Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0C045003.495ON1651658471e-117
NDAI0G009103.495ON1631603731e-45
Kpol_480.133.495ON1571523722e-45
CAGL0I10450g3.495ON1621643636e-44
TDEL0D056303.495ON1501523616e-44
TPHA0D042603.495ON1581523592e-43
NCAS0E007803.495ON1711703542e-42
YGR133W (PEX4)3.495ON1831593361e-39
Suva_7.4213.495ON1651593342e-39
Skud_7.4443.495ON1621593332e-39
ZYRO0D09878g3.495ON1531523322e-39
AFR314W3.495ON1551613289e-39
Smik_6.2293.495ON1651593228e-38
KAFR0C019903.495ON1511553192e-37
KLTH0F14894g3.495ON1661533193e-37
SAKL0F02706g3.495ON1611553175e-37
Kwal_55.212463.495ON1601523166e-37
KNAG0B007803.495ON1531503156e-37
Ecym_12343.495ON1611502974e-34
KLLA0E04027g3.495ON1581552211e-22
ADR169C8.375ON2111332111e-20
Ecym_60388.375ON2111642111e-20
KAFR0C002703.308ON1471522034e-20
NCAS0B031508.375ON2141442004e-19
TBLA0H031308.375ON2141582005e-19
KAFR0B060608.375ON2131442005e-19
Suva_4.3263.308ON1481391956e-19
TPHA0L008508.375ON2161422006e-19
Skud_4.4418.375ON2151441997e-19
KLTH0E14300g3.308ON1471541957e-19
SAKL0B06512g3.308ON1471541957e-19
AER173C3.308ON1471541957e-19
KLLA0E12563g3.308ON1481411957e-19
Kpol_1052.23.308ON1481541958e-19
Suva_2.3438.375ON2151441998e-19
Smik_4.4258.375ON2151441998e-19
Ecym_74313.308ON1471541948e-19
YDR177W (UBC1)8.375ON2151441989e-19
KNAG0A048108.375ON2141441981e-18
TPHA0A038503.308ON1481541931e-18
CAGL0E04752g3.308ON1471391932e-18
ZYRO0G12870g3.308ON1471411922e-18
TDEL0F021003.308ON1471411922e-18
KLTH0A07546g8.375ON2151541962e-18
Skud_2.2073.308ON1481251912e-18
Smik_2.2193.308ON1481251912e-18
YBR082C (UBC4)3.308ON1481251912e-18
Kpol_1030.108.375ON2151421952e-18
CAGL0E00671g8.375ON2131441952e-18
Suva_2.2183.308ON1481521913e-18
Skud_4.3143.308ON1481521913e-18
YDR059C (UBC5)3.308ON1481521913e-18
ZYRO0C03784g8.375ON2181441953e-18
TBLA0I021303.308ON1481541913e-18
Smik_4.2973.308ON1481521904e-18
NDAI0A054903.308ON1471251894e-18
NCAS0A108003.308ON1481251894e-18
KNAG0J023403.308ON1611221889e-18
TDEL0F049908.375ON2171421902e-17
Suva_5.531.436ON2151351892e-17
KLLA0C18656g8.375ON2281431892e-17
YEL012W (UBC8)1.436ON2181351883e-17
Smik_5.981.436ON2151351883e-17
Skud_5.871.436ON2101351857e-17
NDAI0A011608.375ON2161441857e-17
Kpol_461.86.109ON1671061828e-17
SAKL0A00396g8.375ON2151421859e-17
Kwal_23.64858.375ON2151541859e-17
SAKL0A07260g6.109ON1691061821e-16
Ecym_30776.109ON1701061821e-16
YGL058W (RAD6)6.109ON1721061821e-16
TDEL0G036106.109ON1691061821e-16
ZYRO0C04950g6.109ON1681061821e-16
TPHA0J017506.109ON1691061821e-16
Kwal_27.124013.308ON2361241851e-16
AAR156C6.109ON1701061821e-16
Smik_7.2226.109ON1711061821e-16
Suva_7.2136.109ON1731061821e-16
TBLA0F024406.109ON1741061811e-16
ZYRO0D04466g7.54ON1591321792e-16
KLLA0C05632g6.109ON164991792e-16
KNAG0H018701.436ON2101391822e-16
KAFR0H029601.436ON1871351794e-16
CAGL0I00352g6.109ON1671061774e-16
NCAS0D032206.109ON1711061774e-16
NDAI0E038707.54ON1641081775e-16
KNAG0F025706.109ON1511061765e-16
CAGL0M03399g1.436ON2141391805e-16
NDAI0D011401.436ON2451351815e-16
KLTH0H06732g6.109ON1601061765e-16
KAFR0A047006.109ON1531061757e-16
TDEL0B056701.436ON2031391779e-16
Kwal_14.18286.109ON1521061749e-16
NCAS0G031301.436ON2311351771e-15
Skud_7.2226.109ON1701061741e-15
ZYRO0E03806g1.436ON2091351725e-15
Kpol_1030.181.436ON2231351727e-15
KLLA0A11198g1.436ON2021391682e-14
TBLA0A012901.436ON2191351683e-14
NDAI0I016506.109ON1761061653e-14
Ecym_13481.436ON2111351673e-14
TDEL0H039707.54ON1561351635e-14
KAFR0H012303.308ON110931605e-14
TPHA0O009201.436ON2261281665e-14
YOR339C (UBC11)7.54ON1561041626e-14
Kpol_1065.127.54ON1591231627e-14
SAKL0D10560g1.436ON2071391648e-14
Skud_15.5047.54ON1561171601e-13
ZYRO0B11682g8.230ON1511301582e-13
TBLA0F037908.230ON1511311582e-13
AEL045W1.436ON2111391612e-13
KLLA0C17622g8.230ON1591321583e-13
Suva_8.3897.54ON1561381583e-13
Kpol_1075.1b8.230ON1521551573e-13
AGR121C8.230ON154931565e-13
KNAG0H029808.230ON1521571565e-13
SAKL0H17930g8.230ON1531011557e-13
YDR092W (UBC13)8.230ON1531591531e-12
Kwal_34.161741.436ON2131391561e-12
Ecym_55638.230ON164921531e-12
Smik_15.5177.54ON1561041522e-12
TBLA0H026102.569ON1651401522e-12
Skud_4.3528.230ON1431251502e-12
TDEL0A013408.230ON1571311504e-12
CAGL0G08063g8.230ON1491431494e-12
KLTH0G14366g8.230ON1491331494e-12
Kwal_56.234828.230ON1491011495e-12
KAFR0A024208.230ON1471111485e-12
NCAS0B040108.230ON1531301485e-12
NDAI0J015408.230ON1541311486e-12
KLTH0H13816g1.436ON2331351527e-12
Suva_2.2538.230ON1431281478e-12
Smik_4.3358.230ON1431021469e-12
ABR059W2.569ON1651401471e-11
ZYRO0E06358g2.569ON1651401471e-11
KNAG0M021502.569ON1701111443e-11
SAKL0B10582g7.54ON1611231443e-11
Ecym_45782.569ON1651401443e-11
TPHA0B034108.230ON1521311424e-11
KLTH0D01760g7.54ON1611211417e-11
Kpol_1056.52.569ON1651401382e-10
Smik_4.1714.249ON1571021382e-10
TBLA0E015704.49ON194961392e-10
TPHA0B007704.249ON1571211372e-10
