSSSNGIESRIALLLNNNSSRKGGNGTNSEDDEDVIR 772
            RCNCIF DDE+ +    +  Y G+ +   I                              
Sbjct: 691  RCNCIFDDDEMLEDEDYENEYEGHKAPKQILP---------------------------- 722

Query: 773  KNIENLTKDQLSSTEMESLRVTGFNKPHAVRTXXXXXXXXXXXXXXXXXIFDFDYNGKDW 832
                     Q + T   S+  TG  KPHA+R+                  F+FDY+GKDW
Sbjct: 723  ---------QQNPTTSVSMSTTG--KPHAIRSGGS---------------FEFDYSGKDW 756

Query: 833  RDTPRGMNLYYNLNYEFIEKPNLDLVFQLTLKATNMKLDKDDSNLLLRLVASSVKNEQDR 892
            RD PR  NLYY+ NY F+E  + + +  LT KAT   L K +S LLL  VA+ VKNEQD 
Sbjct: 757  RDIPRMSNLYYSPNYHFVEDLDPNTIISLTNKATKQSLSKIESLLLLGSVATCVKNEQDE 816

Query: 893  IIFSDNQVSKEVKEIMEQNEDGVENEKLPHNKNRIENGNEKEIITEITPDDIYEIWCEES 952
            I+  +      + E+              H++N        + + +I+PDDIYE+WC++S
Sbjct: 817  IVLGN------ITEL--------------HHQNGSRGSQVIDKLKDISPDDIYEMWCKDS 856

Query: 953  AFERMMQLNYEVTFRLMDEMLMCYGYRRVLIWFITHLELSHSVIHYIFELVMGFRGTSEE 1012
             FE+M+  N+EV +RLMDEMLMC G+RRVLIWFITH+EL+HS+IHYIFELVMG R + +E
Sbjct: 857  TFEKMVYCNHEVAWRLMDEMLMCSGFRRVLIWFITHMELNHSLIHYIFELVMGLRKSFDE 916

Query: 1013 NGATEDKHTNTKGXXXXXXXXXXXXXXXXXXXDYSKIFDLQLPFSRQGNIELSEIERKML 1072
            N   ++   +                               LPFSRQG+I+LS IE KML
Sbjct: 917  NNENDNGDESISEMTKEAPEVRT-----------------SLPFSRQGSIQLSSIETKML 959

Query: 1073 IQEFLTNAAIHFNERNN--LKHNPXXXXXXXXXXXXXXXXXXXXXXXLYSIGLMRLICFM 1130
            +QEF TNAAI   E++   +   P                       LY++GLM+LIC M
Sbjct: 960  LQEFFTNAAIFLTEKSKEWIGEEP-------MEDEATINDGENGNVSLYAVGLMKLICLM 1012

Query: 1131 IQAFLDNNKLKIEVDDSIFELQTLLMNWITIIPEAKKLFFXXXXXXXXXXXXXXXXXXXX 1190
            ++AF+   K      + +FELQTLLMNWI IIPEAK LFF                    
Sbjct: 1013 VRAFIKKGKFDFRESECVFELQTLLMNWIAIIPEAKDLFFELKALVAEVHSDPMDDEELS 1072

Query: 1191 XXXXXXXXXTIENQTSKDNNDKMDESSKVDSNSSFNKKLIELFPKMSHTNKEENTAIDTL 1250
                       +  +S   ND ++ +  VD  S +N+KLI L   + H  KEEN A+  L
Sbjct: 1073 NNPPDSN----KKLSSMVENDNINGNEAVD--SEYNRKLISLLSPVMH-RKEENAAVVAL 1125

Query: 1251 KNYLKKFRFHQEVPIIGRKVIYEDGKILKIP 1281
            +N++KK+ F   VP+IGRKV+YE  +IL +P
Sbjct: 1126 RNFIKKYSFDTTVPLIGRKVVYEGNEILPLP 1156

>Suva_7.422 Chr7 (727936..731319) [3384 bp, 1127 aa] {ON} YGR134W
            (REAL)
          Length = 1127

 Score =  755 bits (1949), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/1289 (36%), Positives = 661/1289 (51%), Gaps = 254/1289 (19%)

Query: 18   YKPNIQLLETLI--DYAKPDSEYLDSLLFESLILALFTTNCGLSVLNIISTLKSFTNDKQ 75
            Y P+++ LE L+  +    D E    LLFE+L + LFTT  G S+L    T+K+ T+ ++
Sbjct: 45   YTPSVENLEKLLYDETILNDQEIRFPLLFEALSVTLFTTKSGKSILQ---TMKASTSKER 101

Query: 76   KKNNLVPTTATAAVDSKHNKDENLDTTVIRNATATRNIIAKPNILKKQAHHPKLLEKWRN 135
            K          A   S  N D N                           +  ++  W+ 
Sbjct: 102  K----------AWEKSFENHDSN---------------------------YASIIRSWKE 124

Query: 136  DKITLLKFTKFILKNSNFPLNYNAFFDPVMKLPLEFLLLNDRFCSNDNNATSQKLFSIYN 195
            D + LLKF +FIL N   PL  + +  P  KLPL FL+++                 +  
Sbjct: 125  DDVLLLKFLRFILANKTTPLQIDRYNLPKYKLPLSFLIVS----------------KVNL 168

Query: 196  NTLLMDKNYNLLLDYLHVSTPLLISLLHTN----LDPLLFNNIISSYNKSFELTNDNKCL 251
             ++++++ YN+L DYL+  +  +  L+  N        +F   +  Y++  E  N     
Sbjct: 169  PSIILNEGYNMLKDYLYAISGRMEGLIWCNSTFDQSARIFKGTLQQYDRMIEFRN--FYF 226

Query: 252  WYDFIDSKDTTNFGTITNCIDIINNFLEIFDMHKNFTLNAEXXXXXXXXXXXXXXXXXMH 311
            WY F   K+ T                    ++ N  L  +                   
Sbjct: 227  WYSFSAEKNATP------------------KLNHNINLLMDSYEDNLDGVSSVDDAGKSD 268

Query: 312  NENEGADLNLLMDENSMGEHTLSFNLFENNINHGILH-PDLMAHISKRHDILAKILNVGD 370
            N  +     ++    +  E   SF L ++    G L  P++M H   RH++L KILN+  
Sbjct: 269  NHQKQPKDTIIHRTVNDQEQIYSFELNQD----GTLQIPNVMEHSLLRHELLFKILNLTP 324

Query: 371  NDKYYNSPLLHLQFKLLCALVDPLTQPTPNHKNIISIDLLFQLFLGFLKPELDRYSSAED 430
                  +PLL  QF  LC LVDPLTQPTPN K+IISID L+QLFLG + P +       +
Sbjct: 325  ----VLTPLLEQQFSTLCGLVDPLTQPTPNDKHIISIDFLYQLFLGLMYPSIKTSQEHNN 380

Query: 431  GTNWKFLVCFNMEKIINSVMKKLNCVDFNTLNSINNSDESVHWRTQLHKWLPRGFNTQDL 490
              +WKF +CFNM+KII++ M +LNC  F  LNSINN+D++VHWRTQLH WLP G NTQDL
Sbjct: 381  HYDWKFYICFNMQKIIDATMLRLNCFGFEKLNSINNTDDTVHWRTQLHIWLPHGLNTQDL 440

Query: 491  ELLYMVNILATYTIYKLNEDLPIQLNPFLSSMVSHWKNLSCTILLGLEIDRLEEENETFD 550
            ELLYM++ILA YTIYKL E++PIQLNPFL S++S WKNLSC ILL LEIDR+EEE  T++
Sbjct: 441  ELLYMIDILAVYTIYKLYEEIPIQLNPFLFSLLSLWKNLSCVILLALEIDRIEEEKGTYE 500

Query: 551  TPLIVRATVRSSTALRSIIATILNEHVNAFAHDFKHESLNTFMSPYGRKLCNGALYTDFR 610
            TPL+VRAT+R + ALRS+IA +LN  V +  HDFKHESLNTFMSPYGRKLC+GALY D R
Sbjct: 501  TPLMVRATIRGAAALRSVIAAVLNGLVKSNDHDFKHESLNTFMSPYGRKLCHGALYADLR 560

Query: 611  SHASTILALTGDLEHVTQLISDLQPGDRFDEDVKYMFEF--EDYNTLPNVLGGEDDETST 668
            SH +++LAL   +E VT L +DLQ GDRFDED++YMF++  EDYN   +  G  D+E   
Sbjct: 561  SHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECEDYNESFSDCG--DEELGE 618

Query: 669  DTLKNREMLKEIHNGNFIPXXXXXXXXXXXXYLEQKLREMNCHRRCNCIFSDDEIKDTSI 728
                  +    IHNG +                          RRCNCIF+DD++     
Sbjct: 619  GVNSGEKTKTSIHNGFY-------------------------QRRCNCIFNDDKL----- 648

Query: 729  SDKNYMGNSSSNGIESRIALLLNNNSSRKGGNGTNSEDDEDVIRKNIENLTKDQLSSTEM 788
                                           +G N+  + D I+  I +      ++   
Sbjct: 649  ----------------------------VAEDGANASTNNDSIKNEIRSDGNAGSNTAIT 680

Query: 789  ESLRVTGFNKPHAVRTXXXXXXXXXXXXXXXXXIFDFDYNGKDWRDTPRGMNLYYNLNYE 848
             +   T    P++VR+                  F+FDY+G+DWRD P+  N+YY+ +Y 
Sbjct: 681  NANHATSSINPYSVRSRST---------------FEFDYSGEDWRDVPKDFNIYYSPSYS 725

Query: 849  FIEKPNLDLVFQLTLKATNMKLDKDDSNLLLRLVASSVKNEQDRIIFSD-NQVSKEVKEI 907
            FI++P LD++F LTL+    KL +++S LL+R VAS VKNEQD++I +D       + E 
Sbjct: 726  FIQEPKLDIIFNLTLRGATEKLSREESVLLVRSVASCVKNEQDQMILADLGSNFTSIGEN 785

Query: 908  MEQNEDGVENEKLPHNKNRIENGNEKEIITEITPDDIYEIWCEESAFERMMQLNYEVTFR 967
             E  + G+ ++K           N++E +   TPDDIYEIW EESAFERM+ +N++V +R
Sbjct: 786  FEGGDTGITSDKT----------NDEE-LRRTTPDDIYEIWSEESAFERMLYVNHDVAWR 834

Query: 968  LMDEMLMCYGYRRVLIWFITHLELSHSVIHYIFELVMGFRGTSEENGATE---------- 1017
            LMDEMLMC GYRR+LIWF+THLEL HS+I+Y+FEL+MG RG      A++          
Sbjct: 835  LMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGNPFSGEASDQDRKDDMIYE 894

Query: 1018 -----DKHTNTKGXXXXXXXXXXXXXXXXXXXDYSKIFDLQLPFSRQGNIELSEIERKML 1072
                  K+ NT G                            LPFSRQG I LS+IE KML
Sbjct: 895  ILKKKQKNENTSG----------------------------LPFSRQGPIVLSDIETKML 926

Query: 1073 IQEFLTNAAIHFNERNNLKHNPXXXXXXXXXXXXXXXXXXXXXXXLYSIGLMRLICFMIQ 1132
            +QEF  NAAI  + +N  +                          LYS+GL++LIC+M+Q
Sbjct: 927  LQEFFMNAAIFLSSKNTEEEG-----------------EDADKVSLYSLGLVKLICYMVQ 969

Query: 1133 AFLDNNKLKIEVDDSIFELQTLLMNWITIIPEAKKLFFXXXXXXXXXXXXXXXXXXXXXX 1192
              + N+K      +  FELQTLLM WI I+PEAK LFF                      
Sbjct: 970  TLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDLFF-------------QIKSRLAME 1016

Query: 1193 XXXXXXXTIENQTSKDNNDKMDESSKVDSNSSFNKKLIELFPKMSHTNKEENTAIDTLKN 1252
                   T++++   D +    +     S S  N K++ LFP  + T  ++N+AI TL++
Sbjct: 1017 EDGITDNTVQHKDKTDLDLDSGKKPNTKSISKLNMKILSLFPS-NPTENDDNSAISTLRS 1075

Query: 1253 YLKKFRFHQEVPIIGRKVIYEDGKILKIP 1281
            ++  + F  +V   GR+V++ D KIL +P
Sbjct: 1076 FITDYSFDTQVVAPGRRVVFHDDKILPLP 1104

>Smik_6.230 Chr6 (375653..379027) [3375 bp, 1124 aa] {ON} YGR134W
            (REAL)
          Length = 1124

 Score =  754 bits (1946), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/1276 (38%), Positives = 670/1276 (52%), Gaps = 229/1276 (17%)

Query: 17   DYKPNIQLLETLI--DYAKPDSEYLDSLLFESLILALFTTNCGLSVLNIISTLKSFTNDK 74
            +Y P+++ LE ++  +    D +   SLLFE+L + LFTTN G S+L  I T   FT+ K
Sbjct: 42   NYVPSVENLEKVLCDETMLNDQKVRFSLLFEALAITLFTTNSGKSILQSIQT---FTSKK 98

Query: 75   QKKNNLVPTTATAAVDSKHNKDENLDTTVIRNATATRNIIAKPNILKKQAHHPKLLEKWR 134
            +K              S  N + N  + V                             W+
Sbjct: 99   RK----------LWAQSFENNNSNYASIVF---------------------------SWK 121

Query: 135  NDKITLLKFTKFILKNSNFPLNYNAFFDPVMKLPLEFLLLNDRFCSNDNNATSQKLFSIY 194
            ++ I LLKF +F+L N   PL  + +  P  KLPL FL+++                 I 
Sbjct: 122  DNDILLLKFVRFLLANKTMPLKIDRYNLPEHKLPLSFLIVS----------------KIN 165

Query: 195  NNTLLMDKNYNLLLDYLHVSTPLLISLLHT----NLDPLLFNNIISSYNKSFELTNDNKC 250
              ++L+++ YNLL DYL+  T  +  LL      N   L+    +  Y++  E  N   C
Sbjct: 166  IPSILLNEGYNLLKDYLYSITGRIEELLMCSPKFNQPALVVKRTLKDYDRMIECEN---C 222

Query: 251  LWYDFIDSKDTTNFGTITNCIDIINNFLEIFDMHKNFTLNAEXXXXXXXXXXXXXXXXXM 310
              + + +++++ +     N   ++ +        +N T N                    
Sbjct: 223  YCWYYFNAENSAHLKFDDNIACLMGS--------ENNTENG--------LGDSRVNNNNY 266

Query: 311  HNENEGADLNLLMDENSMGEHTLSFNLFENNINH-GILH-PDLMAHISKRHDILAKILNV 368
            H + +   ++  +++    E   SF L     NH G L  P++M H   RH++L KILN+
Sbjct: 267  HKQPKDVVMSRTINDQ---EQIYSFEL-----NHDGTLEIPNVMKHSLLRHELLFKILNL 318

Query: 369  GDNDKYYNSPLLHLQFKLLCALVDPLTQPTPNHKNIISIDLLFQLFLGFLKPELDRYSSA 428
                   ++PLL LQF  LC LVDPL QPTPN K+IISID LF+LFLG + P +      
Sbjct: 319  TP----VSTPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFLFKLFLGLMYPAIKSSQGH 374

Query: 429  EDGTNWKFLVCFNMEKIINSVMKKLNCVDFNTLNSINNSDESVHWRTQLHKWLPRGFNTQ 488
             D  +WKF  CFNM+KII++ M +LNC DFN LNS+NN+D SVHWRTQLH+WLP G NTQ
Sbjct: 375  NDHYDWKFYTCFNMQKIIDATMSRLNCFDFNILNSVNNTDSSVHWRTQLHRWLPHGLNTQ 434

Query: 489  DLELLYMVNILATYTIYKLNEDLPIQLNPFLSSMVSHWKNLSCTILLGLEIDRLEEENET 548
            DLELLYM++ILA YTIYKL E LPIQLNPFL S++S WKNLSC ILL LEIDR+EEEN T
Sbjct: 435  DLELLYMIDILAVYTIYKLYEKLPIQLNPFLFSLISLWKNLSCVILLALEIDRIEEENGT 494

Query: 549  FDTPLIVRATVRSSTALRSIIATILNEHVNAFAHDFKHESLNTFMSPYGRKLCNGALYTD 608
            ++TPL+VRAT+R + ALRS+IATILN  V    HDFKHESLNTFMSPYGRKL +GALY D
Sbjct: 495  YETPLMVRATIRGAAALRSVIATILNGLVKTNEHDFKHESLNTFMSPYGRKLSHGALYAD 554

Query: 609  FRSHASTILALTGDLEHVTQLISDLQPGDRFDEDVKYMFEFE--DYNTLPNVLGGEDDET 666
             RSH++++LA    +E VT L +DLQ GDRFDED++YMF++E  DY+         DDE 
Sbjct: 555  LRSHSASLLAFGTSIEDVTDLFADLQSGDRFDEDIRYMFDYECADYD---ESFSESDDEG 611

Query: 667  STDTLKN-REMLKEIHNGNFIPXXXXXXXXXXXXYLEQKLREMNCHRRCNCIFSDDEIKD 725
              + + N RE +K  ++ N                         C RRCNCIF+DD++  
Sbjct: 612  LEEGIVNAREKIKSSNDNNVF-----------------------CQRRCNCIFNDDKL-- 646

Query: 726  TSISDKNYMGNSSSNGIESRIALLLNNNSSRKGGNGTNSEDDEDVIRKNIENLTKDQLSS 785
                        + +G+        N N  R+             +R NI+ ++   +++
Sbjct: 647  -----------VAEDGLNEVFESTCNRNGERR-------------VRNNIDVVSNTAITT 682

Query: 786  TEMESLRVTGFNKPHAVRTXXXXXXXXXXXXXXXXXIFDFDYNGKDWRDTPRGMNLYYNL 845
            +   S  +     P +VR                   F+FDY+G+DWRD PR  N+YY+ 
Sbjct: 683  SNHVSTSIN----PFSVRARST---------------FEFDYSGEDWRDVPRDFNMYYSP 723

Query: 846  NYEFIEKPNLDLVFQLTLKATNMKLDKDDSNLLLRLVASSVKNEQDRIIFSDNQVSKEVK 905
            +Y FI  P LD++F LTL+    KL++++S LL+R VAS VKNEQD+++ +D        
Sbjct: 724  SYPFIHDPKLDVIFNLTLRGATEKLNREESILLVRSVASCVKNEQDQMVLAD-------- 775

Query: 906  EIMEQNEDGVENEKLPHNKNRIENGNEKEIITEITPDDIYEIWCEESAFERMMQLNYEVT 965
              ++ N  G+       N   I   + +E +   TPDDIYEIW EESAFERM+ +N++V 
Sbjct: 776  --LKTNLTGISKHAEGENSTSISKTDNEE-LRRTTPDDIYEIWSEESAFERMLNVNHDVA 832

Query: 966  FRLMDEMLMCYGYRRVLIWFITHLELSHSVIHYIFELVMGFRGTSEENGAT-EDKHTNTK 1024
            +RLMDEMLMC GYRR+LIWF THLEL HS+I+Y+FEL+MG RG +    A+ +DK  +  
Sbjct: 833  WRLMDEMLMCTGYRRILIWFFTHLELKHSLIYYVFELIMGLRGKAFSGKASDQDKKDD-- 890

Query: 1025 GXXXXXXXXXXXXXXXXXXXDYSKIFDLQLPFSRQGNIELSEIERKMLIQEFLTNAAIHF 1084
                                D S      LPFSRQG I LS+IE KML+QEF  NAAI  
Sbjct: 891  -------MIYEILKKKQKNDDAS-----SLPFSRQGPIILSDIETKMLLQEFFMNAAIFL 938

Query: 1085 NERNNLKHNPXXXXXXXXXXXXXXXXXXXXXXXLYSIGLMRLICFMIQAFLDNNKLKIEV 1144
            +  N+ + N                        LYS+GL+RLIC+M+Q  + N+K     
Sbjct: 939  SSNNSEEEN-----------------EDGEKISLYSLGLVRLICYMVQTLITNDKFFFTK 981

Query: 1145 DDSIFELQTLLMNWITIIPEAKKLFFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIENQ 1204
             +  FELQTLLM WI I+PEAK LFF                               E +
Sbjct: 982  SECTFELQTLLMTWIGILPEAKDLFFEIKTRLAMEEDNDTGTMQH------------EGR 1029

Query: 1205 TSKDNNDKMDESSKVDSNSSFNKKLIELFPKMSHTNKEENTAIDTLKNYLKKFRFHQEVP 1264
             S D   K++       N          FP  S  N  EN+AI+TL+N++  + F  +V 
Sbjct: 1030 RSLDIEKKLNTKPASKLNLKLLSL----FPSNSADNG-ENSAINTLRNFITDYSFDTQVN 1084

Query: 1265 IIGRKVIYEDGKILKI 1280
              GRKV++ DGKIL +
Sbjct: 1085 PPGRKVVFYDGKILPL 1100

>YGR134W Chr7 (757770..761138) [3369 bp, 1122 aa] {ON}  CAF130Part of
            the evolutionarily-conserved CCR4-NOT transcriptional
            regulatory complex involved in controlling mRNA
            initiation, elongation, and degradation
          Length = 1122

 Score =  729 bits (1882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/1277 (38%), Positives = 674/1277 (52%), Gaps = 231/1277 (18%)

Query: 17   DYKPNIQLLETLI--DYAKPDSEYLDSLLFESLILALFTTNCGLSVLNIISTLKSFTNDK 74
            +Y P+++ LE ++  +    D +   +LL E+LI+ LFTT  G S L +I T    ++ K
Sbjct: 42   NYVPSVENLEKILYNETMFNDQKICSNLLLEALIITLFTTISGKSALRLIQT----SSLK 97

Query: 75   QKKNNLVPTTATAAVDSKHNKDENLDTTVIRNATATRNIIAKPNILKKQAHHPKLLEKWR 134
            ++K             S     EN       N+++  +I+                  W+
Sbjct: 98   ERK-------------SWAQSFEN-------NSSSYASIVLS----------------WK 121

Query: 135  NDKITLLKFTKFILKNSNFPLNYNAFFDPVMKLPLEFLLLNDRFCSNDNNATSQKLFSIY 194
            ++ I LLKF +F+L N   PL  N +  P  KLPL FL+++                 I 
Sbjct: 122  DNDILLLKFLRFLLANKTAPLQINRYNLPEYKLPLSFLIVS----------------KIT 165

Query: 195  NNTLLMDKNYNLLLDYLHVSTPLLISLLHT----NLDPLLFNNIISSYNKSFELTNDNKC 250
              ++L+++ YNLL DYL+  T  + SL+      +   L+   I+  YN+  E      C
Sbjct: 166  IPSILLNETYNLLKDYLYSITGRIESLISCSSTFDKPALVVRKILKDYNRMIE------C 219

Query: 251  LWYDFIDSKDTTNFGTITNCIDIINNFLEIFDMHKNFTLNAEXXXXXXXXXXXXXXXXXM 310
              + F  S +  N   +T                 N +L  E                  
Sbjct: 220  RNFYFWYSFNAENRVNLT--------------FSDNISLLMENDEGNAGSGLDDSRFDHQ 265

Query: 311  HNENEGADLNLLMDENSMGEHTLSFNLFENNINHGILH-PDLMAHISKRHDILAKILNVG 369
                E      + D+    E   SF L ++    G L  P++M H   RH++L KILN+ 
Sbjct: 266  KQPREAIMGRTINDQ----EQIYSFELNQD----GTLEIPNVMEHSLLRHELLFKILNL- 316

Query: 370  DNDKYYNSPLLHLQFKLLCALVDPLTQPTPNHKNIISIDLLFQLFLGFLKPELDRYSSAE 429
                   +PLL LQF  LC LVDPL QPTPN K+IISID LFQLFLG +   +       
Sbjct: 317  ---TTVLTPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFLFQLFLGLMSQSIKTSQEHN 373

Query: 430  DGTNWKFLVCFNMEKIINSVMKKLNCVDFNTLNSINNSDESVHWRTQLHKWLPRGFNTQD 489
            D  +WKF +CFNM+KII++ M +LNC DF+ LNS+NN+D +VHW+TQLH+WLP G NTQD
Sbjct: 374  DHYDWKFYMCFNMQKIIDATMLRLNCFDFDILNSVNNTDNAVHWKTQLHRWLPHGLNTQD 433

Query: 490  LELLYMVNILATYTIYKLNEDLPIQLNPFLSSMVSHWKNLSCTILLGLEIDRLEEENETF 549
            LELLYM++ILA YTIYKL E +PIQLNPFL S++S WKNLSC ILL LEIDR+EEEN T+
Sbjct: 434  LELLYMIDILAVYTIYKLYEKIPIQLNPFLFSLISLWKNLSCVILLALEIDRIEEENGTY 493

Query: 550  DTPLIVRATVRSSTALRSIIATILNEHVNAFAHDFKHESLNTFMSPYGRKLCNGALYTDF 609
            +TPL+VRAT+R + ALRS+IAT+LN  V    HDFKHESLNTFMSPYGRKLC+GALY D 
Sbjct: 494  ETPLMVRATIRGAAALRSVIATVLNGLVKNNDHDFKHESLNTFMSPYGRKLCHGALYADL 553

Query: 610  RSHASTILALTGDLEHVTQLISDLQPGDRFDEDVKYMFEFE----DYNTLPNVLGGEDDE 665
            RSH +++LAL   +E VT L +DLQ GDRFDED++YMF++E    D +   +  GG D+ 
Sbjct: 554  RSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECEDYDESFSESDHGGLDES 613

Query: 666  TSTDTLKNREMLKEIHNGNFIPXXXXXXXXXXXXYLEQKLREMNCHRRCNCIFSDDEIKD 725
                T    E +    N  F                          RRCNCIF+DD+   
Sbjct: 614  VVNPT----EKIASGSNNVFF------------------------RRRCNCIFNDDK--- 642

Query: 726  TSISDKNYMGNSSSNGIESRIALLLNNNSSRKGGNGTNSEDDEDVIRKNIENLTKDQLSS 785
                                   L+  + + +    TNSE+ E  +  N  N   +  ++
Sbjct: 643  -----------------------LVAEDGANEAFGSTNSENVEGAMHNN-RNAVHNATTA 678

Query: 786  TEMESLRVTGFNKPHAVRTXXXXXXXXXXXXXXXXXIFDFDYNGKDWRDTPRGMNLYYNL 845
            T   S  V     P +VR+                  F+FDY+G+DWRD PR  N+YY+ 
Sbjct: 679  T---SDHVVTSPNPLSVRSRST---------------FEFDYSGEDWRDVPRDFNMYYSP 720

Query: 846  NYEFIEKPNLDLVFQLTLKATNMKLDKDDSNLLLRLVASSVKNEQDRIIFSDNQVSKEVK 905
            +Y FI +P LD++F LTL+    KL+K++S LL+R VAS V+NEQD++I +D  +     
Sbjct: 721  SYSFIHEPKLDVIFSLTLRGATEKLNKEESILLVRSVASCVRNEQDQMILAD--LESNFS 778

Query: 906  EIMEQNEDGVENEKLPHNKNRIENGNEKEIITEITPDDIYEIWCEESAFERMMQLNYEVT 965
              +  + +G  N K+    ++I+N    E +   TPDDIYEIW EESAFERM+ +N++V 
Sbjct: 779  ASINGDVEGEGNTKM----SKIDN----EDLRRTTPDDIYEIWSEESAFERMLNVNHDVA 830

Query: 966  FRLMDEMLMCYGYRRVLIWFITHLELSHSVIHYIFELVMGFRGTSEENGAT-EDKHTNTK 1024
            +RLMDEMLMC GYRR+LIWF+THLEL HS+I+Y+FEL+MG RG      A+ +DK  +  
Sbjct: 831  WRLMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELIMGLRGKPFSGEASDQDKKDD-- 888

Query: 1025 GXXXXXXXXXXXXXXXXXXXDYSKIFDLQLPFSRQGNIELSEIERKMLIQEFLTNAAIHF 1084
                                D S      LPFSRQG I LS+IE KML+QEF  NAAI  
Sbjct: 889  -------MIYEILKKKQKNEDASG-----LPFSRQGPIVLSDIETKMLLQEFFMNAAIFL 936

Query: 1085 NERNNLKHNPXXXXXXXXXXXXXXXXXXXXXXXLYSIGLMRLICFMIQAFLDNNKLKIEV 1144
            + +NN + N                        LYS+GL+RLIC+M+Q  + N+K     
Sbjct: 937  SSKNNEEEN-----------------EDGEKISLYSLGLVRLICYMVQTLIANDKFFFTK 979

Query: 1145 DDSIFELQTLLMNWITIIPEAKKLFFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIENQ 1204
             +  FELQTLLM WI I+PEAK LFF                             T++++
Sbjct: 980  SECTFELQTLLMTWIGILPEAKDLFF--------------KIKTRLAMEEEDSADTMQHE 1025

Query: 1205 TSKDNNDKMDESSKVDSNSSFNKKLIELFPKMSHTNKEENTAIDTLKNYLKKFRFHQEVP 1264
              K  N  +++       S  N KL+ LFP     NK++++ I+TL++++  + F  +V 
Sbjct: 1026 GRK--NSDIEKKLNAKPASELNLKLLNLFPS-KPANKDDSSPINTLRSFIADYSFDTQVN 1082

Query: 1265 IIGRKVIYEDGKILKIP 1281
              GR+V++ DGKIL +P
Sbjct: 1083 PPGRRVVFYDGKILPLP 1099

>Skud_7.445 Chr7 (736960..740331) [3372 bp, 1123 aa] {ON} YGR134W
            (REAL)
          Length = 1123

 Score =  724 bits (1870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/1274 (37%), Positives = 664/1274 (52%), Gaps = 226/1274 (17%)

Query: 17   DYKPNIQLLETLI--DYAKPDSEYLDSLLFESLILALFTTNCGLSVLNIISTLKSFTNDK 74
            +Y P+++ LE L+  +    D +   S+LFE+L + LFTT  G S+L             
Sbjct: 42   NYVPSLENLEKLLYNESILDDQKIRLSILFEALSIILFTTKSGKSILQ------------ 89

Query: 75   QKKNNLVPTTATAAVDSKHNKDENLDTTVIRNATATRNIIAKPNILKKQAHHPKLLEKWR 134
                         AV +   K++ L    +R+                 +++  +++ W+
Sbjct: 90   -------------AVQASTLKEKKLWAQSLRD---------------DDSNYASVVQGWK 121

Query: 135  NDKITLLKFTKFILKNSNFPLNYNAFFDPVMKLPLEFLLLNDRFCSNDNNATSQKLFSIY 194
            ++ +  LKF +F+L N    L  + +  P  KLPL FL+++                 I 
Sbjct: 122  DNDVLFLKFLRFLLANKTTSLQIDKYNLPEYKLPLSFLIVS----------------KIN 165

Query: 195  NNTLLMDKNYNLLLDYLHVSTPLLISLLH----TNLDPLLFNNIISSYNKSFELTNDNKC 250
              ++++++ +N+L DYL+  +  +  L+     T+   L+   I+  Y++  E    N  
Sbjct: 166  FPSIILNEGHNMLKDYLYSMSGRIDCLIRGNSITSRSALVVKKILKDYDRIVEF--HNLY 223

Query: 251  LWYDFIDSKDTTNFGTITNCIDIINNFLEIFDMHKNFTLNAEXXXXXXXXXXXXXXXXXM 310
             WY F + ++  NF            F + FD+  N                        
Sbjct: 224  FWYSF-NVENDVNF-----------EFSDNFDLLMN-------SPEDHADGGVIDDRCKS 264

Query: 311  HNENEGADLNLLMDENSMGEHTLSFNLFENNINHGILH-PDLMAHISKRHDILAKILNVG 369
             N  + A   ++    +  E   SF L ++    G L  P++M H   RH++L KILN+ 
Sbjct: 265  DNPQKHAKNTIIKRTINDQEQIYSFELDQD----GTLQIPNIMEHSLMRHELLFKILNLP 320

Query: 370  DNDKYYNSPLLHLQFKLLCALVDPLTQPTPNHKNIISIDLLFQLFLGFLKPELDRYSSAE 429
                   +PLL LQF  LC LVDPL QP+PN + +ISID LFQLFLG + P +       
Sbjct: 321  S----VLTPLLELQFCNLCGLVDPLMQPSPNDEQVISIDFLFQLFLGLMYPSIKSSQEHN 376

Query: 430  DGTNWKFLVCFNMEKIINSVMKKLNCVDFNTLNSINNSDESVHWRTQLHKWLPRGFNTQD 489
            D  +WKF  CFNM+KII++ M +LNC DF  LNS+NN+D  +HWRTQLHKWLP G NTQD
Sbjct: 377  DHYDWKFYTCFNMQKIIDATMLRLNCSDFERLNSVNNTDSVIHWRTQLHKWLPHGLNTQD 436

Query: 490  LELLYMVNILATYTIYKLNEDLPIQLNPFLSSMVSHWKNLSCTILLGLEIDRLEEENETF 549
            LELLYM++ILA YTIYKL E +PIQLNPFL S++S WKNLSC ILL LEIDR+EEEN T+
Sbjct: 437  LELLYMIDILAIYTIYKLYEKIPIQLNPFLFSLLSLWKNLSCVILLALEIDRIEEENGTY 496

Query: 550  DTPLIVRATVRSSTALRSIIATILNEHVNAFAHDFKHESLNTFMSPYGRKLCNGALYTDF 609
            +TPL+VRAT+R + ALRS+IA++LN  V +  HDFKHESLNTFMSPYGRKLC+GALY D 
Sbjct: 497  ETPLMVRATIRGAAALRSVIASVLNGLVKSNDHDFKHESLNTFMSPYGRKLCHGALYADL 556

Query: 610  RSHASTILALTGDLEHVTQLISDLQPGDRFDEDVKYMFEF--EDYNTLPNVLGGEDDETS 667
            RSH +++LAL   +E VT L +DLQ GDRFDED++YMF++  EDYN         DDE  
Sbjct: 557  RSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECEDYN---EPFSESDDEQL 613

Query: 668  TDTLKNREMLKEIHNGNFIPXXXXXXXXXXXXYLEQKLREMNCHRRCNCIFSDDEIKDTS 727
             +   +R  +K   +  F                          RRCNCIF+DD++    
Sbjct: 614  NEDANSRGKIKSSSSNGFY------------------------QRRCNCIFNDDKL---- 645

Query: 728  ISDKNYMGNSSSNGIESRIALLLNNNSSRKGGNGTNSEDDEDVIRKNIENLTKDQLSSTE 787
                      + +G      +  N+N   +  N  N      VI            S+  
Sbjct: 646  ---------VAEDGTNEAFEISGNSNMENEMPNNVN------VIP-----------STAT 679

Query: 788  MESLRVTGFNKPHAVRTXXXXXXXXXXXXXXXXXIFDFDYNGKDWRDTPRGMNLYYNLNY 847
              S R      P +VR+                  F+FDY+G+DWRD P+  N+YY+ +Y
Sbjct: 680  TNSNRFASSINPLSVRSRST---------------FEFDYSGEDWRDVPKDFNMYYSPSY 724

Query: 848  EFIEKPNLDLVFQLTLKATNMKLDKDDSNLLLRLVASSVKNEQDRIIFSDNQVSKEVKEI 907
             FI++P LD++F LTL+    KL++DDS +L+  VAS VKNEQD++I SD  +     EI
Sbjct: 725  SFIQEPKLDVIFNLTLRGATEKLNRDDSIVLVCSVASCVKNEQDQMILSD--LGSNFAEI 782

Query: 908  MEQNEDGVENEKLPHNKNRIENGNEKEIITEITPDDIYEIWCEESAFERMMQLNYEVTFR 967
             E  E          + N I   N +E +   TPDDIYEIW EESAFERM+ +N++V +R
Sbjct: 783  DENPE--------AKSSNNITKTNNEE-LRRTTPDDIYEIWSEESAFERMLNVNHDVAWR 833

Query: 968  LMDEMLMCYGYRRVLIWFITHLELSHSVIHYIFELVMGFRGTSEENGATEDKHTNTKGXX 1027
            LMDEMLMC GYRR+LIWF+THLEL HS+I+Y+FELVMG RG      A++    +     
Sbjct: 834  LMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELVMGLRGKPFSGEASDQDRKD----- 888

Query: 1028 XXXXXXXXXXXXXXXXXDYSKIFDLQLPFSRQGNIELSEIERKMLIQEFLTNAAIHFNER 1087
                             D S      LPFSRQG I LS+IE KML+QEF  NAAI  + +
Sbjct: 889  ---DMIYEILKKKRKNEDVSG-----LPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSK 940

Query: 1088 NNLKHNPXXXXXXXXXXXXXXXXXXXXXXXLYSIGLMRLICFMIQAFLDNNKLKIEVDDS 1147
            N+ + N                        LYS+GL++LIC+M+Q  + N+K      + 
Sbjct: 941  NDEEEN-----------------EDGEKISLYSLGLVKLICYMVQTLIANDKFLFTKSEC 983

Query: 1148 IFELQTLLMNWITIIPEAKKLFFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIENQTSK 1207
             FELQTLLM WI ++PEAK LFF                               + Q + 
Sbjct: 984  TFELQTLLMTWIGVLPEAKDLFFQIKTRLAMEEDSDK-----------------DGQQND 1026

Query: 1208 DNND-KMDESSKVDSNSSFNKKLIELFPKMSHTNKEENTAIDTLKNYLKKFRFHQEVPII 1266
            DN D +++      SNS  N KL+ LFP     N  +N+AI TL++++  + F  ++   
Sbjct: 1027 DNKDLEVERRPHTKSNSELNVKLLNLFPSNPAGNN-DNSAISTLRSFITDYPFDTQITPP 1085

Query: 1267 GRKVIYEDGKILKI 1280
            GRKV++ DGKIL +
Sbjct: 1086 GRKVVFYDGKILPL 1099

>KAFR0C02000 Chr3 (396123..399323) [3201 bp, 1066 aa] {ON} Anc_3.497
            YGR134W
          Length = 1066

 Score =  708 bits (1827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/1262 (37%), Positives = 666/1262 (52%), Gaps = 301/1262 (23%)

Query: 41   SLLFESLILALFTTNCGLSVLNIISTLKSFTNDKQKKNNLVPTTATAAVDSKHNKDENLD 100
            S+L E L+++LFTT  G S+L++++   + +   Q+ N+ +  +++  ++ K+ K E   
Sbjct: 51   SVLLEGLVISLFTTKSGHSILSVLNNPDANSELFQRYNSWL-ESSSGDLNYKYLKHE--- 106