KAFR0A021602.569ON1651581364e-10
KNAG0D043904.249ON1571091354e-10
Kwal_26.70097.54ON1611131364e-10
TDEL0B065702.569ON1651401365e-10
YDL064W (UBC9)4.249ON1571021355e-10
Suva_4.1864.249ON1571021346e-10
NCAS0I014303.301ON2581151387e-10
CAGL0D00814g4.249ON1571091348e-10
Kwal_26.82242.569ON1651401331e-09
SAKL0D13552g2.569ON1651401331e-09
NCAS0A059404.49ON1931151341e-09
Skud_4.1914.249ON1571021321e-09
KLTH0D07986g2.569ON1651401322e-09
Kpol_483.164.249ON1221221292e-09
TPHA0I024602.569ON1671441312e-09
KLLA0E07745g2.569ON1651401303e-09
NDAI0A075703.301ON2391101323e-09
TBLA0I029604.249ON1571141293e-09
Smik_13.1862.569ON1651401294e-09
CAGL0M07568g2.569ON1651181294e-09
Suva_13.1892.569ON1651401294e-09
KLLA0E05039g4.249ON1571211285e-09
KAFR0G032404.249ON1571301285e-09
YMR022W (UBC7)2.569ON1651401285e-09
TDEL0E012204.249ON1571021286e-09
ZYRO0B12386g4.249ON1571211286e-09
Skud_13.1762.569ON1651401286e-09
KLTH0D14344g4.249ON1571201276e-09
NCAS0A024904.249ON1571261261e-08
SAKL0H03058g4.249ON1571211252e-08
Kwal_23.42274.249ON1221161232e-08
Smik_12.3894.49ON1871101252e-08
NCAS0A127402.569ON1651401224e-08
NDAI0D043804.249ON1571021215e-08
Suva_10.4014.49ON1871091226e-08
AER056C4.249ON1571021208e-08
Ecym_32704.249ON1571021208e-08
NDAI0B015202.569ON1651581191e-07
KAFR0F030404.49ON1691291172e-07
Kwal_27.104443.301ON2781431192e-07
KLTH0C04818g3.301ON2751431193e-07
CAGL0D06468g4.49ON1871171164e-07
NDAI0A055303.301ON2731611184e-07
AGL203C3.301ON2701591175e-07
NCAS0A107703.301ON2731591175e-07
Kpol_1045.397.392ON253961141e-06
KNAG0H010403.301ON296991141e-06
Ecym_26693.301ON268991141e-06
Skud_12.3894.49ON1871131121e-06
TDEL0E055604.49ON1871461121e-06
CAGL0E04598g3.301ON2951151141e-06
ZYRO0G12650g3.301ON2851011132e-06
KAFR0H012703.301ON2871011132e-06
KLLA0E20395g7.392ON2511241132e-06
TBLA0G032703.301ON3301151132e-06
YLR306W (UBC12)4.49ON188971112e-06
Kpol_1065.453.301ON3231011132e-06
TBLA0D006007.392ON256891122e-06
KLLA0D09196g3.301ON2921371123e-06
SAKL0D02530g3.301ON272991113e-06
KNAG0I029404.49ON1971101093e-06
KLLA0C17248g4.49ON184971084e-06
Skud_4.3063.301ON2971431104e-06
Smik_4.2903.301ON2971431105e-06
YDR054C (CDC34)3.301ON2951431105e-06
TDEL0D032603.301ON289991095e-06
Ecym_46837.392ON2431151096e-06
TPHA0M012803.301ON4351231096e-06
Suva_2.2113.301ON297991096e-06
Smik_5.2467.392ON2501141088e-06
NCAS0E026007.392ON2551121079e-06
SAKL0H24112g4.49ON1851041061e-05
Ecym_83714.49ON267871071e-05
KNAG0J022803.301ON2171381061e-05
ADL035C4.49ON200871042e-05
Suva_5.2197.392ON2491141052e-05
KAFR0L017507.392ON2511141052e-05
TPHA0K008207.392ON2571471043e-05
TPHA0F003904.49ON1931141023e-05
NDAI0D029104.49ON1891111023e-05
YER100W (UBC6)7.392ON2501141033e-05
NDAI0E041707.392ON257831034e-05
Skud_5.2257.392ON2501141024e-05
SAKL0F12474g7.392ON2511231024e-05
ZYRO0B03344g7.392ON2501181025e-05
TDEL0G015806.187ON138130986e-05
NDAI0A016507.392ON251851016e-05
CAGL0I05478g7.392ON2461161009e-05
Kpol_YGOB_414.24.49ON19397999e-05
TDEL0C015507.392ON248911009e-05
Kpol_414.2singletonOFF19297999e-05
Kwal_27.108377.392ON2461151001e-04
NCAS0D036606.187ON138144971e-04
KNAG0F021306.187ON138143961e-04
SAKL0A05192g6.187ON14059952e-04
CAGL0H03157g6.187ON139142952e-04
KLTH0C06688g7.392ON24685972e-04
Suva_7.1826.187ON13789952e-04
NCAS0A143907.392ON240113972e-04
KLTH0H04796g6.187ON138125942e-04
Ecym_22306.187ON138123942e-04
ZYRO0G19910g4.49ON179107953e-04
KAFR0C021406.187ON138126933e-04
KNAG0B023607.392ON25184953e-04
Skud_7.1956.187ON10089906e-04
Smik_7.1966.187ON10089896e-04
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0C04500
         (165 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3....   330   e-117
NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON...   148   1e-45
Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON} ...   147   2e-45
CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa] ...   144   6e-44
TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3....   143   6e-44
TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.49...   142   2e-43
NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON...   140   2e-42
YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}  PEX4Peroxis...   134   1e-39
Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W (...   133   2e-39
Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W (...   132   2e-39
ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {O...   132   2e-39
AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic h...   130   9e-39
Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W (...   128   8e-38
KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.49...   127   2e-37
KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} simil...   127   3e-37
SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {O...   126   5e-37
Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W...   126   6e-37
KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON...   125   6e-37
Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON} ...   119   4e-34
KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {O...    90   1e-22
ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON} ...    86   1e-20
Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to A...    86   1e-20
KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {O...    83   4e-20
NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON}      82   4e-19
TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.37...    82   5e-19
KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8....    82   5e-19
Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 b...    80   6e-19
TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.3...    82   6e-19
Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W (...    81   7e-19
KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936) ...    80   7e-19
SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444...    80   7e-19
AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON} Sy...    80   7e-19
KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 1...    80   7e-19
Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON} ...    80   8e-19
Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W (...    81   8e-19
Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W (...    81   8e-19
Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON} ...    79   8e-19
YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}  UBC1Ubiquit...    81   9e-19
KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON...    81   1e-18
TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa...    79   1e-18
CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {O...    79   2e-18
ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431) ...    79   2e-18
TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa...    79   2e-18
KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly ...    80   2e-18
Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 b...    78   2e-18
Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 b...    78   2e-18
YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, ...    78   2e-18
Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON...    80   2e-18
CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}...    80   2e-18
Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 b...    78   3e-18
Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 b...    78   3e-18
YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, ...    78   3e-18
ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly ...    80   3e-18
TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 ...    78   3e-18
Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 b...    78   4e-18
NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 14...    77   4e-18
NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [...    77   4e-18
KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {O...    77   9e-18
TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.37...    78   2e-17
Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 21...    77   2e-17
KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highl...    77   2e-17
YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {O...    77   3e-17
Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa] ...    77   3e-17
Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W (R...    76   7e-17
NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON}      76   7e-17
Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..148...    75   8e-17
SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}...    76   9e-17
Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177...    76   9e-17
SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 a...    75   1e-16
Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to...    75   1e-16
YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}  RAD6Ubiquit...    75   1e-16
TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa...    75   1e-16
ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 a...    75   1e-16
TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {O...    75   1e-16
Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa] ...    76   1e-16
AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON} Sy...    75   1e-16
Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W (...    75   1e-16
Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W (...    75   1e-16
TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON...    74   1e-16
ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {O...    74   2e-16
KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {O...    74   2e-16
KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON...    75   2e-16
KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON...    74   4e-16
CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly si...    73   4e-16
NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109      73   4e-16
NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON...    73   5e-16
KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.10...    72   5e-16
CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {...    74   5e-16
NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa...    74   5e-16
KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 a...    72   5e-16
KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.10...    72   7e-16
TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1....    73   9e-16
Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W ...    72   9e-16
NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON}                73   1e-15
Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W (...    72   1e-15
ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 a...    71   5e-15
Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa] ...    71   7e-15
KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609...    69   2e-14
TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 ...    69   3e-14
NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON}      68   3e-14
Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp...    69   3e-14
TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON...    67   5e-14
KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.30...    66   5e-14
TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.4...    69   5e-14
YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}  ...    67   6e-14
Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON} (25814.....    67   7e-14
SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {O...    68   8e-14
Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {O...    66   1e-13
ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly ...    65   2e-13
TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49...    65   2e-13
AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {O...    67   2e-13
KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 1...    65   3e-13
Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}...    65   3e-13
Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..195...    65   3e-13
AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, ...    65   5e-13
KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa...    65   5e-13
SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741) ...    64   7e-13
YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {O...    64   1e-12
Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W...    65   1e-12
Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 ...    64   1e-12
Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {O...    63   2e-12
TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON...    63   2e-12
Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W (...    62   2e-12
TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 ...    62   4e-12
CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly ...    62   4e-12
KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 1...    62   4e-12
Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {O...    62   5e-12
KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON...    62   5e-12
NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 ...    62   5e-12
NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465...    62   6e-12
KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012) ...    63   7e-12
Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W (...    61   8e-12
Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W (...    61   9e-12
ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic hom...    61   1e-11
ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly ...    61   1e-11
KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.5...    60   3e-11
SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {O...    60   3e-11
Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON...    60   3e-11
TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON...    59   4e-11
KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly ...    59   7e-11
Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON} c...    58   2e-10
Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]...    58   2e-10
TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 ...    58   2e-10
TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.24...    57   2e-10
KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.56...    57   4e-10
KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON...    57   4e-10
Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C ...    57   4e-10
TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2....    57   5e-10
YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {O...    57   5e-10
Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]...    56   6e-10
NCAS0I01430 Chr9 (264456..265232) [777 bp, 258 aa] {ON}                58   7e-10
CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly si...    56   8e-10
Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W ...    56   1e-09
SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highl...    56   1e-09
NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49     56   1e-09
Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]...    55   1e-09
KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly ...    55   2e-09
Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON} ...    54   2e-09
TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.56...    55   2e-09
KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {O...    55   3e-09
NDAI0A07570 Chr1 complement(1734788..1735507) [720 bp, 239 aa] {...    55   3e-09
TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 ...    54   3e-09
Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W...    54   4e-09
CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {...    54   4e-09
Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W...    54   4e-09
KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly ...    54   5e-09
KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON...    54   5e-09
YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiqui...    54   5e-09
TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.24...    54   6e-09
ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa] ...    54   6e-09
Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W...    54   6e-09
KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413) ...    54   6e-09
NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 ...    53   1e-08
SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 a...    53   2e-08
Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W ...    52   2e-08
Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W...    53   2e-08
NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2....    52   4e-08
NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 15...    51   5e-08
Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W...    52   6e-08
AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, ...    51   8e-08
Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa] ...    51   8e-08
NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON...    50   1e-07
KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON...    50   2e-07
Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C...    50   2e-07
KLTH0C04818g Chr3 (416167..416994) [828 bp, 275 aa] {ON} highly ...    50   3e-07
CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar...    49   4e-07
NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3....    50   4e-07
AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON} Sy...    50   5e-07
NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {...    50   5e-07
Kpol_1045.39 s1045 complement(92062..92823) [762 bp, 253 aa] {ON...    49   1e-06
KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON}                49   1e-06
Ecym_2669 Chr2 (1289437..1290243) [807 bp, 268 aa] {ON} similar ...    49   1e-06
Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W...    48   1e-06
TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [...    48   1e-06
CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {O...    49   1e-06
ZYRO0G12650g Chr7 complement(1002296..1003153) [858 bp, 285 aa] ...    48   2e-06
KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON}                48   2e-06
KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} simil...    48   2e-06
TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON...    48   2e-06
YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {...    47   2e-06
Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON} (12142...    48   2e-06
TBLA0D00600 Chr4 complement(156677..157447) [771 bp, 256 aa] {ON...    48   2e-06
KLLA0D09196g Chr4 (772795..773673) [879 bp, 292 aa] {ON} similar...    48   3e-06
SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly ...    47   3e-06
KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa...    47   3e-06
KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa] ...    46   4e-06
Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}...    47   4e-06
Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}...    47   5e-06
YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}  C...    47   5e-06
TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.30...    47   5e-06
Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON...    47   6e-06
TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {...    47   6e-06
Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}...    47   6e-06
Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W (...    46   8e-06
NCAS0E02600 Chr5 complement(519792..520559) [768 bp, 255 aa] {ON...    46   9e-06
SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 1...    45   1e-05
Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to...    46   1e-05
KNAG0J02280 Chr10 complement(424795..425448) [654 bp, 217 aa] {O...    45   1e-05
ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, ...    45   2e-05
Suva_5.219 Chr5 (333753..334502) [750 bp, 249 aa] {ON} YER100W (...    45   2e-05
KAFR0L01750 Chr12 (320295..321050) [756 bp, 251 aa] {ON} Anc_7.3...    45   2e-05
TPHA0K00820 Chr11 complement(172380..173153) [774 bp, 257 aa] {O...    45   3e-05
TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, ...    44   3e-05
NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49       44   3e-05
YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}  UBC6Ubiquit...    44   3e-05
NDAI0E04170 Chr5 complement(940288..941061) [774 bp, 257 aa] {ON...    44   4e-05
Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W (...    44   4e-05
SAKL0F12474g Chr6 (974485..975240) [756 bp, 251 aa] {ON} similar...    44   4e-05
ZYRO0B03344g Chr2 (278107..278859) [753 bp, 250 aa] {ON} similar...    44   5e-05
TDEL0G01580 Chr7 (311978..311988,312055..312460) [417 bp, 138 aa...    42   6e-05
NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON...    44   6e-05
CAGL0I05478g Chr9 complement(518933..519673) [741 bp, 246 aa] {O...    43   9e-05
Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, ...    43   9e-05
TDEL0C01550 Chr3 complement(267010..267756) [747 bp, 248 aa] {ON...    43   9e-05
Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF} co...    43   9e-05
Kwal_27.10837 s27 complement(519750..520490) [741 bp, 246 aa] {O...    43   1e-04
NCAS0D03660 Chr4 complement(683552..683957,684062..684072) [417 ...    42   1e-04
KNAG0F02130 Chr6 (405648..406064) [417 bp, 138 aa] {ON} Anc_6.18...    42   1e-04
SAKL0A05192g Chr1 (468949..468959,469039..469450) [423 bp, 140 a...    41   2e-04
CAGL0H03157g Chr8 complement(297272..297680,297881..297891) [420...    41   2e-04
KLTH0C06688g Chr3 complement(581697..582437) [741 bp, 246 aa] {O...    42   2e-04
Suva_7.182 Chr7 complement(339292..339694,339786..339796) [414 b...    41   2e-04
NCAS0A14390 Chr1 (2833944..2834666) [723 bp, 240 aa] {ON} Anc_7....    42   2e-04
KLTH0H04796g Chr8 (428760..428770,428834..429239) [417 bp, 138 a...    41   2e-04
Ecym_2230 Chr2 (447891..447901,447985..448390) [417 bp, 138 aa] ...    41   2e-04
ZYRO0G19910g Chr7 (1650667..1651206) [540 bp, 179 aa] {ON} simil...    41   3e-04
KAFR0C02140 Chr3 complement(427907..428312,428412..428422) [417 ...    40   3e-04
KNAG0B02360 Chr2 complement(462478..463233) [756 bp, 251 aa] {ON...    41   3e-04
Skud_7.195 Chr7 complement(349627..349929) [303 bp, 100 aa] {ON}...    39   6e-04
Smik_7.196 Chr7 complement(340809..341111) [303 bp, 100 aa] {ON}...    39   6e-04
YGL087C Chr7 complement(346406..346808,346894..346904) [414 bp, ...    40   7e-04
ZYRO0G08228g Chr7 complement(670807..671212,671271..671281) [417...    40   7e-04
NDAI0I01230 Chr9 (296124..296160,296450..296886) [474 bp, 157 aa...    40   8e-04
Kwal_27.11182 s27 complement(675053..675358) [306 bp, 101 aa] {O...    39   9e-04
AGR372W Chr7 (1420314..1421042) [729 bp, 242 aa] {ON} Syntenic h...    40   0.001
KLLA0E19119g Chr5 complement(1702717..1703125,1703226..1703236) ...    39   0.001
TPHA0J02250 Chr10 complement(501615..502017,502181..502191) [414...    39   0.002
AFL064W Chr6 (314210..314220,314273..314678) [417 bp, 138 aa] {O...    37   0.004
KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555...    37   0.006
Kpol_1002.65 s1002 (176569..176874) [306 bp, 101 aa] {ON} (17656...    35   0.012
TBLA0A01900 Chr1 complement(463994..464402,464500..464510) [420 ...    34   0.065
TDEL0A04490 Chr1 (799756..800190) [435 bp, 144 aa] {ON} Anc_5.58...    30   2.4  
Suva_7.66 Chr7 (120034..124503) [4470 bp, 1489 aa] {ON} YGL197W ...    30   2.6  
Suva_10.578 Chr10 complement(1011107..1012066) [960 bp, 319 aa] ...    30   3.1  
Kpol_1065.19 s1065 (49733..50458) [726 bp, 241 aa] {ON} (49733.....    30   3.1  
KAFR0G03600 Chr7 (742036..743955) [1920 bp, 639 aa] {ON} Anc_6.1...    30   4.3  
KNAG0C00950 Chr3 complement(180863..182335) [1473 bp, 490 aa] {O...    29   6.7  
CAGL0J05412g Chr10 complement(517428..519347) [1920 bp, 639 aa] ...    28   8.7  

>TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3.495
           YGR133W
          Length = 165

 Score =  330 bits (847), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 165/165 (100%), Positives = 165/165 (100%)

Query: 1   MSRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHI 60
           MSRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHI
Sbjct: 1   MSRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHI 60

Query: 61  PTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAY 120
           PTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAY
Sbjct: 61  PTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAY 120

Query: 121 PDPSSPLNIDLSRLLTLKDSKAYNSLIKYYLYNFPKPELICDCEI 165
           PDPSSPLNIDLSRLLTLKDSKAYNSLIKYYLYNFPKPELICDCEI
Sbjct: 121 PDPSSPLNIDLSRLLTLKDSKAYNSLIKYYLYNFPKPELICDCEI 165

>NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON}
           Anc_3.495
          Length = 163

 Score =  148 bits (373), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 108/160 (67%), Gaps = 11/160 (6%)

Query: 1   MSRIIKEYNHIRK-LNALPDN--------MTTLHPVSNATSDLSNWHSIILGPKDSPYHN 51
           MSRIIKEY  I+K LN   +N        + +L P+ +   DL+ W ++I GP+ +PY+ 
Sbjct: 1   MSRIIKEYKTIQKQLNNNRNNQDDEFNNIIVSLAPI-DPDQDLTKWEAVIKGPQGTPYYG 59

Query: 52  KSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSV 111
            +F+L I IP EYP++PP  +F   S+P HCNVN+ TGEICL+ILK ++W+PVWNL+ ++
Sbjct: 60  FNFILYITIPQEYPTVPPFFEFQPRSMP-HCNVNYNTGEICLDILKQDHWTPVWNLMSTL 118

Query: 112 QAIIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSLIKYYL 151
           +AI  LL  P P SPLN+DL+ LL   D  AYN LI YYL
Sbjct: 119 KAIWLLLKDPVPESPLNVDLANLLRFGDLSAYNGLINYYL 158

>Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON}
           complement(27113..27586) [474 nt, 158 aa]
          Length = 157

 Score =  147 bits (372), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 79/152 (51%), Positives = 104/152 (68%), Gaps = 4/152 (2%)

Query: 3   RIIKEYNHIRK-LNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIP 61
           R++KEY  ++K L    + +++L P+   + DL+NW + ILGP ++PYH  SF L IH+ 
Sbjct: 5   RLLKEYQVVKKELGNHKNIISSLEPID--SDDLTNWTATILGPPNTPYHGHSFDLRIHLT 62

Query: 62  TEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYP 121
            EYP  PP + F+   +P HCN+ F TG+ICLNIL N NWSPVWNLL  V AI QLL+ P
Sbjct: 63  PEYPLKPPQVTFSAYKMP-HCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121

Query: 122 DPSSPLNIDLSRLLTLKDSKAYNSLIKYYLYN 153
              SPLNIDLS +L +KD+ AY  LI+YYL N
Sbjct: 122 VTDSPLNIDLSNILKIKDTSAYYGLIEYYLNN 153

>CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa]
           {ON} similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133w ubiquitin-conjugating enzyme - peroxin
          Length = 162

 Score =  144 bits (363), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 75/164 (45%), Positives = 103/164 (62%), Gaps = 9/164 (5%)

Query: 1   MSRIIKEYNHIRKLNALPDN--MTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEI 58
           M+RI KE   IRK     D+  +  L PV +  SDLS W ++I GP ++PY+   F L I
Sbjct: 1   MARISKELLKIRKALEHGDSEFLVDLAPVDD--SDLSRWFAVIKGPAETPYYPYEFKLAI 58

Query: 59  HIPTEYPSIPPVIKFNKNS-----IPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQA 113
            +P  YP +PP IKF  ++     +PPHCNV+  TGEICL+ILK E WSP+W++L+ VQA
Sbjct: 59  EVPASYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQA 118

Query: 114 IIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSLIKYYLYNFPKP 157
           I  LL  P P SPL++D++ +L   D  AYN +I+Y+L     P
Sbjct: 119 IHILLQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLTEIDSP 162

>TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3.495
           YGR133W
          Length = 150