Query: 101  TTVIRNATATRNIIAKPNILKKQAHHPKLLEKWRNDK-ITLLKFTKFILKNSNFPLNYNA 159
                                            W++++   L +FTKF+L+N   P + N 
Sbjct: 107  -------------------------------LWQSNRNYYLSQFTKFLLQNEQVPFHLNN 135

Query: 160  FFDPVMKLPLEFLLLNDRFCSNDNNATSQKLFSIYNNTLLMDKNYNLLLDYLHVSTPLLI 219
            +     KL L+      R  ++++N  S          +L   NYNLLLD++    P + 
Sbjct: 136  YHLTKYKLKLQ------RLINSESNIIS---------LILNSDNYNLLLDFIMFFQPYMN 180

Query: 220  SLLHTNLDPLLFNNIISSYNKSFELTNDNKCLWYDFIDSKDTTNFGTITNCIDIINNFLE 279
             L+   ++   F  II+ YN+ +EL   +   WY    + +T+        +  +N+ L 
Sbjct: 181  DLISYIVEGNKFFEIIAKYNRIYELNGFHT--WYTLTIASNTSI------AVRYLNDVLS 232

Query: 280  IFDM-HKNFTLNAEXXXXXXXXXXXXXXXXXMHNENEGADLNLLMDENSMGEHTLSFNLF 338
            I  M    FT N                        + ++  LLM +    +  + F+  
Sbjct: 233  IDPMITDQFTSNYRDKAF------------------QESEETLLMSQQQTAKDDIIFSF- 273

Query: 339  ENNINHGILHPDLMAHISKRHDILAKILNVGDNDKYYNSPLLHLQFKLLCALVDPLTQPT 398
              ++N     P+L+ H   RH I+  ILN+   D    SP L  QF L+C LVDPLTQP 
Sbjct: 274  --DLNETGDLPNLIKHSEMRHQIIYDILNLNQID----SPFLKKQFLLICGLVDPLTQPQ 327

Query: 399  PNHKNIISIDLLFQLFLGFLKPELDRYSSAEDGTNWKFLVCFNMEKIINSVMKKLNCVDF 458
            PN+++IISIDL++QLF+G +    +   + +D     F +CFNM+KII+  +  LNC D+
Sbjct: 328  PNNEHIISIDLIYQLFMGLMYKFNNNELAGKDKELQHFTICFNMQKIISRSLVLLNCNDY 387

Query: 459  NTLNSINNSDESVHWRTQLHKWLPRGFNTQDLELLYMVNILATYTIYKLNEDLPIQLNPF 518
            +TL++I N D    ++T L+KWLP G NTQDLEL+YM+NI+A YTIYKL  +LPIQLNPF
Sbjct: 388  DTLSTILN-DFPNDYKTALNKWLPHGINTQDLELIYMINIIAIYTIYKLYSNLPIQLNPF 446

Query: 519  LSSMVSHWKNLSCTILLGLEIDRLEEENETFDTPLIVRATVRSSTALRSIIATILNEHVN 578
            L ++VS WK LS  +L+GLEIDR+EE NET+DTP+IVRAT+R + ALR++IATILN+HV+
Sbjct: 447  LQTLVSLWKTLSHLVLIGLEIDRIEESNETYDTPIIVRATIRGAAALRAVIATILNDHVS 506

Query: 579  AFAHDFKHESLNTFMSPYGRKLCNGALYTDFRSHASTILALT-GDLEHVTQLISDLQPGD 637
               HDFKHES NTFMSP+GRKLC+GAL  D RSHA+ ILAL  G+L  VT+L++DLQ GD
Sbjct: 507  TKEHDFKHESFNTFMSPHGRKLCSGALLADLRSHAAAILALGDGELHDVTELLADLQAGD 566

Query: 638  RFDEDVKYMFEFE--DYNTLPNVLGGEDDETSTDTLKNREMLKEIHNGNFIPXXXXXXXX 695
            RFDEDVKY+FE+E  DYN L     GE+DE + +                          
Sbjct: 567  RFDEDVKYIFEYEYQDYNEL-----GEEDEQTNE-------------------------- 595

Query: 696  XXXXYLEQKLREMNCHRRCNCIFSDDEIKDTSISDKNYMGNSSSNGIESRIALLLNNNSS 755
                 LE+  +     RRCNCIF DD++    + D  Y                      
Sbjct: 596  -----LEELEKRSVKKRRCNCIFEDDKM----LEDYEYY--------------------- 625

Query: 756  RKGGNGTNSEDDEDVIRKNIENLTKDQLSSTEMESLRVTGFNKPHAVRTXXXXXXXXXXX 815
             + GN +  ED          NL  D+  +             P++VR            
Sbjct: 626  -EVGNESRRED---------MNLESDKSRTN------------PYSVRV----------- 652

Query: 816  XXXXXXIFDFDYNGKDWRDTPRGMNLYYNLNYEFIEKPNLDLVFQLTLKATNMKLDKDDS 875
                  IF+FDY+GKDWRD PRG NLYY+ +YEFI+ P L  V   TLKAT  KL  +DS
Sbjct: 653  ----NSIFEFDYSGKDWRDVPRGFNLYYSPSYEFIKNPKLGTVLHFTLKATTEKLSDEDS 708

Query: 876  NLLLRLVASSVKNEQDRIIFSDNQVSKEVKEIMEQNEDGVENEKLPHNKNRIENGNEKEI 935
             LLL+ VAS VK EQ+++I  +   +K                             E+++
Sbjct: 709  LLLLQSVASCVKLEQEKMILENYSNTKNC-------------------------STEEDL 743

Query: 936  ITEITPDDIYEIWCEESAFERMMQLNYEVTFRLMDEMLMCYGYRRVLIWFITHLELSHSV 995
              E+TPDD+YEIWCEESAFERM+ LN EV +RLMDEMLMC GYRRVL+WFITH+E++HS+
Sbjct: 744  DREVTPDDVYEIWCEESAFERMIYLNKEVAWRLMDEMLMCNGYRRVLMWFITHMEINHSL 803

Query: 996  IHYIFELVMGFRGTSEENG----------ATEDKHTNTKGXXXXXXXXXXXXXXXXXXXD 1045
            +HYIFELVMG RG  +++             +D  T+ KG                    
Sbjct: 804  VHYIFELVMGLRGQRDDSRNPGDDRLKSLLLQDMMTDKKGSE------------------ 845

Query: 1046 YSKIFDLQLPFSRQGNIELSEIERKMLIQEFLTNAAIHF--NERNNLKHNPXXXXXXXXX 1103
                   ++PFSRQG+I LSEIE KML+QEF TNAAI F  N+  N+  N          
Sbjct: 846  -------KVPFSRQGSIILSEIETKMLLQEFFTNAAIFFSTNDTANMSSN---------- 888

Query: 1104 XXXXXXXXXXXXXXLYSIGLMRLICFMIQAFLDNNKLKIEVDDSIFELQTLLMNWITIIP 1163
                          LY+IGL++LICFM++  ++N+K      +  FELQTLLMNWI IIP
Sbjct: 889  --------DSENVSLYAIGLVKLICFMVKTLMNNDKFDFSKSECTFELQTLLMNWIGIIP 940

Query: 1164 EAKKLFFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIENQTSKDNNDKMDESSKVDSN- 1222
            EA++LFF                             T++    + + +   +S   DSN 
Sbjct: 941  EAQELFF-----------------------------TLKANVGEPSMEGKSDSDGTDSNE 971

Query: 1223 ---SSFNKKLIELFPKMSHTNKEENTAIDTLKNYLKKFRFHQEVPIIGRKVIYEDGKILK 1279
               S +N KL+ L P  +++   EN AI+TL+++LKK+ F  +VP++GRKVIY+D KIL 
Sbjct: 972  GELSWYNSKLLALLPSPTNSGL-ENPAIETLRSFLKKYSFTNKVPVVGRKVIYKDDKILP 1030

Query: 1280 IP 1281
            IP
Sbjct: 1031 IP 1032

>Kpol_480.12 s480 complement(23340..26684) [3345 bp, 1114 aa] {ON}
            complement(23340..26684) [3345 nt, 1115 aa]
          Length = 1114

 Score =  669 bits (1725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/935 (41%), Positives = 541/935 (57%), Gaps = 142/935 (15%)

Query: 349  PDLMAHISKRHDILAK-ILNVGDNDKYYNSPLLHLQFKLLCALVDPLTQPTPNHKNIISI 407
            PDLM   +KRH  L+K I++     +  NSPLL +Q+K L AL+DPLTQP PN  ++ISI
Sbjct: 299  PDLMNETAKRHLALSKLIIDSKLEKQISNSPLLQIQYKTLLALIDPLTQPVPNDTHVISI 358

Query: 408  DLLFQLFLGFLKPELDRYSSAEDGTNWKFLVCFNMEKIINSVMKKLNCVDFNTLNSINNS 467
            DLL  +FLG +KP +D   + +DG +W+F +CFNM++II + +  LNC DF  L ++   
Sbjct: 359  DLLCNMFLGLMKPYIDNQLNNDDGVDWRFHICFNMQQIIIASLFVLNCNDFERLGTV--- 415

Query: 468  DESVHWRTQLHKWLPRGFNTQDLELLYMVNILATYTIYKLNEDLPIQLNPFLSSMVSHWK 527
            DES  WR+QLH WLPRG NTQ+LEL+YM  ILA YTIYKL  D P+  NPFLSS++S WK
Sbjct: 416  DESKDWRSQLHLWLPRGLNTQNLELVYMSCILAVYTIYKLYSDSPVHFNPFLSSLISLWK 475

Query: 528  NLSCTILLGLEIDRLEEENETFDTPLIVRATVRSSTALRSIIATILNEHVNAFAHDFKHE 587
            +L+C +L GL+IDRLEE N++FDTP+IVRAT+R + ALRSI+AT+LNE +    HDF HE
Sbjct: 476  SLTCVVLYGLQIDRLEESNQSFDTPIIVRATIRGAAALRSIVATVLNEQMELKRHDFIHE 535

Query: 588  SLNTFMSPYGRKLCNGALYTDFRSHASTILALTGDLEHVTQLISDLQPGDRFDEDVKYMF 647
            SLNTFMSP+GRKLC+GALY D +++ ++ILAL  + + VT L+S LQ GD+FDEDVKYMF
Sbjct: 536  SLNTFMSPHGRKLCDGALYADLKAYTASILALGAEFQEVTDLVSYLQAGDQFDEDVKYMF 595

Query: 648  EFE--DYNTLPNVLGGEDDETSTDTLKNREMLKEIHNGNFIPXXXXXXXXXXXXYLEQKL 705
            E+E  DYN        E  E S++  +  E +    N                       
Sbjct: 596  EYEYEDYN--------EIYEDSSNENEENEEIDYAFN----------------------- 624

Query: 706  REMNCHRRCNCIFSDDEIKDTSISDKNYMGNSSSNGIESRIALLLNNNSSRKGGNGTNSE 765
                  RRCNCIFSDD + +    D+       ++ I+  IA                  
Sbjct: 625  -----KRRCNCIFSDDNLIEEEEDDEEESDVEKTSDIDGEIA------------------ 661

Query: 766  DDEDVIRKNIENLTKDQLSSTEMESLRVTGFNKPHAVRTXXXXXXXXXXXXXXXXXIFDF 825
                   K+ E+  K    + E +S      +KPHAVR+                  F+F
Sbjct: 662  ------TKSKEHTEK----TIESDSGLSNQLSKPHAVRSKSN---------------FEF 696

Query: 826  DYNGKDWRDTPRGMNLYYNLNYEFIEKPNLDLVFQLTLKATNMKLDKDDSNLLLRLVASS 885
            DY+GKDWRD PR  NLYY+  Y FI++P+L+ VF LTLKAT+ KL K+++ LLL  VAS+
Sbjct: 697  DYSGKDWRDIPREYNLYYSPFYNFIDRPDLNTVFVLTLKATSEKLTKEEAALLLCSVAST 756

Query: 886  VKNEQDRIIFSDNQVSKEVKEIMEQNEDGVENEKLPHNKNRIENGNEKEIITEITPDDIY 945
            VKNEQDR+IF +         ++EQ++    +E   H   +           E TPDDIY
Sbjct: 757  VKNEQDRMIFGN---------LLEQDKSSTADE---HEDTK----------KEATPDDIY 794

Query: 946  EIWCEESAFERMMQLNYEVTFRLMDEMLMCYGYRRVLIWFITHLELSHSVIHYIFELVMG 1005
            EIWCEESAFER++  N ++ ++LMDEMLMC GYRRVLIWFITH+ELSHS+I YIF+L+MG
Sbjct: 795  EIWCEESAFERILHFNPDLAWKLMDEMLMCSGYRRVLIWFITHMELSHSLIIYIFDLMMG 854

Query: 1006 FRGTSEENGATEDKHTNTKGXXXXXXXXXXXXXXXXXXXDYSKIFDLQLPFSRQGNIELS 1065
             RG ++ + +   K T                       + S      L FSR G+++LS
Sbjct: 855  SRGINKTDTSKNVKST-------------------FITENISDSNSNSLKFSRMGHLKLS 895

Query: 1066 EIERKMLIQEFLTNAAIHFNERNNLKHNPXXXXXXXXXXXXXXXXXXXXXXXLYSIGLMR 1125
            E+E +M++QE  TNAAI+F+++   K N                        +YS+GLM+
Sbjct: 896  ELETRMILQELFTNAAIYFSDKAR-KSNQSILTPDYSTEEEEFDEENEGGYSIYSVGLMK 954

Query: 1126 LICFMIQAFLDNNKLKIEVDDSIFELQTLLMNWITIIPEAKKLFFXXXXXXXXXXXXXXX 1185
            LIC M+   ++N+K  +   D +FELQTLLM WI+I+PEAK+L F               
Sbjct: 955  LICIMVSKLIENSKFNVNESDCVFELQTLLMGWISILPEAKELSF-----------KINS 1003

Query: 1186 XXXXXXXXXXXXXXTIENQTSKDNNDKMDESSKVDSNSSFNKKLIELFPKMSHTNKEENT 1245
                          +IE  ++K +   +D++S+   +  +N+ L++L P  +   KEEN 
Sbjct: 1004 SLSEFSHVENSELASIEGASTKSHKQLVDKNSE---SYKYNEILLKLIPP-TFGGKEENI 1059

Query: 1246 AIDTLKNYLKKFRFHQEVPIIGRKVIYEDGKILKI 1280
              +T ++Y+K + F  EV  + RK+I++  +IL +
Sbjct: 1060 IFNTFRDYIKDYSFDSEVSTMCRKIIHQSDEILPL 1094

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/177 (29%), Positives = 79/177 (44%), Gaps = 46/177 (25%)

Query: 6   KLSDLRDSLPIDYKPNIQLLETLIDYAK------PDSEYLDSLLFESLILALFTTNCGLS 59
           KL  + + L  +YKP+I  LE L+           D E   S + E  ++ALFTT  G+S
Sbjct: 9   KLKRIAEILSPNYKPSIYQLEQLLRDENQVLDLLADIEVKGSFITEVTVIALFTTRPGIS 68

Query: 60  VLNIISTLKSFTNDKQKKNNLVPTTATAAVDSKHNKDENLDTTVIRNATATRNIIAKPNI 119
           +LN +                   T    +D + NKD N                  PN 
Sbjct: 69  LLNCL-------------------TDNFGID-EDNKDFN------------------PNS 90

Query: 120 LKKQAHHPKLLEKWRNDKITLLKFTKFILKNSNFPLNYNAFFDPVMKLPLEFLLLND 176
           L  +   P+L  KW +D++ L+KF +FI+ N N  +N+    D + KL L+FL+ N+
Sbjct: 91  LLPRM--PQLALKWMHDELILIKFLRFIIDNRNMDINFKNKNDILSKLQLDFLIKNE 145

>SAKL0F02596g Chr6 complement(221983..225381) [3399 bp, 1132 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily-conserved CCR4-
            NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1132

 Score =  657 bits (1694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/955 (40%), Positives = 529/955 (55%), Gaps = 145/955 (15%)

Query: 330  EHTLSFNLFENNINHGILH-PDLMAHISKRHDILAKILNVGDNDKYYNSPLLHLQFKLLC 388
            E   SF L E+    G L  P++ AH  +RHD L K+L + D+     +PLL   F   C
Sbjct: 284  EQVYSFELNED----GTLEIPNVFAHTKRRHDALYKVLGLNDDP----TPLLKSCFLTFC 335

Query: 389  ALVDPLTQPTPNHKNIISIDLLFQLFLGFLKPELDR-YSSAEDGTNWKFLVCFNMEKIIN 447
             L DP+TQP PN K+I+S+DLL  +FLG + PE+        +   W   +CFN++KIIN
Sbjct: 336  CLADPVTQPPPNDKHIVSLDLLSDMFLGLMYPEITADLVQPLNKDTWTLHICFNLQKIIN 395

Query: 448  SVMKKLNCVDFNTLNSINNSDESVHWRTQLHKWLPRGFNTQDLELLYMVNILATYTIYKL 507
            + + +LNC DF  LN INNSD+SV WR  L+KWLP+G NTQDLEL+YMV+ILATYTIYKL
Sbjct: 396  ATLSRLNCDDFTRLNEINNSDDSVDWRKNLYKWLPQGLNTQDLELIYMVDILATYTIYKL 455

Query: 508  NEDLPIQLNPFLSSMVSHWKNLSCTILLGLEIDRLEEENETFDTPLIVRATVRSSTALRS 567
              + PIQ+NPFL  M+S WKNL+C +LLGLEIDRLEEE ETF+TP++VRAT+R ++ALRS
Sbjct: 456  YSNRPIQMNPFLLPMISLWKNLTCVVLLGLEIDRLEEEQETFNTPVMVRATIRGASALRS 515

Query: 568  IIATILNEHVNAFAHDFKHESLNTFMSPYGRKLCNGALYTDFRSHASTILALTGDLEHVT 627
            ++ATI+N H    +HDFKHE +N FMSP+GRKLCNGALY D RSHA+T+LAL  +LE +T
Sbjct: 516  VLATIINGHARYKSHDFKHEPINLFMSPHGRKLCNGALYADLRSHAATMLALGIELETLT 575

Query: 628  QLISDLQPGDRFDEDVKYMF--EFEDYNTLPNVLGGEDDETSTDTLKNREMLKEIHNGNF 685
             L+SDLQPGDRFDEDVKYMF  EF+DYN +   L  +D+    + +++RE +KE+     
Sbjct: 576  DLLSDLQPGDRFDEDVKYMFDYEFDDYNEVDTELMADDE---LEDIESRERIKEVR---- 628

Query: 686  IPXXXXXXXXXXXXYLEQKLREMNCHRRCNCIFSDDEIKDTSISDKNYMGNSSSNGIESR 745
                                     ++RC+C+F DD                        
Sbjct: 629  -----------------------GYYKRCHCVFDDD------------------------ 641

Query: 746  IALLLNNNSSRKGGNGTNSEDDEDVIRKNIENLTKDQLSSTEMESLRVTGFNKPHAVRTX 805
             +L+  N                   +K++++  +DQL   +   +  T  +KP AVR+ 
Sbjct: 642  -SLVPENEDGGGEEGDQED------TKKHLQDSHEDQLPPQQNVVMSTT--SKPLAVRSR 692

Query: 806  XXXXXXXXXXXXXXXXIFDFDYNGKDWRDTPRGMNLYYNLNYEFIEKPNLDLVFQLTLKA 865
                              +FD+NG+DWRD PRG+N YY   Y F+ K + D+V  L  +A
Sbjct: 693  DT---------------VEFDFNGRDWRDIPRGLNFYYTDAYIFVTKLHADVVHYLMKEA 737

Query: 866  TNMKLDKDDSNLLLRLVASSVKNEQDRIIFSDNQVSKEVKEIMEQNEDGVENEKLPHNKN 925
            T  KL+++ ++ +LR +A+ VK EQ+  I         V+  +  N+DG ++     N  
Sbjct: 738  TRKKLERNHASFILRSIATCVKLEQEEAI---------VRRAL-GNQDGDKSS----NAT 783

Query: 926  RIENGNEKEIITEITPDDIYEIWCEESAFERMMQLNYEVTFRLMDEMLMCYGYRRVLIWF 985
             I+  N      E+T D IYE WCE+S FE+MM  N ++ +R+MDEMLMC GYRRVLIWF
Sbjct: 784  TIKTEN------ELTSDFIYEKWCEDSLFEKMMYHNSDLVWRMMDEMLMCSGYRRVLIWF 837

Query: 986  ITHLELSHSVIHYIFELVMGFRGTSEENGATEDKHTNTKGXXXXXXXXXXXXXXXXXXXD 1045
            ITHLE++HSVIHYIFELVMG RG    N   ED    +K                     
Sbjct: 838  ITHLEINHSVIHYIFELVMGLRG----NITYEDDEEKSKNLDALDGLAQG---------- 883

Query: 1046 YSKIFDLQLPFSRQGNIELSEIERKMLIQEFLTNAAIHFNERNNLKHNPXXXXXXXXXXX 1105
             S   +L LPFSRQG I LS IE  ML+QEF TNAAI F+ +     +            
Sbjct: 884  -SSTSELTLPFSRQGPIILSSIEVNMLLQEFFTNAAIFFSSKLRESFDSENEELDENFED 942

Query: 1106 XXXXXXXXXXXXLYSIGLMRLICFMIQAFLDNNKLKIEVDDSIFELQTLLMNWITIIPEA 1165
                         + IGLM+L+CFM+   +   K      + IFELQTLLMNWI I+PEA
Sbjct: 943  EDEFSVPP-----HVIGLMKLVCFMVDTLMQKKKFDFTDSEYIFELQTLLMNWIGIVPEA 997

Query: 1166 KKLFFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIENQTSKDNNDKMDESSKVDSNSSF 1225
            + LFF                             T   ++ KD+ D  D     D+ S  
Sbjct: 998  RDLFF------------KLKSQIVATSQDTQEQGTPVKESEKDDIDAPDTLEMNDTMSEH 1045

Query: 1226 NKKLIELFPKMSHTNKEENTAIDTLKNYLKKFRFHQEVPIIGRKVIYEDGKILKI 1280
            NKKL+ L P  + TN  E  A+  L+ ++ K+    +  + GRK+IY+D +I+ +
Sbjct: 1046 NKKLMMLIPPGT-TN--ERNALTALRGFIGKYSLTNKTAVFGRKIIYQDDEIMGM 1097

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 62/220 (28%), Positives = 94/220 (42%), Gaps = 58/220 (26%)

Query: 37  EYLDSLLFESLILALFTTNCGLSVLNIISTLKSFTNDKQKKNNLVPTTATAAVDSKHNKD 96
           E+ D+++ E LIL+LF T  G S+L +   L     D            ++    +H++ 
Sbjct: 43  EFPDAVVQEMLILSLFVTLPGHSILELYYDLSCGRVD-----------LSSYKQWQHSQV 91

Query: 97  ENLDTTVIRNATATRNIIAKPNILKKQAHHPKLLEKWRNDKITLLKFTKFILKNSNFPLN 156
            + D                         + KL+++W    + LL+FT  +L+N N PL 
Sbjct: 92  RSTDG------------------------YKKLVKRWSTSTLVLLRFTDLLLQNKNVPLE 127

Query: 157 YNAFFDPVMKLPLEFLLLNDRFCSNDNNATSQKLFSIYNNTLLMDKNYNLLLDYLHVSTP 216
           Y        KL L FLL  D+                 N  L++D +YNLLLDYL  + P
Sbjct: 128 YTKHNTAEYKLSLIFLL--DK----------------QNEFLILDPDYNLLLDYLLHAKP 169

Query: 217 LLISLLHTNLDPLLFNNIISSYNKSFELTNDNKC-LWYDF 255
           ++ S+L  N+ P L   ++  YNK  E    N C  WY F
Sbjct: 170 MIESILLGNI-PGLLKALVYQYNKLPEF---NGCHTWYTF 205

>AFR316W Chr6 (1008188..1011763) [3576 bp, 1191 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YGR134W (CAF130)
          Length = 1191

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/1324 (33%), Positives = 645/1324 (48%), Gaps = 252/1324 (19%)

Query: 18   YKPNIQ-LLETLIDYAKPDSEYLDSLLFESLILALFTTNCGLSVLNIISTLKSFTNDKQK 76
            YKP+IQ LLE  +    P   + + ++ E +++ LF T  G S+L+++            
Sbjct: 25   YKPSIQSLLELNVQEGDP---HFELMIVEKVVVTLFMTRGGNSILHLLY----------- 70

Query: 77   KNNLVPTTATAAVDSKHNKDENLDTTVIRNATATRNIIAKPNILKKQAHHPKLLEKWRND 136
                                 +L    I+ +   +++  + N+ + +  +    ++W + 
Sbjct: 71   ---------------------DLSCGRIKLSEYRQSLKVRSNVHQWKTCY----KEWGSR 105

Query: 137  KITLLKFTKFILKNSNFPLNYNAFFDPVMKLPLEFLLLNDRFCSNDNNATSQKLFSIYNN 196
            + TL +F  F L+N +  L+Y  +   + KLPL+FLL                      +
Sbjct: 106  RDTLSRFLDFCLRNEDCALDYTEYGRVMRKLPLQFLLPAGL------------------H 147

Query: 197  TLLMDKNYNLLLDYLHVSTPLLISLLHTNLDPLLFNNIISSYNKSFELTNDNKCLWYDFI 256
              ++D+ YNLLLDY+ +++ L+   L     P L   +I  YN+ FE   +    WY   
Sbjct: 148  AYVLDEGYNLLLDYI-INSRLMWEELLIQGIPRLLPELIEDYNRVFEF--NGYYTWYGGA 204

Query: 257  DSKDTTNFGTITNCIDIINNFLEIFDMHKNF--TLNAEXXXXXXXXXXXXXXXXXMHNEN 314
             S       T      ++    +   + K     LNA                    NE 
Sbjct: 205  PSGAGAANSTRELHTKVLYALFDKLTVAKELLPRLNATVWSHSWPPMYHKHGINEFSNEE 264

Query: 315  EGA-DLNLLMDENSMGEHTLSFN----LFENNINHGILHPDLMAHISKRHDILAKILNVG 369
            E   D +  ++ +S  +H  S       FE N +  +  P++  H  +RH+ L +IL + 
Sbjct: 265  EDLYDFDSELEGDSWPQHKSSAKEQVYTFELNRDGSLEFPNVFLHTRRRHETLYRILGLP 324

Query: 370  DNDKYYNSPLLHLQFKLLCALVDPLTQPTPNHKNIISIDLLFQLFLGFLKPELDRYSSAE 429
            + +     PLL  QF  LCALVDP+TQP P  K+IISIDL++Q+FLG +   L+     +
Sbjct: 325  NRE----CPLLRAQFMTLCALVDPITQPPPTEKHIISIDLIYQMFLGSISSLLESSLRGQ 380

Query: 430  DGTNWKFLVCFNMEKIINSVMKKLNCVDFNTLNSINNSDESVHWRTQLHKWLPRGFNTQD 489
            D   W+F VC N++KII + MK+LNC D   LNSINNSDE+VHW   + KW PRG NTQD
Sbjct: 381  D---WRFHVCHNLQKIILATMKRLNCHDSEVLNSINNSDETVHWNVNIGKWTPRGLNTQD 437

Query: 490  LELLYMVNILATYTIYKLNEDLPIQLNPFLSSMVSHWKNLSCTILLGLEIDRLEEENETF 549
            LELLYMV++L  YTIY+L  DLP+Q+NPFL      WKNL+  +LLGLEIDR EE+ ETF
Sbjct: 438  LELLYMVDMLGIYTIYQLYSDLPVQMNPFLPLSFHLWKNLTNVLLLGLEIDRFEEDRETF 497

Query: 550  DTPLIVRATVRSSTALRSIIATILNEHVNAFAHDFKHESLNTFMSPYGRKLCNGALYTDF 609
             TP+IVRAT+R S ALRS++AT++N H +   HDFKHE +N FMSP+GRKLC GALY D 
Sbjct: 498  STPIIVRATIRGSAALRSVVATMINSHFSIKEHDFKHEPINLFMSPHGRKLCQGALYADV 557

Query: 610  RSHASTILALTGDLEHVTQLISDLQPGDRFDEDVKYMF--EFEDYNTL-PNVLGGEDDET 666
            RSHA+ +LAL  +L  VT L+SDLQPGDRFD+DVKYMF  E++DYN + P  L  E++E 
Sbjct: 558  RSHAAAMLALGIELNDVTDLLSDLQPGDRFDDDVKYMFDYEYDDYNAIDPEQLYDENEE- 616

Query: 667  STDTLKNREMLKEIHNGNFIPXXXXXXXXXXXXYLEQKLREM-NCHRRCNCIFSDDEIKD 725
                  + E L+EI                      +++++M   ++RC+C+F DDE   
Sbjct: 617  ------DLERLEEIQQ-------------------RERIKDMRGYYKRCHCVFDDDE--- 648

Query: 726  TSISDKNYMGNSSSNGIESRIALLLNNNSSRKGGNGTNSEDDEDVIRKNIENLTKDQLSS 785
                                   LL++      G  T++   E V    +  +T    S 
Sbjct: 649  -----------------------LLSDEEGTDTGEHTDNHITETVQSAPLNLVTGVSTSG 685

Query: 786  TEMESLRVTGFNKPHAVRTXXXXXXXXXXXXXXXXXIFDFDYNGKDWRDTPRGMNLYYNL 845
             +  ++R   +                           +FD+NGKDWRD PRGMN YY  
Sbjct: 686  PQKVAVRSRDY--------------------------VEFDFNGKDWRDIPRGMNFYYVE 719

Query: 846  NYEFIEKPNLDLVFQLTLKATNMKLDKDDSNLLLRLVASSVKNEQDRIIFSDNQVSKEVK 905
            +Y F+ K + D++  L  +AT+ KL+ + S+ +LR VA+ +K EQ++ +  D     +  
Sbjct: 720  DYVFVNKLHADVLHYLMKEATSKKLESNQSSFILRSVATCIKLEQEKTMVHDAIFKSK-- 777

Query: 906  EIMEQNEDGVENEKLPHNKNRIENGNEKEIITEITPDDIYEIWCEESAFERMMQLNYEVT 965
                        +K P + +  E  N       +T D IYE WCE++ FE+MM  N ++ 
Sbjct: 778  ------------DKSPLSASGSEGSN------GLTSDFIYEKWCEDALFEKMMYYNNDLV 819

Query: 966  FRLMDEMLMCYGYRRVLIWFITHLELSHSVIHYIFELVMGFRGTSEENGATEDKHTNTKG 1025
            +R+MDEMLMC GYRRVLIWFITHLELSHSVIHYIFELVMG RG        E+   N   
Sbjct: 820  WRMMDEMLMCSGYRRVLIWFITHLELSHSVIHYIFELVMGMRGNVAYKDLEEEYIINRNL 879

Query: 1026 XXXXXXXXXXXXXXXXXXXDYSKIFDLQLPFSRQGNIELSEIERKMLIQEFLTNAAIHFN 1085
                                 S      +PFSRQG I LS IE  ML+QEF  NAAI+F+
Sbjct: 880  DLLDSFSLG------------SSCIPASIPFSRQGPIVLSTIEVNMLLQEFFINAAIYFS 927

Query: 1086 ----ERNNLKH----NPXXXXXXXXXXXXXXXXXXXXXXXLYSIGLMRLICFMIQAFLDN 1137
                +  + +H     P                        + +GLM+L+CFM+   ++ 
Sbjct: 928  NYLRDTASYEHLDVEQPEEQTEIEEGEAEDEIADERLTASSHVLGLMKLLCFMVDMLIEK 987

Query: 1138 NKLKIEVDDSIFELQTLLMNWITIIPEAKKLFFXXXXXXXXXXXXXXXXXXXXXXXXXXX 1197
             KL     + +FELQTLLMNWI ++PEA+ LFF                           
Sbjct: 988  KKLDFTDSEYLFELQTLLMNWIGLVPEARTLFFKLKSTLLNSSALNGSALSH-------- 1039

Query: 1198 XXTIENQTSKDNND------------KMDESSKVD------------------------- 1220
               +E + + ++ND             MD+S+ +D                         
Sbjct: 1040 ---LEGELASNDNDDSEPVDTAEDAGPMDKSNGLDGLPLCDIGALTNGQPTSAANSAPNG 1096

Query: 1221 ---SNSSF-NKKLIELFPKMSHTNKEENTAIDTLKNYLKKFRFHQEVPIIGRKVIYEDGK 1276
               SN S+ N+ LI+L P  S    +EN A+  L++++ K     +  I GR+VIY+D  
Sbjct: 1097 MSESNISYCNQMLIKLLPPHS---ADENAAVTALRSFIAKHPLTTKTAIFGRRVIYQDNA 1153

Query: 1277 ILKI 1280
            I+ +
Sbjct: 1154 IMGL 1157

>Ecym_1232 Chr1 complement(477523..481137) [3615 bp, 1204 aa] {ON}
            similar to Ashbya gossypii AFR316W
          Length = 1204

 Score =  626 bits (1615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 417/1186 (35%), Positives = 598/1186 (50%), Gaps = 216/1186 (18%)

Query: 18   YKPNIQLLETLIDYA-KPDSEYLDSLLFESLILALFTTNCGLSVLNIISTLKSFTNDKQK 76
            YKP+I+   +L+++      E+ D+L+ E +++ LF T  G S+L+++  L         
Sbjct: 25   YKPDIR---SLVEFRLNVGDEHFDALITEKVVVTLFMTRSGNSMLHMLYDLCC------G 75

Query: 77   KNNLVPTTATAAVDSKHNKDENLDTTVIRNATATRNIIAKPNILKKQAHHPKLLEKWRND 136
            +  L     +  V S H                              ++     + W + 
Sbjct: 76   RIKLTEYKQSLKVRSNH------------------------------SYWKSCYKDWGSR 105

Query: 137  KITLLKFTKFILKNSNFPLNYNAFFDPVMKLPLEFLLLNDRFCSNDNNATSQKLFSIYNN 196
            +  L +F  F L+N N  L+Y  +     KLPL+FLL              + L      
Sbjct: 106  RDILSEFLDFCLRNENCALDYIEYASATRKLPLQFLL-------------PEPL-----R 147

Query: 197  TLLMDKNYNLLLDYLHVSTPLLISLLHTNLDPLLFNNIISSYNKSFELTNDNKCLWYDFI 256
              L+D  YNLLLDY+  S P+   LL   + P     ++  YN+S+E   +   +WY  +
Sbjct: 148  PYLIDDEYNLLLDYMIQSRPMWEMLLTQGI-PKFLPELVDEYNRSYEF--NGYYVWYGNV 204

Query: 257  DSKD-----------TTNFGTITNCIDIINNFLEIFDM----HKNFTLNAEXXXXXXXXX 301
                           T  F T+ + + +    L   ++    H       +         
Sbjct: 205  TCSQVQVQSSTKELYTKFFYTLFDKLTVTKELLPKLNVALWSHSWPASYTKQTLLDLSND 264

Query: 302  XXXXXXXXMHNENEGADLNLLMDENSMGEHTLSFNLFENNINHGILHPDLMAHISKRHDI 361
                    + +EN+      L    S  E   +F+L   N +  +  P++  H  KRH+I
Sbjct: 265  DDDHYDQDVDSENDHWPQQKL----SSREQVFTFDL---NRDGTLEFPNVFLHAKKRHEI 317

Query: 362  LAKILNVGDNDKYYNSPLLHLQFKLLCALVDPLTQPTPNHKNIISIDLLFQLFLGFLKPE 421
            L ++L + D +     PLL  QF  L ALVDP+TQP P   +IISIDL+FQ+FLG     
Sbjct: 318  LYRVLGLPDAE----GPLLKAQFMTLAALVDPITQPPPTEDHIISIDLIFQMFLGSTSNL 373

Query: 422  LDRYSSAEDGTNWKFLVCFNMEKIINSVMKKLNCVDFNTLNSINNSDESVHWRTQLHKWL 481
            ++    +  G +W+F VC+NM+KI+ + MK+LNC D + LN++NNSDESVHW   L KW 
Sbjct: 374  IENMLISR-GRDWRFHVCYNMQKIVLATMKRLNCHDGDVLNTVNNSDESVHWNVNLDKWT 432

Query: 482  PRGFNTQDLELLYMVNILATYTIYKLNEDLPIQLNPFLSSMVSHWKNLSCTILLGLEIDR 541
            PRG NTQDLELLYMV++L+ Y +Y+L   LP+Q+NPFL   +  WKNL+  +L GLEIDR
Sbjct: 433  PRGLNTQDLELLYMVDMLSIYAMYRLYSYLPVQMNPFLPLALHLWKNLTNVLLRGLEIDR 492

Query: 542  LEEENETFDTPLIVRATVRSSTALRSIIATILNEHVNAFAHDFKHESLNTFMSPYGRKLC 601
             EE+ ETF+TP+IVRA +R + ALRS++AT++N+H ++  HDFKHE +N FMSP+GRKLC
Sbjct: 493  FEEDRETFNTPIIVRAAIRGTAALRSVVATMINDHFSSKEHDFKHEPINLFMSPHGRKLC 552

Query: 602  NGALYTDFRSHASTILALTGDLEHVTQLISDLQPGDRFDEDVKYMF--EFEDYNTL-PNV 658
            +GALY D RSHA+ +L+L  DL  VT L+SDLQPGDRFD+DVKYMF  E++DYN + P  
Sbjct: 553  HGALYADVRSHAAAMLSLGIDLNDVTDLLSDLQPGDRFDDDVKYMFDYEYDDYNAIDPEQ 612

Query: 659  LGGEDDETSTDTLKNREMLKEIHNGNFIPXXXXXXXXXXXXYLEQKLREM-NCHRRCNCI 717
            L  E++E       + E L+EI                      +++++M   ++RC+C+
Sbjct: 613  LYDENEE-------DLERLEEIQQ-------------------RERIKDMRGYYKRCHCV 646

Query: 718  FSDDEIKDTSISDKNYMGNSSSNGIESRIALLLNNNSSRKGGNGTNSEDDEDVIRKNIEN 777
            F DDE+    +SD+                         + G   +S  D      N  N
Sbjct: 647  FDDDEL----LSDE-------------------------EEGETASSNIDRPKYSHNSLN 677

Query: 778  LTKDQLSSTEMESLRVTGFNKPH----AVRTXXXXXXXXXXXXXXXXXIFDFDYNGKDWR 833
            L    LS+T         FN P+    A+R+                   DFD+NGKDWR
Sbjct: 678  LPSSMLSTT---------FNGPNSQKFAIRSRDG---------------VDFDFNGKDWR 713

Query: 834  DTPRGMNLYYNLNYEFIEKPNLDLVFQLTLKATNMKLDKDDSNLLLRLVASSVKNEQDRI 893
            D PRG+N YY  +Y F+ K + D+V+ L  +AT  K++ + ++ +LR +A+ +K EQ++ 
Sbjct: 714  DIPRGLNFYYTEHYVFVNKLHADVVYYLMKEATTKKMEPNHASFILRSIATCIKLEQEKS 773

Query: 894  IFSDNQVSKEVKEIMEQNEDGVENEKLPHNKNRIENGNEKEIITEITPDDIYEIWCEESA 953
            +         V ++M    D          K    N N    + E+T D IYE WCEES 
Sbjct: 774  M---------VYDVMNGRTD----------KGSSSNSNSDR-VNELTSDFIYEKWCEESL 813

Query: 954  FERMMQLNYEVTFRLMDEMLMCYGYRRVLIWFITHLELSHSVIHYIFELVMGFRGTSEEN 1013
            F +MM  N ++ +R+MDEMLMC GYRRVLIWFITHLE+SHS+IHYIFELVMG RG  + +
Sbjct: 814  FTKMMYYNNDLVWRMMDEMLMCSGYRRVLIWFITHLEISHSLIHYIFELVMGMRGNVDYD 873

Query: 1014 GATEDKHTNTKGXXXXXXXXXXXXXXXXXXXDYSKIFDLQLPFSRQGNIELSEIERKMLI 1073
               ED   N                        S    +++PFSRQG I LS IE  ML+
Sbjct: 874  EEAEDDIKNRN------------LDILDSLSLGSSSVTIKIPFSRQGPIILSIIEINMLL 921

Query: 1074 QEFLTNAAIHF---------NERNNLKHNPXXXXXXXXXXXXXXXXXXXXXXXLYSIGLM 1124
             EF  NA I+F         +E   L  +                         + IGLM
Sbjct: 922  LEFFINATIYFSDNMKNLNSDEELPLSQSENEGSDDLEYGLCEDGDKDTLGVSPHVIGLM 981

Query: 1125 RLICFMIQAFLDNNKLKIEVDDSIFELQTLLMNWITIIPEAKKLFF 1170
            +L+CFM+   ++  K      + IFELQTLLMNWI IIPEA+ LFF
Sbjct: 982  KLVCFMVDMLMEKKKFDFTDSEYIFELQTLLMNWIGIIPEARNLFF 1027

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 41/68 (60%), Gaps = 6/68 (8%)

Query: 1216 SSKVDSN---SSFNKKLIELFPKMSHTNKEENTAIDTLKNYLKKFRFHQEVPIIGRKVIY 1272
            S ++D+N   S +NK LIEL P   H + E NTA+  L++++ K     +  + GR+VIY
Sbjct: 1107 SPEIDNNNNLSKYNKMLIELLPL--HVDNE-NTAVTALRSFITKHSLTNKTAVFGRRVIY 1163

Query: 1273 EDGKILKI 1280
            +D  I+ +
Sbjct: 1164 QDHAIMGL 1171

>KLTH0G02442g Chr7 complement(189819..193160) [3342 bp, 1113 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily- conserved
            CCR4- NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1113

 Score =  623 bits (1607), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/1286 (33%), Positives = 629/1286 (48%), Gaps = 244/1286 (18%)

Query: 13   SLPIDYKPNIQLLETLIDYAKPDSEYLDSLLFESLILALFTTNCGLSVLNIISTLKSFTN 72
            +LP   +PN      +   ++    + D    E L+L LFTT  GLS L +   L     
Sbjct: 19   ALPAPAEPNGTPGSPVGQPSREPRAFTDIDAQEKLVLGLFTTRPGLSTLRLYYELSC--- 75

Query: 73   DKQKKNNLVPTTATAAVDSKHNKDENLDTTVIRNATATRNIIAKPNILKKQAHHPKLLEK 132
                + NL+          ++ K +                 +KP  +   A+  +++++
Sbjct: 76   ---GRVNLL----------RYKKWQQ----------------SKPQRVSDAAYK-RMVKR 105

Query: 133  WRNDKITLLKFTKFILKNSNFPLNYNAFFDPVMKLPLEFLLLNDRFCSNDNNATSQKLFS 192
            W +    +       L+N N+ L+Y +F+ P  KL + FLL  +                
Sbjct: 106  WTSSTEHVGLLMDHFLRNDNWALDYASFYSPAHKLSVAFLLDPE---------------- 149

Query: 193  IYNNTLLMDKNYNLLLDYLHVSTPLLISLLHTNLDPLLFNNIISSYNKSFELTNDNKCLW 252
                 L++D  YNLLLD+      L+  LL+    P L       + + F+L    + +W
Sbjct: 150  --TEVLVIDDEYNLLLDFALQCRALVEQLLNQIDLPSLLAKCAYGHGRLFQLCG--RYVW 205

Query: 253  YDFIDSKDTTNFGTITNCIDIINNFLEIFDMHKNFTLNAEXXXXXXXXXXXXXXXXXMH- 311
            Y F   +            DI   +L +  +    T   +                  H 
Sbjct: 206  YTFSAEQ-------FDEAQDICYKYLSV--LTDKLTAQQDLIPQIQPLFEIISSSKASHW 256

Query: 312  -------NENEGADLNLLMDEN-----SMGEHTLSFNLFENNINHGILHP-DLMAHISKR 358
                    EN  +D N   D       S  E   SF+L ++    G L   ++     +R
Sbjct: 257  VYGDGLFTENPESDSNSDSDHWPQKRLSAQERVYSFDLKDD----GTLEASNVFNRTRRR 312

Query: 359  HDILAKILNVGDNDKYYNSPLLHLQFKLLCALVDPLTQPTPNHKNIISIDLLFQLFLGFL 418
            H  L ++LN+    K   +PLL  QF  LCALVDP+TQPTPN  +I+SIDLL  +FLG L
Sbjct: 313  HQALYQVLNL---QKQNTAPLLSSQFFTLCALVDPVTQPTPNDSHIVSIDLLSDMFLGLL 369

Query: 419  KPELDRYSSAEDGTNWKFLVCFNMEKIINSVMKKLNCVDFNTLNSINNSDESVHWRTQLH 478
              E++     E   +W+F VCFN++KI+ + + +LNC DF  LNS+NNSD+S+ WR  LH
Sbjct: 370  YSEIN-----ELHIDWRFHVCFNLQKIVQATLPRLNCHDFQRLNSVNNSDDSIDWRRNLH 424

Query: 479  KWLPRGFNTQDLELLYMVNILATYTIYKLNEDLPIQLNPFLSSMVSHWKNLSCTILLGLE 538
            KWLP+G NTQDLEL+YM++ILA Y I+KL  DLP Q+NPFL+SM+S WKNL+  +LLGLE
Sbjct: 425  KWLPQGLNTQDLELIYMIDILAIYIIHKLYRDLPAQMNPFLASMISLWKNLTFVVLLGLE 484

Query: 539  IDRLEEENETFDTPLIVRATVRSSTALRSIIATILNEHVNAFAHDFKHESLNTFMSPYGR 598
            IDR EEE ETF TP++VRA +R S+ALRS++ATILN HV    HDF+HE +N FMSP+GR
Sbjct: 485  IDRFEEEQETFSTPVLVRAAIRGSSALRSVVATILNGHVEYKRHDFQHEPINIFMSPHGR 544

Query: 599  KLCNGALYTDFRSHASTILALTGDLEHVTQLISDLQPGDRFDEDVKYMFEFEDYNTLPNV 658
            KLC+GALYTD RSHA+ +LAL  +LE VT L+SDLQPGDRFDEDVKYMF++E Y+    V
Sbjct: 545  KLCHGALYTDVRSHAAAMLALGIELEDVTNLLSDLQPGDRFDEDVKYMFDYE-YDNYNEV 603

Query: 659  LGGEDDETSTDTLKNREMLKEIHNGNFIPXXXXXXXXXXXXYLEQKLREMNCHRRCNCIF 718
               E DE   + +++RE +KE+                              ++RC+C F
Sbjct: 604  DTEELDEDELEDVESRERIKEMR---------------------------AYYKRCHCQF 636

Query: 719  SDDEIKDTSISDKNYMGNSSSNGIESRIALLLNNNSSRKGGNGTNSEDDEDVIRKNIE-- 776
             DDE+                                         ED+ED  R +    
Sbjct: 637  DDDELL---------------------------------------PEDEEDG-RPDASPY 656

Query: 777  NLTKDQLSSTEMESLRVTGFNKPHAVRTXXXXXXXXXXXXXXXXXIFDFDYNGKDWRDTP 836
             +T+D   +    +++++  +KP A+R+                   +FD+NG+DWR  P
Sbjct: 657  RVTRD---APPDNNVKLSNTSKPMALRSQKDS--------------VEFDFNGRDWRGIP 699

Query: 837  RGMNLYYNLNYEFIEKPNLDLVFQLTLKATNMKLDKDDSNLLLRLVASSVKNEQDRIIFS 896
            RG+N Y+N NYEF +  +      L   A   KL  ++   LLR++A+ V  EQ+  +  
Sbjct: 700  RGLNFYFNENYEFEKHLSSGQAHSLMCNAAEKKLPLEEGTQLLRVIATCVAKEQELTVLR 759

Query: 897  DNQVSKEVKEIMEQNEDGVENEKLPHNKNRIENGNEKEIITEITPDDIYEIWCEESAFER 956
               +  E  E         EN     +   + +G+       +T D +YE WCE S FE+
Sbjct: 760  SALLLGETPE--------SEN-----HSTLVADGD-------LTTDFVYEKWCENSMFEK 799

Query: 957  MMQLNYEVTFRLMDEMLMCYGYRRVLIWFITHLELSHSVIHYIFELVMGFRGTSEENGAT 1016
            ++  N  + +R+MDEMLMC GYRRVLIWFITHLE+S+S+I YI+ LV+G RG   E  A+
Sbjct: 800  ILFHNETLVWRMMDEMLMCSGYRRVLIWFITHLEVSNSMIEYIYTLVLGNRG---EKAAS 856

Query: 1017 EDKHTNTKGXXXXXXXXXXXXXXXXXXXDYSKIFDLQLPFSRQGNIELSEIERKMLIQEF 1076
            +                           DY+K+     PFSRQG I LS+IE KML+QEF
Sbjct: 857  DG--------------------------DYAKV-----PFSRQGAIVLSDIEIKMLLQEF 885

Query: 1077 LTNAAIHFNE--RNNLKHNPXXXXXXXXXXXXXXXXXXXXXXXLYSIGLMRLICFMIQAF 1134
             TNAAI F++  R +L                            + +GLM+L+C+M+++ 
Sbjct: 886  FTNAAIFFSKQLRESLGDGEDDEDQGDDEKGSGISP--------HVVGLMKLVCYMVKSL 937

Query: 1135 LDNNKLKIEVDDSIFELQTLLMNWITIIPEAKKLFFXXXXXXXXXXXXXXXXXXXXXXXX 1194
            +       +  D IFELQTLLM+WI I+PEA+ LFF                        
Sbjct: 938  MQKEMFDFKDPDYIFELQTLLMSWICILPEARDLFFALRSLVDEQSQNIKLESESIASAC 997

Query: 1195 XXXXXTIENQTSKDNNDKMDESSKVDSNSSFNKKLIELFPKMSHTNKEENTAIDTLKNYL 1254
                 + E Q  +  + ++ E     + S +NKKL+ L P  + T   EN+AI  L++++
Sbjct: 998  EPDSQS-EPQLPQGTHAEL-EPEATHAVSIYNKKLMSLLPPAAGT---ENSAITALRSFI 1052

Query: 1255 KKFRFHQEVPIIGRKVIYEDGKILKI 1280
             K     +  + GR+VI +D  I+ +
Sbjct: 1053 SKHSLTTKTALFGRRVISQDDTIMPM 1078

>KNAG0B00770 Chr2 complement(142612..145728) [3117 bp, 1038 aa] {ON}
            Anc_3.497 YGR134W
          Length = 1038

 Score =  609 bits (1570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/1106 (35%), Positives = 560/1106 (50%), Gaps = 223/1106 (20%)

Query: 198  LLMDKNYNLLLDYLHVSTPLLISLLHTNLDPLLFNNIISSYNKSFELTNDNKCLWYDFID 257
            L+++ +Y++LLD+++   P L  L+   +   L + I+  Y + +E    +   W++   
Sbjct: 108  LVLNTDYDVLLDFVNTVRPQLKGLIRQAVQGSLVDPIVRKYGRVYEF--HDYFHWFNLSK 165

Query: 258  SKDTT------NFGTITNCIDIINNFLE--IFDMHKNFTLNAEXXXXXXXXXXXXXXXXX 309
             K         N GT       IN+F     +D+H       E                 
Sbjct: 166  KKFANRDVLILNKGTPDLFHYYINSFCSKAPYDVHPLHPFLGELF--------------- 210

Query: 310  MHNENEGADLNLLMDENSMGEHTLSFNLFE---NNINHGILHPDLMAHISKRHDILAKIL 366
                 EG + N+   +    EH   F+L E   N   +  +  DLM   ++RH+IL ++L
Sbjct: 211  -----EGNN-NVKYQQLGTNEHVYEFDLDEETHNGSGNRTVAVDLMQQSNQRHEILTRML 264

Query: 367  NVGDNDKYYNSPLLHLQFKLLCALVDPLTQPTPNHKNIISIDLLFQLFLGFLKPELDRYS 426
            N+ + D    SP L+ QFK + +LVDPLTQP P+   ++S+DLL++LFL FL    D   
Sbjct: 265  NLKEID----SPHLYEQFKCMISLVDPLTQPPPSDTYVVSLDLLYKLFLAFLPKNQDTEQ 320

Query: 427  SAEDGTNWKFLVCFNMEKIINSVMKKLNCVDFNTLNSIN-----NSDESVHWRTQLHKWL 481
                  N  FL+CFNM+KII   + +L C D+  L SI+       +   ++R  L +W+
Sbjct: 321  ------NDTFLLCFNMQKIITRTLWRLKCWDYAKLTSISKKQTEGDNSQYNYRDHLKEWV 374

Query: 482  PRGFNTQDLELLYMVNILATYTIYKLNEDLPIQLNPFLSSMVSHWKNLSCTILLGLEIDR 541
            P G NTQDLELLYMV+I+A YTIY     LPIQLNPFLS ++S WKNLS  +LL LE+DR
Sbjct: 375  PNGLNTQDLELLYMVDIMAVYTIYNAYSHLPIQLNPFLSMLISLWKNLSAVLLLSLEVDR 434

Query: 542  LEEENETFDTPLIVRATVRSSTALRSIIATILNEHVNAFAHDFKHESLNTFMSPYGRKLC 601
             EE N+TFDTPL+VRAT+R ++ALR+++A +LN HV    HDFKHE LNTFMSP+GRKLC
Sbjct: 435  CEEANDTFDTPLLVRATIRGASALRAVVACVLNGHVRENEHDFKHEPLNTFMSPHGRKLC 494

Query: 602  NGALYTDFRSHASTILALTGDLEHVTQLISDLQPGDRFDEDVKYMF--EFEDYNTLPNVL 659
             G+LY D RSHA+ +L+L  DLE VT+L+SDLQPGDRFDED++YMF  E+EDYN +    
Sbjct: 495  QGSLYADLRSHAAAMLSLGVDLEDVTELLSDLQPGDRFDEDIRYMFEYEYEDYNLVD--F 552

Query: 660  GGEDDETSTDTLKNREMLKEIHNGNFIPXXXXXXXXXXXXYLEQKLREMNCHRRCNCIFS 719
              ED++ +            I   N                  QK       RRCNCIF+
Sbjct: 553  EDEDEDAAAAATTATASAAAITAAN------------EGTGASQK-------RRCNCIFT 593

Query: 720  DDEIKDTSISDKNYMGNSSSNGIESRIALLLNNNSSRKGGNGTNSEDDEDVIRKNIENLT 779
            DD+I  +                ES+++L         GG                    
Sbjct: 594  DDKIIQSD---------------ESKVSL---------GG-------------------- 609

Query: 780  KDQLSSTEMESLRVTGFNKPHAVRTXXXXXXXXXXXXXXXXXIFDFDYNGKDWRDTPRGM 839
                           G N+P++VRT                  F+FDY+G DWRD PRG+
Sbjct: 610  ---------------GKNRPYSVRTKSS---------------FEFDYSGNDWRDVPRGL 639

Query: 840  NLYYNLNYEFIEKPNLDLVFQLTLKATNMKLDKDDSNLLLRLVASSVKNEQDRIIFSDNQ 899
            NLY+  +YEF+ +P L     ++ KA   KL+  +S  LL+LVAS++K EQ+ II     
Sbjct: 640  NLYFWPSYEFLARPGLAEFRNVSSKAAGGKLNPMESQQLLKLVASAIKIEQECIIMGTVY 699

Query: 900  VSKEVKEIMEQNEDGVENEKLPHNKNRIENGNEKEIITEITPDDIYEIWCEESAFERMMQ 959
               E   +    +DG+                       +TPD+IY+ W ++  F+R++ 
Sbjct: 700  PQTEGIAV---GDDGL-----------------------LTPDNIYDAWFQDKVFDRILF 733

Query: 960  LNYEVTFRLMDEMLMCYGYRRVLIWFITHLELSHSVIHYIFELVMGFRGTSEENGATEDK 1019
            +N E+ ++LMDE+LMC+GYRRVL+WF+TH+EL+HSVIHYIFELVMG RG       T ++
Sbjct: 734  MNQELAWKLMDELLMCHGYRRVLLWFVTHMELNHSVIHYIFELVMGLRGQELSADVTLEE 793

Query: 1020 HTNTKGXXXXXXXXXXXXXXXXXXXDYSKIFDLQLP------FSRQGNIELSEIERKMLI 1073
                                         + ++  P      FSRQGN+ LSEIE KML+
Sbjct: 794  QRKQA---------------------LHNLMEIDTPNGGTLMFSRQGNLALSEIEVKMLL 832

Query: 1074 QEFLTNAAIHFNERNNLKHNPXXXXXXXXXXXXXXXXXXXXXXXLYSIGLMRLICFMIQA 1133
            QEF TNAAI  +   + +                          LYSIGL++LICFM++ 
Sbjct: 833  QEFFTNAAIFLSASESEEPE-----------------SETSDVSLYSIGLVKLICFMVKT 875

Query: 1134 FLDNNKLKIEVDDSIFELQTLLMNWITIIPEAKKLFFXXXXXXXXXXXXXXXXXXXXXXX 1193
             + N+K +    +  FELQTLLMNW+ I+P+A++LFF                       
Sbjct: 876  LIVNHKFEFSKSECTFELQTLLMNWLGIVPDAQELFFLLKKNISDTKTATTTTTTTSALG 935

Query: 1194 XXXXXXTIENQTSKDNNDKMDESSKVDSNSSFNKKLIELFPKMSHT-NKEENTAIDTLKN 1252
                          DNN      +  ++ S FNKKL+ L P+ + +  K  + AID L+N
Sbjct: 936  APGDIFPTLTDADDDNN------AVAENLSEFNKKLVMLLPRATQSEGKGSSQAIDALRN 989

Query: 1253 YLKKFRFHQEVPIIGRKVIYEDGKIL 1278
            +++K     E+P++GR+++    +IL
Sbjct: 990  FMRKHSLSSEIPVLGRRIVRRGSQIL 1015

>CAGL0I10428g Chr9 complement(1031462..1034953) [3492 bp, 1163 aa]
            {ON} similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134w
          Length = 1163

 Score =  505 bits (1300), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 327/957 (34%), Positives = 489/957 (51%), Gaps = 174/957 (18%)

Query: 330  EHTLSFNLFENNINHGILHPDLMAHISKRHDILAKILNVGDNDKYYNSPLLHLQFKLLCA 389
            E  LSF++ EN +      P++M     RH IL + L +   +    +P L +QFK L  
Sbjct: 357  EVILSFDINENGLQEV---PNIMKDSMLRHSILFEFLGLSQRNTL--APYLEMQFKTLAG 411

Query: 390  LVDPLTQPTPNHKNIISIDLLFQLFLGFLKPELDRYSSAEDGTNWKFLVCFNMEKIINSV 449
            LVDPLTQPTPN  +IISIDLL  L+ G + P L +   A +  +WK+L  FN+ KI+   
Sbjct: 412  LVDPLTQPTPNDTHIISIDLLHGLYTGLVHPALIKSGKARN-YDWKYLCGFNLIKIVWKS 470

Query: 450  MKKLNCVDFNTLNSINNSDESVHWRTQLHKWLPRGFNTQDLELLYMVNILATYTIYKLNE 509
            +KKL+C  ++TLN+I N +E   WR  L  W+P+  NTQDLELLYM++IL+ Y IYKL E
Sbjct: 471  LKKLHCSSYDTLNNIGNFEEGNDWRQTLEYWIPKNLNTQDLELLYMIDILSVYAIYKLYE 530

Query: 510  DLPIQLNPFLSSMVSHWKNLSCTILLGLEIDRLEEENETFDTPLIVRATVRSSTALRSII 569
            D PIQ NPFL  + S WK ++  I LGL++DR+EE+N++ +TPL++RATVR ++A R+ +
Sbjct: 531  DQPIQNNPFLFELFSVWKYITKIIFLGLQVDRIEEQNDSEETPLMIRATVRGASAFRAAL 590

Query: 570  ATILNEHVNAFAHDFKHESLNTFMSPYGRKLCNGALYTDFRSHASTILALTGDLEHVTQL 629
             TILN  +    HDFKHE +NTFMSP+GRKLC+G+LY D R      +    +L+ +T L
Sbjct: 591  TTILNRQIENNEHDFKHEPINTFMSPHGRKLCSGSLYADMRVSTKIFVENGVELDDITNL 650

Query: 630  ISDLQPGDRFDEDVKYMF--EFEDYNTLPNVLGGEDDETSTDTLKNREMLKEIHNGNFIP 687
            ++DLQPGDRFDEDV+YMF  E+EDYN + +    ED +   D   +              
Sbjct: 651  LTDLQPGDRFDEDVEYMFDYEYEDYNLVSD---SEDMDEKADNESD-------------- 693

Query: 688  XXXXXXXXXXXXYLEQKLREMNCHRRCNCIFSDDEIKDTSISDKNYMGNSSSNGIESRIA 747
                             +R     RRCNC+F DD+I D S  D   +             
Sbjct: 694  ----------------GVRPAPIFRRCNCVFEDDKIMDESTIDHQSLITD---------- 727

Query: 748  LLLNNNSSRKGGNGTNSEDDEDVIRKNIENLTKDQLSSTEMESLRVTGFNKPHAVRTXXX 807
            + L NN+        +++D+ D I+          +S  E  ++R+  F           
Sbjct: 728  MELENNA-------ISTKDENDKIKI---------ISQPEPFTVRMRSF----------- 760

Query: 808  XXXXXXXXXXXXXXIFDFDYNGKDWRDTPRGMNLYYNLNYEFIEKPNLDLVFQLTLKATN 867
                           FDF+Y GKDWRD PRG NLYYN  + F+++ +         KA N
Sbjct: 761  ---------------FDFNYGGKDWRDIPRGENLYYNGEFVFVQECSSSEFASYFSKAVN 805

Query: 868  MKLDKDDSNLLLRLVASSVKNEQDRIIFSDNQVSKEVKEIMEQNEDGVENEKLPHNKNRI 927
              LD  +SN L++LVAS ++ EQDR++         +   M Q         LP     +
Sbjct: 806  SVLDISESNRLIQLVASCIREEQDRMV---------IYHGMSQ---------LP-----L 842

Query: 928  ENGNEKEIITEITPDDIYEIWCEESAFERMMQLNYEVTFRLMDEMLMCYGYRRVLIWFIT 987
             NG+  +  +++T D+IY+     + F +M+  + E+   LMDE+LM  GYRRVLIWF+T
Sbjct: 843  ANGDVNK--SKLTVDEIYDQISSSNNFAKMLYQDTELACGLMDELLMIVGYRRVLIWFLT 900

Query: 988  HLELSHSVIHYIFELVMGFR-GTSEENGATEDKHTNTKGXXXXXXXXXXXXXXXXXXXDY 1046
            H+ ++  +IHYIFELVMG+R G S+ +   ++   ++ G                     
Sbjct: 901  HINITFPLIHYIFELVMGYRVGFSDGDANGDNNKKSSTG--------------------- 939

Query: 1047 SKIFDLQLPFSRQGNIELSEIERKMLIQEFLTNAAIHFNERNNLKHNPXXXXXXXXXXXX 1106
                  +  FSR G + LS IE++ML+QEF  NA +  + + + + N             
Sbjct: 940  ------KCGFSRLGTVALSSIEKQMLLQEFFLNATVSLSAK-SFESNGTEIDNYDDNADE 992

Query: 1107 XXXXXXXXXXXLYSIGLMRLICFMIQAFLDNNKLKIEVDDSIFELQTLLMNWITIIPEAK 1166
                        Y++G++ LIC M++  +   ++ +   +   ELQTLL+NWI++IPEAK
Sbjct: 993  DNEYISS-----YAVGIVTLICNMVKTLVRAGQMDVSKSEYTVELQTLLVNWISLIPEAK 1047

Query: 1167 KLFFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIENQTSKDNNDKMDESSKVDSNSSFN 1226
            +LFF                              I++     N  ++  S  ++  ++ +
Sbjct: 1048 ELFFFLKQEAHEFD--------------------IQDSLEPINESELQTSGNINEPAATD 1087

Query: 1227 KKLIELFPKMSHTNKEENT-AIDTLKNYLKKF-RFHQEVPIIGRKVIYEDGKILKIP 1281
               ++     S T+  +N+ A D L  +L+       + P IGRKVIY+  KIL +P
Sbjct: 1088 SIPLDDTINTSLTSSTKNSNATDALSTFLETVEETSVQPPQIGRKVIYKGTKILPLP 1144

 Score = 38.9 bits (89), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 50/205 (24%), Positives = 80/205 (39%), Gaps = 56/205 (27%)

Query: 12  DSLPIDYKPNIQLLETL--IDYAKPDSEYLDSLLFESLILALFTTNCGLSVLNIISTLKS 69
           D +P +Y   I   E L    Y++P  E  D+  +E L +ALFTT  G  +L+       
Sbjct: 85  DVIPFEYLEKIYRDEDLSTTSYSRPRFE--DNFFYELLTIALFTTKPGNKILHFF----- 137

Query: 70  FTNDKQKKNNLVPTTATAAVDSKHNKDENLDTTVIRNATATRNIIAKPNILKKQAHHPKL 129
                                    K+  LD+ +  N  +   +   P        H K+
Sbjct: 138 -------------------------KNTGLDSAIEHN-DSDDTLFHSP-----AYEHLKM 166

Query: 130 LEKWRNDKITLLKFTKFILKNSNFPLNYNAFFDPVMKLPLEFLLLNDRFCSNDNNATSQK 189
           L KW ++   L    +FILKN N  ++   +     K PL FLL     C N+N      
Sbjct: 167 LWKWEDE--YLHNLLQFILKNRNVDIDLGNYCKTSYKRPLTFLLT----CPNNN------ 214

Query: 190 LFSIYNNTLLMDKNYNLLLDYLHVS 214
                 +  L+ + +N+L +YL+ +
Sbjct: 215 ----IKHRFLLSEEFNILEEYLYAA 235

>TDEL0D05650 Chr4 (1015679..1018912) [3234 bp, 1077 aa] {ON}
           Anc_3.497 YGR134W
          Length = 1077

 Score =  446 bits (1147), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 260/615 (42%), Positives = 356/615 (57%), Gaps = 102/615 (16%)

Query: 37  EYLDSLLFESLILALFTTNCGLSVLNIISTLKSFTNDKQKKNNLVPTTATAAVDSKHNKD 96
           ++  SL+ E+LI+ALFTT  G+S+L + S                               
Sbjct: 44  QWRPSLICETLIIALFTTRAGISLLPLFSE------------------------------ 73

Query: 97  ENLDTTVIRNATATRNIIAKPNILKKQAHHPKLLEKWRNDKITLLKFTKFILKNSNFPLN 156
                      +A R  +            P++LE W ND+  +L+F  +IL+N +  + 
Sbjct: 74  -----------SAKRKRVG-----------PRVLE-WHNDEELMLRFFSYILENRSSRIE 110

Query: 157 YNAFFDPVMKLPLEFLLLNDRFCSNDNNATSQKLFSIYNNTLLMDKNYNLLLDYLHVSTP 216
              F     KLPL F L+  +F +                ++++D+NYNLLLDY+H  TP
Sbjct: 111 PRLFEKARWKLPL-FFLIESKFLA---------------ASMVLDQNYNLLLDYVHTITP 154

Query: 217 LLISLLHTNL-DPLLFNNIISSYNKSFELTNDNKCLWYDFIDSKDTTNFGTITNCIDIIN 275
           ++   +H        F + +  YN+ +EL + ++  WY F   K       I   +    
Sbjct: 155 MIKRWVHRAFTQGTFFKDTVVCYNRVYELKDSSE--WYSFGTKKSNEERRAIQQFLR--E 210

Query: 276 NFLEIFDMHKNFTLNAEXXXXXXXXXXXXXXXXXMHNENEGADLNLLMDENSMGEHTLSF 335
           N  ++ D +      +                    NE    D        S  E+  SF
Sbjct: 211 NSEQVLDTYHEMVRPS--------------------NERAINDTASYHHRISQHENVYSF 250

Query: 336 NLFENNINHGILHPDLMAHISKRHDILAKILNVGDNDKYYNSPLLHLQFKLLCALVDPLT 395
           ++   N +  +  P++M+H S RHDIL  ++ +   D    SPLL  QFKL+  LVDPLT
Sbjct: 251 DI---NQDGSLEIPNIMSHASVRHDILQNLMRLPLCD----SPLLQWQFKLMAGLVDPLT 303

Query: 396 QPTPNHKNIISIDLLFQLFLGFLKPELDRYSSAEDGTNWKFLVCFNMEKIINSVMKKLNC 455
           QP PN K+IIS+DLL+Q+ LG ++P +   +   DG +WKF +CFNM+KII + +K+LN 
Sbjct: 304 QPPPNDKHIISLDLLYQMLLGLMEPAISN-TLGSDGCDWKFHLCFNMQKIIQASLKRLNL 362

Query: 456 VDFNTLNSINNSDESVHWRTQLHKWLPRGFNTQDLELLYMVNILATYTIYKLNEDLPIQL 515
            DF+TLNSINNSDE V WR  LH WLP G NTQ+LEL+YM++ILA YTIYKL EDLP+QL
Sbjct: 363 QDFDTLNSINNSDEDVSWRDNLHSWLPHGLNTQNLELIYMIDILAVYTIYKLYEDLPVQL 422

Query: 516 NPFLSSMVSHWKNLSCTILLGLEIDRLEEENETFDTPLIVRATVRSSTALRSIIATILNE 575
           NPFLS M+S WKNL+C ILLGLEIDR EEE+ETF+TP++VRAT+R + ALR+++ATILN 
Sbjct: 423 NPFLSPMISLWKNLTCVILLGLEIDRFEEEHETFETPVLVRATIRGAAALRAVVATILNG 482

Query: 576 HVNAFAHDFKHESLNTFMSPYGRKLCNGALYTDFRSHASTILALTGDLEHVTQLISDLQP 635
           HV+ + HDF HE LNTFMSP+GRKLC GALY D RSHA+ +LAL  +LE VT L++DLQ 
Sbjct: 483 HVDTYKHDFMHEPLNTFMSPHGRKLCQGALYADLRSHAAALLALGTELEDVTNLLADLQA 542

Query: 636 GDRFDEDVKYMFEFE 650
           GDRFDEDV+YMFE+E
Sbjct: 543 GDRFDEDVRYMFEYE 557

 Score =  318 bits (815), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 197/503 (39%), Positives = 274/503 (54%), Gaps = 74/503 (14%)

Query: 783  LSSTEMESLRVTGFNKPHAVRTXXXXXXXXXXXXXXXXXIFDFDYNGKDWRDTPRGMNLY 842
            L      SL ++   KP AVR+                  F+FDY+GKDWRD PRG N Y
Sbjct: 616  LQQNAQTSLSMSSSGKPRAVRSGGA---------------FEFDYSGKDWRDIPRGSNFY 660

Query: 843  YNLNYEFIEKPNLDLVFQLTLKATNMKLDKDDSNLLLRLVASSVKNEQDRIIFSDNQVSK 902
            Y+ ++EFIE P+L  +  LT KA++ KL + +S  LLR VAS VKNEQD I   +     
Sbjct: 661  YSPDFEFIESPSLSSLLALTKKASSEKLVEKESLTLLRSVASCVKNEQDEITLGN----- 715

Query: 903  EVKEIMEQNEDGVENEKLPHNKNRIENGNEKEIITEITPDDIYEIWCEESAFERMMQLNY 962
                +++ ++D   +E+   N ++IE            PDDIYE+WCE S FE+++  N+
Sbjct: 716  ----LIDPHQDSQADEE-SRNADKIE------------PDDIYEMWCENSTFEKIVYFNH 758

Query: 963  EVTFRLMDEMLMCYGYRRVLIWFITHLELSHSVIHYIFELVMGFRGTSEENGATEDKHTN 1022
             + ++LMDEML+C GYRRVLIWFITH+EL+HS+IHYIFELVMG RG S+EN    D+  +
Sbjct: 759  TLAWKLMDEMLLCIGYRRVLIWFITHMELNHSLIHYIFELVMGLRGNSDEN----DRDVD 814

Query: 1023 TKGXXXXXXXXXXXXXXXXXXXDYSKI-FDLQLPFSRQGNIELSEIERKMLIQEFLTNAA 1081
              G                   D  K+  +L + FSRQG ++LS IE KML+QEF TNAA
Sbjct: 815  LAG---------------PPLQDVDKVKGELSVGFSRQGALQLSTIETKMLLQEFFTNAA 859

Query: 1082 IHFNERNNLKHNPXXXXXXXXXXXXXXXXXXXXXXXLYSIGLMRLICFMIQAFLDNNKLK 1141
            I  ++++                             LY++GLM+LICFM++ F++  K  
Sbjct: 860  IFISKKS---EESTDIANEEQNNENRDLNGNSENVSLYAMGLMKLICFMVRTFINKEKFD 916

Query: 1142 IEVDDSIFELQTLLMNWITIIPEAKKLFFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTI 1201
                + +FELQ LLMNWI IIPEAK LFF                              +
Sbjct: 917  FSESECVFELQALLMNWIGIIPEAKTLFFELKSLIAGFSTATSVQEQKNAE--------V 968

Query: 1202 ENQTSKDNNDKMDESSKVDSNSS---FNKKLIELFPKMSHTNKEENTAIDTLKNYLKKFR 1258
            +N T +D     ++S    SN++   FN+KL+ L P +   NKEEN A+ TL++++K   
Sbjct: 969  KNDTQEDV--PKEQSPVRVSNTAGFEFNRKLMTLLPPLV-KNKEENAAMQTLRSFIKTSS 1025

Query: 1259 FHQEVPIIGRKVIYEDGKILKIP 1281
            F   VP+IGRK++YED KIL +P
Sbjct: 1026 FLNTVPVIGRKIVYEDDKILPLP 1048

>Kwal_47.18886 s47 (1013635..1016952) [3318 bp, 1105 aa] {ON}
           YGR134W (CAF130) - CCR4 Associated Factor 130 kDa
           [contig 189] FULL
          Length = 1105

 Score =  410 bits (1053), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 259/686 (37%), Positives = 372/686 (54%), Gaps = 98/686 (14%)

Query: 12  DSLP--IDYKPNIQLLETLIDYAKPDSEYLDSLLFESLILALFTTNCGLSVLNIISTLKS 69
           ++LP  +D KPN          A+  + Y    + E L++ LFTT  GLS+L +   L  
Sbjct: 20  ETLPKLVDPKPNES-------EARGTNSYASLSIQEKLVIGLFTTKPGLSILKLYYELSC 72

Query: 70  FTNDKQKKNNLVPTTATAAVDSKHNKDENLDTTVIRNATATRNIIAKPNILKKQAHHPKL 129
                  + NL+          + +K ++L   V +                      KL
Sbjct: 73  ------GRINLLRYKKW-----QQSKFQSLPDAVYK----------------------KL 99

Query: 130 LEKWRNDKITLLKFTKFILKNSNFPLNYNAFFDPVMKLPLEFLLLNDRFCSNDNNATSQK 189
           ++KW      +    +++L+N +  L+Y +F+    KL + FLL  D             
Sbjct: 100 VKKWTGSSDYISALMEYLLRNDSTSLDYVSFYSAEYKLSMAFLLDQD------------- 146

Query: 190 LFSIYNNTLLMDKNYNLLLDYLHVSTPLLISLLHTNLDPLLFNNIISSYNKSFELTNDNK 249
                   L++D  YNLLLD+L  +   +  LL     P L      S+++ F+L+   +
Sbjct: 147 -----TELLIIDDEYNLLLDFLLQTRASVEELLSQADLPSLIAKSALSHHRLFQLSG--R 199

Query: 250 CLWYDFIDSKDTTNFGTITNCIDIINNFLEIFDMHKNFTLNAEXXXXXXXXXXXXXXXXX 309
            +WY F D +            DI   +L +  +    T   +                 
Sbjct: 200 YVWYTFSDER-------FAEAQDICYKYLSV--LTDKLTAQQDLIPQIQPLFDSVNSSRL 250

Query: 310 MHNE------NEGADLNLLMDEN-------SMGEHTLSFNLFENNINHGILH-PDLMAHI 355
            H        +EG + +   D +       S  E   SF+L ++    G L  P++    
Sbjct: 251 AHLSQGDSLYSEGVESDSNSDSDHWPQKKLSAHERIYSFDLKDD----GTLESPNVFGRT 306

Query: 356 SKRHDILAKILNVGDNDKYYNSPLLHLQFKLLCALVDPLTQPTPNHKNIISIDLLFQLFL 415
            +RH  L ++L +   +   +SP L  QF  LCALVDP+TQPTPN  +IISIDLL  +F+
Sbjct: 307 RRRHQALYQVLRLQQQN---SSPCLKAQFFTLCALVDPVTQPTPNDSHIISIDLLSDMFI 363

Query: 416 GFLKPELDRYSSAEDGTNWKFLVCFNMEKIINSVMKKLNCVDFNTLNSINNSDESVHWRT 475
           G L  E+ +        NW+F +CFN++KI+ S + +LNC DF  LNS+NNSD+S+ WR 
Sbjct: 364 GLLHSEIKQLP-----FNWRFHICFNLQKILQSTLPRLNCHDFQQLNSVNNSDDSIDWRR 418

Query: 476 QLHKWLPRGFNTQDLELLYMVNILATYTIYKLNEDLPIQLNPFLSSMVSHWKNLSCTILL 535
            LHKWLP+G NTQDLEL+YM++ILA Y I+KL  D P+Q+NPFL+SM+S WKNL+  +LL
Sbjct: 419 NLHKWLPQGLNTQDLELVYMIDILAIYIIHKLYRDRPVQMNPFLASMISLWKNLTFVVLL 478

Query: 536 GLEIDRLEEENETFDTPLIVRATVRSSTALRSIIATILNEHVNAFAHDFKHESLNTFMSP 595
           GLEIDR EEE ETF TP++VRA +R S+ALRS++AT+LN HV    HDF+HE +N FMSP
Sbjct: 479 GLEIDRFEEEQETFSTPVLVRAAIRGSSALRSVVATVLNGHVEYKRHDFQHEPINIFMSP 538

Query: 596 YGRKLCNGALYTDFRSHASTILALTGDLEHVTQLISDLQPGDRFDEDVKYMFEFEDYNTL 655
           +GRKLC+GALYTD RSHA+ +LAL  +LE VT L+SDLQPGDRFDEDVKYMF++E Y+  
Sbjct: 539 HGRKLCHGALYTDVRSHAAAMLALGIELEDVTNLLSDLQPGDRFDEDVKYMFDYE-YDNY 597

Query: 656 PNVLGGEDDETSTDTLKNREMLKEIH 681
             V   + DE   + +++RE +KE+ 
Sbjct: 598 NEVGTEDMDEEELEDVESRERIKEMR 623

 Score =  256 bits (653), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 165/481 (34%), Positives = 239/481 (49%), Gaps = 74/481 (15%)

Query: 824  DFDYNGKDWRDTPRGMNLYYNLNYEFIEKPNLDLVFQLTLKATNMKLDKDDSNLLLRLVA 883
            +FD+NG+DWRD PRG+N Y+N NY+F +         L   A   +L K+++  LLRLV+
Sbjct: 684  EFDFNGRDWRDIPRGLNFYFNENYDFEKSVKRGAAHTLMNSAAERQLSKEEAVHLLRLVS 743

Query: 884  SSVKNEQDRIIFSDNQVSKEVKEIMEQNEDGVENEKLPHNKNRIENGNEKEIITEITPDD 943
            + V  EQ+  +      + +             ++ L      + +G+       +T D 
Sbjct: 744  TCVAKEQEHTVLRSAFAADD-------------SQALSCQSTLVADGD-------LTTDY 783

Query: 944  IYEIWCEESAFERMMQLNYEVTFRLMDEMLMCYGYRRVLIWFITHLELSHSVIHYIFELV 1003
            IYE WC++S F++M+  N  + +R+MDEMLMC GYRRVLIWFITHLE++ S+I YI+ LV
Sbjct: 784  IYENWCQDSLFDKMLFHNETLVWRIMDEMLMCSGYRRVLIWFITHLEVTSSMIEYIYSLV 843

Query: 1004 MGFRGTSEENGATEDKHTNTKGXXXXXXXXXXXXXXXXXXXDYSKIFDLQLPFSRQGNIE 1063
            MG RG    N  T                             + K     LPFSRQG+I 
Sbjct: 844  MGNRGEKLANEETP----------------------------FGK-----LPFSRQGDIV 870

Query: 1064 LSEIERKMLIQEFLTNAAIHFNE--RNNLKHNPXXXXXXXXXXXXXXXXXXXXXXXLYSI 1121
            LSEIE KML+QEF TNAAI F++  R +L                            Y +
Sbjct: 871  LSEIEIKMLLQEFFTNAAIFFSKQLRESLGDEEEEETENLGISP-------------YIV 917

Query: 1122 GLMRLICFMIQAFLDNNKLKIEVDDSIFELQTLLMNWITIIPEAKKLFFXXXXXXXXXXX 1181
            GLMRL+CFM+++ +       +  D IFEL+TLLM+WI I+PEA+ LFF           
Sbjct: 918  GLMRLVCFMVKSLIQEEMFDFKDPDYIFELETLLMSWICILPEARDLFFALRSRVDQQSR 977

Query: 1182 XXXXXXXXXXXXXXXXXXTIENQTSKDNNDKMDESSKVDSNSSFNKKLIELFPKMSHTNK 1241
                              + + +T+ D ND   +S + +S S +NKKLI L P +  T  
Sbjct: 978  KPAKRDPDAMATASVVNLSPDFRTT-DENDGSSDSEETNSVSIYNKKLISLLPPVVGT-- 1034

Query: 1242 EENTAIDTLKNYLKKFRFHQEVPIIGRKVIYEDGKILKIPIN--IIDEYNQWNDQIYDYN 1299
             ENTA+  L++++ K        + GR+VI  D +I+ + ++   ID  N   +   DYN
Sbjct: 1035 -ENTAVTALRSFISKHSLTMGTAVFGRRVINHDDRIMSMYMSDKDIDNRNFLAEFGIDYN 1093

Query: 1300 D 1300
            D
Sbjct: 1094 D 1094

>NCAS0E00770 Chr5 complement(141832..145284) [3453 bp, 1150 aa] {ON}
           Anc_3.497
          Length = 1150

 Score =  362 bits (929), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 173/316 (54%), Positives = 232/316 (73%), Gaps = 15/316 (4%)

Query: 350 DLMAHISKRHDILAKILNVGDNDKYYNSPLLHLQFKLLCALVDPLTQPTPNHKNIISIDL 409
           ++++H +KRH +L +++N   N+    +PLL LQF  +  LVDPL+QP PN+K +IS+ L
Sbjct: 292 NVVSHTAKRHRVLNQLIN---NNDLKTTPLLTLQFTFMAGLVDPLSQPPPNNKQVISLHL 348

Query: 410 LFQLFLGFLKPELDRYSSAEDGTNWKFLVCFNMEKIINSVMKKLNCVDFNTLNSI----- 464
           L+ +F+G + P L    +A DG NWKF +CFNM K+IN+ M  L C +FN LN I     
Sbjct: 349 LYSMFIGLMYPNLKECFNANDGFNWKFHICFNMVKLINNSMVILKCDNFNKLNDIINSNN 408

Query: 465 -----NNSDESVHWRTQLHKWLPRGFNTQDLELLYMVNILATYTIYKLNEDLPIQLNPFL 519
                  +D+   W+ +L++W+P G NTQDLEL+YM+NI+A YTIY+L  DLPIQ+NPFL
Sbjct: 409 DNDEGTENDDDDAWKLKLNEWIPHGINTQDLELIYMINIMAVYTIYQLYSDLPIQMNPFL 468

Query: 520 SSMVSHWKNLSCTILLGLEIDRLEEENETFDTPLIVRATVRSSTALRSIIATILNEHVNA 579
           S +++ WKNLS  ILLGL+IDR EE  +TF TPL+VRAT+R + +LR+++ATILN HV+ 
Sbjct: 469 SCLITLWKNLSAIILLGLDIDRSEEARKTFSTPLLVRATIRGAASLRAVVATILNNHVDV 528

Query: 580 FAHDFKHESLNTFMSPYGRKLCNGALYTDFRSHASTILALTGDLEHVTQLISDLQPGDRF 639
             HDFKHE LNTFMSP+GRKLC GALY D RSHA+ ILAL  +LE VT L++DLQ GDRF
Sbjct: 529 NEHDFKHEPLNTFMSPHGRKLCQGALYADIRSHAAAILALGAELEDVTDLLTDLQAGDRF 588

Query: 640 DEDVKYMF--EFEDYN 653
           DED++YMF  E++DYN
Sbjct: 589 DEDIRYMFDYEYDDYN 604

 Score =  328 bits (840), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 192/466 (41%), Positives = 257/466 (55%), Gaps = 48/466 (10%)

Query: 823  FDFDYNGKDWRDTPRGMNLYYNLNYEFIEKPNLDLVFQLTLKATNMKLDKDDSNLLLRLV 882
            F+FDY GKDWRD PRG NLYY+ +Y FI+ P ++ +  LT KATN KL  +DS LL+  V
Sbjct: 695  FEFDYGGKDWRDIPRGFNLYYSPSYHFIKSPMMETISTLTSKATNEKLTTEDSTLLITAV 754

Query: 883  ASSVKNEQDRIIFSDNQVSKEVKEIMEQNEDGVENEKLPHNKNRIENGNEKEIITEITPD 942
            AS +K EQD++I          KE+++ N       K PH     EN ++ +     TPD
Sbjct: 755  ASCIKLEQDKMI---------SKELLKHN-----TVKHPH---AAENEDDADFKIA-TPD 796

Query: 943  DIYEIWCEESAFERMMQLNYEVTFRLMDEMLMCYGYRRVLIWFITHLELSHSVIHYIFEL 1002
            DIY++W EES FERM+ LN +V +RLMDEMLMC GYRRVLIWFITH+EL+HS+I YIFEL
Sbjct: 797  DIYDMWSEESKFERMLYLNQDVAWRLMDEMLMCNGYRRVLIWFITHMELNHSLIQYIFEL 856

Query: 1003 VMGFRGT--SEENGATEDK----HTNTKGXXXXXXXXXXXXXXXXXXXDYSKIFDLQLPF 1056
            VMG RG+  S E   T+ K    H    G                            LPF
Sbjct: 857  VMGLRGSPFSGEGDETDSKNDLLHEIMYGQVKNKEIVTSLTY---------------LPF 901

Query: 1057 SRQGNIELSEIERKMLIQEFLTNAAIHFNERNNLKHNPXXXXXXXXXXXXXXXXXXXXXX 1116
            SRQG + LSEIE KML+QEF TNAAI+F+ ++N                           
Sbjct: 902  SRQGPLILSEIENKMLLQEFFTNAAIYFSSKSN-------NEGTTNNDNGEGIDEEAVNF 954

Query: 1117 XLYSIGLMRLICFMIQAFLDNNKLKIEVDDSIFELQTLLMNWITIIPEAKKLFFXXXXXX 1176
             +YS GL++LICFM+Q+ ++NNK      +  FELQTLLMNWI IIPEA+ LFF      
Sbjct: 955  SVYSTGLVKLICFMVQSLMENNKFDFAKSECTFELQTLLMNWIGIIPEAEDLFFTLKSGV 1014

Query: 1177 XXXXXXXXXXXXXXXXXXXXXXX-TIENQTSKDNNDKMDESSKVDSNSSFNKKLIELFPK 1235
                                    + +  T      + D      + S FNK+L+ L PK
Sbjct: 1015 SSSSTKTGRESDDHDNTHADNLSFSDDGDTGHPGISRFDTDDSPPNESIFNKRLVSLLPK 1074

Query: 1236 MSHTNKEENTAIDTLKNYLKKFRFHQEVPIIGRKVIYEDGKILKIP 1281
              + +K+EN A+ TL+++++++ F +E P+ GRKV+Y D  +L +P
Sbjct: 1075 RIN-DKDENAAVSTLRHFIERYSFDEEAPVYGRKVVYSDEIVLPLP 1119

 Score = 62.0 bits (149), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 71/142 (50%), Gaps = 24/142 (16%)

Query: 86  TAAVDSKHNKDENLDTTVIRNATATRNIIAKPNILKKQAHHPKLLEKWRNDKITLLKFTK 145
           +A  + KH +D  L+    +  T+T         + K AH   L +KW ++K+  LKFTK
Sbjct: 91  SALFNDKHQQDTFLENQYKKWLTSTD--------ISKTAHQ-YLRKKWSSNKLYFLKFTK 141

Query: 146 FILKNSNFPLNYNAFFDPVMKLPLEFLLLNDRFCSNDNNATSQKLFSIYNNTLLMDKNYN 205
           F+L N++  +N + + +P+ KLPL FL         D+N            T ++D  YN
Sbjct: 142 FLLVNADGNINVDKYTEPIYKLPLNFLF--------DDNTNLMP-------TFILDNKYN 186

Query: 206 LLLDYLHVSTPLLISLLHTNLD 227
           LL DY++   PLL  ++   L+
Sbjct: 187 LLQDYIYACGPLLKCVMKDTLE 208

>KLLA0E03961g Chr5 complement(358995..362393) [3399 bp, 1132 aa] {ON}
            weakly similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily- conserved
            CCR4-NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1132

 Score =  349 bits (896), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 320/1161 (27%), Positives = 516/1161 (44%), Gaps = 226/1161 (19%)

Query: 35   DSEYLDSLLFESLILALFTTNCGLSVLNIISTLKSFTNDKQKKNNLVPTTATAAVDSKHN 94
            DS+  +S+L E L++ALFTT  G +V+          ND ++ N++              
Sbjct: 15   DSDVDESVLLEKLVIALFTTVPGQAVVT------QLINDAKRTNDV-------------- 54

Query: 95   KDENLDTTVIRNATATRNIIAKPNILKKQAHHPKLLEKWRNDKITLLKFTKFILKNSNFP 154
              + ++  +  N                  +   L   W  DK  L  F  ++L+N    
Sbjct: 55   --DGVECLIRMN----------------DPYWVALFGTWATDKHILSLFLGWVLRNETDH 96

Query: 155  LNYNAFFDPVMKLPLEFLLLNDRFCSNDNNATSQKLFSIYNNTLLMDKNYNLLLDYLHVS 214
            ++   + D   K+ + FLL N      D   T+           L D + N+LLDYLH +
Sbjct: 97   IDLERYSDQSFKMAMRFLLTN-----QDPKFTAP----------LWDTS-NILLDYLHNA 140

Query: 215  TPLLISLLHTNLDPLLFNNIISSYNKSFELTNDNKCLWYDFIDSKDTTNFGTITNCIDII 274
             PL+ S+L   LD   F   +  YN+ +E     +  W  F   + T++  + T  ++  
Sbjct: 141  KPLIESVL-KKLDGSQFLQCLMKYNRLYEFNGSYQ--W--FTPPQSTSHAESPTTILERN 195

Query: 275  NNFLEIFDMHKNFTLNAEXXXXXXXXXXXXXXXXXMHNENEGADLNLLMDENSMGEHTL- 333
            + FL                                   N G D+   + +   G+  L 
Sbjct: 196  STFLSTLG-------------------------------NFGNDMVRALSQLKTGDIRLN 224

Query: 334  SFNLFENNINHGILHPDLMAHISKRHDILAKILNVGDNDKY----------YNSPLLHLQ 383
            S   +  N  H   +P L    SK+ D     LN G +D++             PLL  Q
Sbjct: 225  SLESYGKNSGHN--NPPL----SKQDDHNPLNLN-GKSDRFNLFFKLGLHKEPHPLLAEQ 277

Query: 384  FKLLCALVDPLTQPTPNHKNIISIDLLFQLFLGFLKPELDRYSSAEDGTNWKFLVCFNME 443
            F  LC   DP+TQP PN  +IIS+DLL  L+LG L   + +         WK  +  N+E
Sbjct: 278  FNSLCLFADPMTQPPPNDSHIISLDLLHDLYLGSLTAYIVKLIPNYQKV-WKIHLSANLE 336

Query: 444  KIINSVMKKLNCVDFNTLNSINN--SDESVHWRTQLHKWLPRGFNTQDLELLYMVNILAT 501
             I  ++++ L   D+ +L+++ +  +     +   +  W+P   +  ++E+LYM+  L+ 
Sbjct: 337  TITLAILQMLQIWDYRSLDNLKDIQARSPDAYPKYMTSWIPYDLSPPEMEILYMIAGLSF 396

Query: 502  YTIYKLNEDLPIQLNPFLSSMVSHWKNLSCTILLGLEIDRLEEENETFDTPLIVRATVRS 561
            Y+++K++ D P +LNPFL  M+  W+ LS  ++LGL+IDR EE    + TP+IV A +R 
Sbjct: 397  YSMHKMHSDKPPRLNPFLPMMLRAWRGLSSALVLGLQIDRFEEMQMLYGTPVIVSAVIRG 456

Query: 562  STALRSIIATILNEHVNAFAHDFKHESLNTFMSPYGRKLCNGALYTDFRSHASTILALTG 621
            ++ALRSIIATILN HV+   HDFKH+    FMSP+GRKLCNGALYT    + + +L    
Sbjct: 457  ASALRSIIATILNGHVDEKLHDFKHQPFGGFMSPHGRKLCNGALYTYEMYYFAALLPSGM 516

Query: 622  DLEHVTQLISDLQPGDRFDEDVKYMFEFE--DYNTLPNVLGGEDDETSTDTLKNREMLKE 679
            D + + +L++D+Q GDR DEDV+YMF++E  DYN         D +TS  T   + M   
Sbjct: 517  DYDEIVELLTDIQKGDRIDEDVRYMFDYEYFDYN---------DADTSKLT-DGKLMFTS 566

Query: 680  IHNGNFIPXXXXXXXXXXXXYLEQKLR---EMNCHRRCNCIFSDDEIKDTSISDKNYMGN 736
              N                  LEQK R       ++RC C FSD++  D    D +   +
Sbjct: 567  TKNE-----------------LEQKNRFRMLRGLYKRCLCKFSDEDDNDDDDDDDD---D 606

Query: 737  SSSNGIESRIALLLNNNSSRKGGNGTNSEDDEDVIRKNIENLTKDQLSSTEMESLRVTGF 796
               NG +S + L  N   +      T SE    V      +L   + S  +  S   TG+
Sbjct: 607  DDYNGEKSVVGLDENGQINEAETPQTFSESSNAVA---FTSLMTHRDSQNDFVSHLTTGY 663

Query: 797  NKPHAVRTXXXXXXXXXXXXXXXXXIFDFDYNGKDWRDTPRGMNLYYNLNYEFIEKPNLD 856
            +K                             NG DWRD PRG+NLYY  +Y+F+ K +  
Sbjct: 664  DK-----------------------------NGDDWRDIPRGLNLYYMDDYQFLSKLDKV 694

Query: 857  LVFQLTLKATNMKLDKDDSNLLLRLVASSVKNEQDRIIFSDNQVSKEVKEIMEQNEDGVE 916
             +F+L  +  +  +    +  +LR +A+ VK EQ++I+           +++      V+
Sbjct: 695  SLFELLRRLPDRNVTFSQACTVLRSIATCVKLEQEQILL----------KLITATSAEVD 744

Query: 917  NEKLPHNKNRIENGNEKEIITEITPDDIYEIWCEESAFERMMQLNYEVTFRLMDEMLMCY 976
             + LP + +        E+IT I  DD   I  +   F      N  + +++ DE++M +
Sbjct: 745  LKVLPFSTD--------EVITAIFNDDGGII--KPFPFS---GCNDSLGWKIFDELMMSH 791

Query: 977  GYRRVLIWFITHLELSHSVIHYIFELVMGFRGTSEENGATEDKHTNTKGXXXXXXXXXXX 1036
            G+RR+LI+ +TH   + S IHY++EL+ G RG    +   E       G           
Sbjct: 792  GHRRLLIYHLTHRSYTFSSIHYVYELLFGLRGNPARSYDLESTKNKQLG----------- 840

Query: 1037 XXXXXXXXDYSKIFDLQLPFSRQGNIELSEIERKMLIQEFLTNAAIH-FNERNNLK---- 1091
                    ++ ++  ++  FSRQG IELS IE+KML+QEF    +     E N+      
Sbjct: 841  ILSWTPTGEFERVAAIE--FSRQGVIELSAIEKKMLLQEFFVGVSSGLLGEYNDAGFEAF 898

Query: 1092 --HNPXXXXXXXXXXXXXXXXXXXXXXXLYSIGLMRLICFMIQAFLDNNKLK-IEVDDSI 1148
               NP                           G ++++CF+++  L++ + + +  +D +
Sbjct: 899  SIKNPSKVYVDDYGEEFFSATSRKAEMS----GKVKMVCFILEEVLNDKEFEFVPHEDYV 954

Query: 1149 FELQTLLMNWITIIPEAKKLF 1169
            +EL+  LM W T   EA  ++
Sbjct: 955  YELKRFLMQWSTFSAEACSMY 975

>NDAI0G00900 Chr7 complement(187653..191492) [3840 bp, 1279 aa] {ON}
           Anc_3.497 YGR134W
          Length = 1279

 Score =  345 bits (886), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 200/440 (45%), Positives = 271/440 (61%), Gaps = 62/440 (14%)

Query: 312 NENEGAD------LNLLMDENSMGEHTLSFNLFENNINHGILHPDLMAHISKRHDILAKI 365
           N N+GAD      L+ + D     E   SF+L  NN     +  +LM +  KRH IL K+
Sbjct: 371 NRNDGADEYDDDYLHRIDDLKDGEEKVYSFDL--NNDGSITMPENLMLNTKKRHQILNKL 428

Query: 366 LNVGDNDKYYNSPLLHLQFKLLCALVDPLTQPTPNHKNIISIDLLFQLFLGFLKPELDRY 425
           LN   ++ + +SPLL LQFKL+  LVDPL+QP PN K+IIS+DLL+QLF+  L P  + +
Sbjct: 429 LN---SNSFDSSPLLELQFKLMLGLVDPLSQPPPNDKHIISLDLLYQLFIAILYPNFEIF 485

Query: 426 SSAEDGTNWKFLVCFNMEKIINSVMKKLNCVDFNTLNSI------NNSDESV-------- 471
            +   G NWK  VCF M KIIN+ M+KLNC D   L  +      NN +E +        
Sbjct: 486 QNNL-GFNWKTHVCFQMVKIINNCMEKLNCNDLQKLYDLTGFQGENNKEELLQQQQQQQQ 544

Query: 472 -----------HWRTQLHKWLPRGFNTQDLELLYMVNILATYTIYKLNEDLPIQLNPFLS 520
                      +WR+ L +WLP G NTQDLELLYMV ILA+YT+ KLN ++PIQLNPFL 
Sbjct: 545 QQQQTDRFVDGNWRSTLEQWLPHGLNTQDLELLYMVMILASYTLQKLNHEIPIQLNPFLP 604

Query: 521 SMVSHWKNLSCTILLGLEIDRLEEENETFDTPLIVRATVRSSTALRSIIATILNEHVNAF 580
           ++++ WK L+  ++LGL+IDR EE +ET+ TPL+V+AT+R ++ALRS++ATILN ++   
Sbjct: 605 TLINLWKKLTLILVLGLDIDRSEEAHETYKTPLLVKATIRGASALRSVVATILNNYMEYN 664

Query: 581 AHDFKHESLNTFMSPYGRKLCNGALYTDFRSHASTILALTGDLEHVTQLISDLQPGDRFD 640
            HDFKHE+LNTFMSP+GRKLCNGALY D +  A+++ AL  DL  +  L+S L+PGDRFD
Sbjct: 665 DHDFKHEALNTFMSPHGRKLCNGALYCDIKLFAASLYALGMDLIEIRNLLSYLEPGDRFD 724

Query: 641 EDVKYMFEFE--DYNTLPNVLGGEDDETSTDTLKNREMLKEIHNGNFIPXXXXXXXXXXX 698
           ED+ YMFE+E  DYN        E+ E    TLK+ +   +I                  
Sbjct: 725 EDINYMFEYEYDDYNAALK----ENHEDLGKTLKSNDDNSDI------------------ 762

Query: 699 XYLEQKLREMNCHRRCNCIF 718
            Y+  +++     RRCNCIF
Sbjct: 763 -YVLNEVKLDRYQRRCNCIF 781

 Score =  270 bits (689), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 173/471 (36%), Positives = 248/471 (52%), Gaps = 55/471 (11%)

Query: 823  FDFDYNGKDWRDTPRGMNLYYNLNYEFIEKPNLDLVFQLTLKATNMKLDKDDSNLLLRLV 882
            F+FDY+GKDWRD PRG N+YY+ +Y FI+  +LD +  LT KA+  KL+ DDS  LL+L+
Sbjct: 834  FEFDYSGKDWRDIPRGFNIYYSTSYSFIDDSSLDTMINLTSKASTQKLNHDDSIQLLQLL 893

Query: 883  ASSVKNEQDRIIFSDNQVSKEVKEIMEQNEDGVENEKLPHNKNRIENGNEKEIITEITPD 942
            ASS+K EQ+ +I  D          + + +D + +  +    N  E      ++   TPD
Sbjct: 894  ASSIKEEQNDMIMKD----------LLKGKDQLHSNIINPLVNSKEEKERSTVVA--TPD 941

Query: 943  DIYEIWCEESAFERMMQLNYEVTFRLMDEMLMCYGYRRVLIWFITHLELSHSVIHYIFEL 1002
            DI++ W ++  F  M+  N E+++RLMDEMLMC GYRRVLIW+ITH++L+HS+I YIFEL
Sbjct: 942  DIFDYWFDKDVFVEMLHFNEELSWRLMDEMLMCNGYRRVLIWYITHMKLNHSLIQYIFEL 1001

Query: 1003 VMGFRGTSEENG---ATEDKHTNTKGXXXXXXXXXXXXXXXXXXXDYSKIFD-LQLPFSR 1058
            +MG RG+   N      E  H    G                      KI D    PFSR
Sbjct: 1002 LMGLRGSPFANNNECKNELLHELMLG---------------------KKIVDNHTYPFSR 1040

Query: 1059 QGNIELSEIERKMLIQEFLTNAAIHFNERNNLKHNPXXXXXXXXXXXXXXXXXXXX---- 1114
            QG + LS+IE KML+QEF +NAAI+F+  N+L  N                         
Sbjct: 1041 QGPLILSDIETKMLLQEFFSNAAIYFD--NDLATNEGDGQLEHTTEDISINSDEIENNEN 1098

Query: 1115 -XXXLYSIGLMRLICFMIQAFLDNNKLKIEVDDSIFELQTLLMNWITIIPEAKKLFFXXX 1173
                +YS+GLM+LIC M+ + ++N K      D  FELQTLLMNWI I+ EAK+LFF   
Sbjct: 1099 HGVSMYSMGLMKLICIMVSSLIENKKFDFTKSDCNFELQTLLMNWIGILKEAKELFF--- 1155

Query: 1174 XXXXXXXXXXXXXXXXXXXXXXXXXXTIENQTSKDNNDKMDESSKVDSNSSFNKKLIELF 1233
                                      +I+++ S ++N K  E S++   + FNK+L+ L 
Sbjct: 1156 ----KLKSDIEETSESTDGGDDDDFESIDSRKSSESNGKW-EGSRIGKMNDFNKRLLRLL 1210

Query: 1234 PKM--SHTNKEENTAIDTLKNYLKKFRF-HQEVPIIGRKVIYEDGKILKIP 1281
              +    T+   +T     +  LK + F  +   + GRKV+Y D +IL +P
Sbjct: 1211 APIHSGDTDLNSDTVTTPFRGLLKNYSFTSKPKKVAGRKVVYTDDEILPLP 1261

 Score = 50.8 bits (120), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 62/236 (26%), Positives = 99/236 (41%), Gaps = 79/236 (33%)

Query: 18  YKPNIQLLETLIDYAKPDSEYLD----------SLLFESLILALFTTNCGLSVLNIISTL 67
           YKP I   E L D+ + +  +L+          S++ E+L++A FTT  G S+LN     
Sbjct: 85  YKPTI---ENLQDFLEDEHFFLEMRKIKKVKKFSIMLETLVIAYFTTKSGQSILN----- 136

Query: 68  KSFTNDKQKKNNLVPTTATAAVDSKHNKDENLDTTVIRNATATRNIIAKPNILKKQAHHP 127
             +  D ++K    P T         NK                       IL+K     
Sbjct: 137 --YLFDTKRK----PPTV-------QNK-----------------------ILRKT---- 156

Query: 128 KLLEKWRNDKITLLKFTKFILKNSNFPLNYNAFFDPVMKLPLEFLLLNDRFCSNDNNATS 187
                W  ++     F  F+++N N  +N + F +P  KL ++FLL            T 
Sbjct: 157 -----WEVNEFLYFCFIDFLIRNKNNEINIDKFNEPENKLSIKFLL------------TF 199

Query: 188 QKLFSIYNNTLLMDKNYNLLLDYLHVSTPLLISLLHT---NLDPLLFNNIISSYNK 240
             L +I   ++++D NYN+L DYL  ++  LI L+     N+ P  +N II  YN+
Sbjct: 200 HPLSNIETPSIILDSNYNMLTDYLDATSNWLILLIKMTILNVGPFFYNTII-RYNR 254

>TPHA0A05680 Chr1 (1285934..1289158) [3225 bp, 1074 aa] {ON}
           Anc_3.497 YGR134W
          Length = 1074

 Score =  320 bits (820), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 158/332 (47%), Positives = 223/332 (67%), Gaps = 11/332 (3%)

Query: 326 NSMGEHTLSFNLFENNINHGILHPDLMAHISKRHDILAKILNVGDNDKYY--NSPLLHLQ 383
           NS GE   S  +  N+ N+ I   DLM    +R +IL K+L      +    +  L+ L 
Sbjct: 260 NSFGEFQSS-AMLTNDENNSI---DLMKLTERRQNILYKVLIFSKLKQIEPESFQLMSLL 315

Query: 384 FKLLCALVDPLTQPTPNHKNIISIDLLFQLFLGFLKPELDRYSSAEDGTNWKFLVCFNME 443
           F  +CALVDPLTQP PN +++IS+DLL+++FL  + P +      E   +W++ +  N++
Sbjct: 316 FNRICALVDPLTQPIPNDEHVISLDLLYKIFLAMMLPHVQVLIERESSYDWRYEISNNLQ 375

Query: 444 KIINSVMKKLNCVDFNTLNSINNSDESVHWRTQLHKWLPRGFNTQDLELLYMVNILATYT 503
           KI+      LNC D   LN +   DE+ HW+ QLH WLP G N Q+LELLYM+ I   Y 
Sbjct: 376 KILFYAFLNLNCYDMEKLNKV---DETKHWKEQLHLWLPHGLNPQNLELLYMICIFCVYA 432

Query: 504 IYKLNEDLPIQLNPFLSSMVSHWKNLSCTILLGLEIDRLEEENETFDTPLIVRATVRSST 563
           I+KL ED P+  NPFL +++S WK L+  +L GL++DR EEENE+F+TP++VRAT+R ++
Sbjct: 433 IFKLYEDKPLHFNPFLPTLLSTWKKLTYVMLYGLQVDRFEEENESFNTPIMVRATIRGAS 492

Query: 564 ALRSIIATILNEHVNAFAHDFKHESLNTFMSPYGRKLCNGALYTDFRSHASTILALTGDL 623
           ALRS++A+ILN  ++   HDF+HE LNTFMSP+GRKLC GALY D +S+ +++LA   + 
Sbjct: 493 ALRSVVASILNNQMDGKKHDFQHEPLNTFMSPHGRKLCTGALYADLKSYTASMLACGMEF 552

Query: 624 EHVTQLISDLQPGDRFDEDVKYMFEFE--DYN 653
           + +T+L+S LQPGD FDEDVKYMFE+E  DYN
Sbjct: 553 KDITELLSYLQPGDCFDEDVKYMFEYEYDDYN 584

 Score =  231 bits (590), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 157/457 (34%), Positives = 231/457 (50%), Gaps = 77/457 (16%)

Query: 824  DFDYNGKDWRDTPRGMNLYYNLNYEFIEKPNLDLVFQLTLKATNMKLDKDDSNLLLRLVA 883
            +FD++GKDWR  PR +N++Y+ +Y FIE P   L+  L  +A+   L K  S+LLLR +A
Sbjct: 663  EFDFDGKDWRAVPRHLNMFYSFDYIFIENPLEVLIRSLISEASASALSKKKSHLLLRNIA 722

Query: 884  SSVKNEQDRIIFSDNQVSKEVKEIMEQNEDGVENEKLPHNKNRIENGNEKEIITEITPDD 943
            S +K  QD  I              +++ +G ++ K   ++N +  G   ++I  IT  D
Sbjct: 723  SVIKINQDSRILGS-----------KRSPNGTDSSK---SQNGLSTG---DLIKLITAGD 765

Query: 944  IYEIWCEESAFERMMQLNYEVTFRLMDEMLMCYGYRRVLIWFITHLELSHSVIHYIFELV 1003
                      FE +++ N E+   LMDE+LM  GYRRVL+WF+THL LSH++I+YIFEL+
Sbjct: 766  ---------TFENILKFNRELGCFLMDELLMILGYRRVLLWFLTHLTLSHTIIYYIFELL 816

Query: 1004 MGFRGTSEENGATEDKHTNTKGXXXXXXXXXXXXXXXXXXXDYSKIFDLQLPFSRQGNIE 1063
            M  RG   +   TE + +                             +L   FSRQG + 
Sbjct: 817  MHHRGQVSD---TEREQS-----------------------------ELSYTFSRQGELR 844

Query: 1064 LSEIERKMLIQEFLTNAAIHFNERNNLKHNPXXXXXXXXXXXXXXXXXXXXXXXLYSIGL 1123
            LS++ER+ML+QEF TNA + F+ ++ L                           LY++GL
Sbjct: 845  LSDLEREMLLQEFFTNATMFFSSKSVL----FASDTGDNNEINTDVDGEEGLYSLYAVGL 900

Query: 1124 MRLICFMIQAFLDNNKLKIEVDDSIFELQTLLMNWITIIPEAKKLFFXXXXXXXXXXXXX 1183
            MR+ C MI +  DN    +   +SIFELQTLLM WI IIPEAK LFF             
Sbjct: 901  MRVTCIMIISLFDNADFDLSSSESIFELQTLLMGWINIIPEAKLLFF-----------KL 949

Query: 1184 XXXXXXXXXXXXXXXXTIENQTSKDNNDKMDESSKVDSNSSFNKKLIELFPKMSHTNKEE 1243
                            +IE  ++      +DE+S+      FNKKL++ FPK S +  + 
Sbjct: 950  KESVKSFNGIDNPELKSIEESSTTTKKTTIDENSE---QYRFNKKLLKTFPK-SFSGDDG 1005

Query: 1244 NTAIDTLKNYLKKFRFHQEVPIIGRKVIYEDGKILKI 1280
            +  + T K++L+ + F  E P IGRKVIYE  +IL++
Sbjct: 1006 DILLKTFKDFLRNYSFDSEPPYIGRKVIYESDEILQL 1042

>CAGL0C00110g Chr3 complement(2137..4284) [2148 bp, 715 aa] {ON}
           some similarities with uniprot|P36170 Saccharomyces
           cerevisiae YKR102w FLO10
          Length = 715

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 51/115 (44%), Gaps = 12/115 (10%)

Query: 316 GADLNLLMDENSMGEHTLSFNLFENNIN----HGILHPDLMAHISKRHDILAKILNVGDN 371
           G   N+   +N +     S++  ++  N       L P+      K H +LAK+ NV  N
Sbjct: 49  GCSPNVTTPKNGLSMELYSYDYLKSGSNPCWDAAYLDPNYPRTGYKSHRLLAKVENVAGN 108

Query: 372 -DKYYNSPLLHLQFKLLCALVDPLTQPTPNHKNIISIDLLFQLFLGFLKPELDRY 425
            + YY++P+         +L D L Q   N++  +++     L  G+ KP++  Y
Sbjct: 109 INFYYHAPM------GCTSLFDTLPQAY-NYRTPLTMTNFTMLLYGYFKPKVTGY 156

>KLLA0D10351g Chr4 (873366..875945) [2580 bp, 859 aa] {ON} similar
           to uniprot|Q04500 Saccharomyces cerevisiae YML093W UTP14
           Nucleolar protein component of the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 859

 Score = 34.7 bits (78), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 35/59 (59%), Gaps = 5/59 (8%)

Query: 631 SDLQPGDRFDEDVKYMFEFEDYNTL--PNVLGGEDDETSTDTL-KNREMLKEIHNGNFI 686
           S  +P    DEDV  + + ED NTL   +  GG DDETST+T+ K +E++ +   G+ +
Sbjct: 669 SKKKPSSTKDEDV--LLDLEDSNTLNIVDAYGGSDDETSTNTMFKQQEVIADAFAGDDV 725

>KNAG0E02770 Chr5 (557579..559105) [1527 bp, 508 aa] {ON} Anc_6.8
           YPL272C
          Length = 508

 Score = 33.5 bits (75), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 36/79 (45%), Gaps = 5/79 (6%)

Query: 663 DDETSTDTLKNREMLKEIHNGNFIPXXXXXXXXXXXXYLEQKLREMNCHRRCNCIFSDDE 722
           DD+ S D +K   + +E  +   +             +LEQ+L      R     F+DD+
Sbjct: 357 DDDKSKDCMKGASVSEEDFDEKLMEYQFKNITGFVRNHLEQRLT-----RFSKTGFNDDD 411

Query: 723 IKDTSISDKNYMGNSSSNG 741
           I+     DKN +G SS+NG
Sbjct: 412 IRRMKFDDKNTLGGSSNNG 430

>Kpol_529.12 s529 (24687..28028) [3342 bp, 1113 aa] {ON}
           (24687..28028) [3342 nt, 1114 aa]
          Length = 1113

 Score = 33.5 bits (75), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 58/101 (57%), Gaps = 12/101 (11%)

Query: 822 IFDFDYNG---KDWRDTPRGMNLYYNLNYEFIEKPNLDLVF-QLTLKATNMKLDKDDSNL 877
           IF+ + NG    D   TPR  +  + ++  F E  + D ++ Q+   ++N+ L    +  
Sbjct: 416 IFNEEKNGVKNTDSSPTPRDRDQNW-ISNSFYESASPDKIYLQI---SSNIDLTSSQNGD 471

Query: 878 LLRLVASSVKNEQDRIIFSDNQVSKEVKEIMEQNEDGVENE 918
           L++      K+ ++++IFS+ ++++E+ E+ EQNED ++N+
Sbjct: 472 LVK----GAKDCEEKVIFSEAEMTQELPEVEEQNEDELKNK 508

>TDEL0H00980 Chr8 (159829..172068) [12240 bp, 4079 aa] {ON} Anc_1.216
            YKR054C
          Length = 4079

 Score = 33.5 bits (75), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%)

Query: 97   ENLDTTVIRNATATRNIIAKPNILKKQAHHPKLLEKWRNDKITLLKFTKFI 147
            E LD+ +I +     +I+A   ILK++  H  L+   R  K TL+KF  +I
Sbjct: 2709 EQLDSQLIVHEEMLNHILAIDRILKQRQGHAMLIGARRTGKTTLVKFVSWI 2759

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 146,975,367
Number of extensions: 7109227
Number of successful extensions: 32471
Number of sequences better than 10.0: 113
Number of HSP's gapped: 33672
Number of HSP's successfully gapped: 185
Length of query: 1307
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1185
Effective length of database: 39,492,147
Effective search space: 46798194195
Effective search space used: 46798194195
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 72 (32.3 bits)