 Score =  143 bits (361), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 98/152 (64%), Gaps = 5/152 (3%)

Query: 1   MSRIIKEYNHIRK-LNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIH 59
           M+RI +EY HI+  L +    + +L P+     DLS W   I GP  +PY   +F L + 
Sbjct: 1   MARIAREYKHIQATLGSESSLVVSLEPIDG---DLSRWAGEIRGPTGTPYEGHTFSLRLV 57

Query: 60  IPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLA 119
           +   YP+ PP + F + S+P HCNVN+ TG ICLNIL  E+WSP W+LL+ ++AIIQLL+
Sbjct: 58  LGDRYPTTPPQVTFARRSMP-HCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLS 116

Query: 120 YPDPSSPLNIDLSRLLTLKDSKAYNSLIKYYL 151
            P+P SPL+IDL+ +L  +D  AY  L+ YYL
Sbjct: 117 DPEPDSPLDIDLANILRAQDRSAYYGLVNYYL 148

>TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.495
           YGR133W
          Length = 158

 Score =  142 bits (359), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 102/152 (67%), Gaps = 4/152 (2%)

Query: 1   MSRIIKEYNHIRK-LNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIH 59
           + R++KE   I K L+   +++  L PV  A  +   W +++ GP ++PYH  SF L I 
Sbjct: 3   LKRLLKEKRLIEKELSGYSESIELLEPV--AFENFLKWRAVLKGPVNTPYHKHSFKLLIE 60

Query: 60  IPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLA 119
           +P+EYP +PP I F   S+P HCNV F+TG+ICLNIL++E+WSPVWNL+Y + A+ QLL 
Sbjct: 61  LPSEYPLVPPAITFEPYSMP-HCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQ 119

Query: 120 YPDPSSPLNIDLSRLLTLKDSKAYNSLIKYYL 151
            P   SPLNIDL+ +L   D+ AY+ LI YYL
Sbjct: 120 EPVVDSPLNIDLANILRAGDTSAYHGLINYYL 151

>NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON}
           Anc_3.495
          Length = 171

 Score =  140 bits (354), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 106/170 (62%), Gaps = 16/170 (9%)

Query: 1   MSRIIKEYNHIRKL---NALPDN----------MTTLHPVSNATSDLSNWHSIILGPKDS 47
           MSR++KEY  I+     N+   N          +T LHP+S  TSDL++W + I GP+ +
Sbjct: 1   MSRLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPIS--TSDLTHWQAQIKGPQGT 58

Query: 48  PYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNL 107
           PY N  F L+I  P  YP  PP+I F   S+P HCNVNF TG ICL+IL+ ++W+P WNL
Sbjct: 59  PYANHEFQLQIECPPTYPIEPPIIHFQPLSMP-HCNVNFQTGAICLDILEKQHWTPAWNL 117

Query: 108 LYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSLIKYYLYNFPKP 157
           + +++AI  LL  P P SPLN+D++ +L + D  AYN L+ YYL   P P
Sbjct: 118 MTTMKAIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLSASPSP 167

>YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}
           PEX4Peroxisomal ubiquitin conjugating enzyme required
           for peroxisomal matrix protein import and peroxisome
           biogenesis
          Length = 183

 Score =  134 bits (336), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 98/159 (61%), Gaps = 11/159 (6%)

Query: 1   MSRIIKEYNHIRKLNALPDNMT--------TLHPVSNATSDLSNWHSIILGPKDSPYHNK 52
           MSRI+KEY  I K  A  D +         +L+P+    +DLS W +II GP D+PY N 
Sbjct: 19  MSRIVKEYKVILKTLASDDPIANPYRGIIESLNPIDE--TDLSKWEAIISGPSDTPYENH 76

Query: 53  SFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQ 112
            F + I +P+ YP  PP I F +N+I  HCNV   TGEICLNILK E W+PVW+LL+ V 
Sbjct: 77  QFRILIEVPSSYPMNPPKISFMQNNIL-HCNVKSATGEICLNILKPEEWTPVWDLLHCVH 135

Query: 113 AIIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSLIKYYL 151
           A+ +LL  P   SPL++D+  ++   D  AY  ++KY+L
Sbjct: 136 AVWRLLREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFL 174

>Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  133 bits (334), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 68/159 (42%), Positives = 98/159 (61%), Gaps = 11/159 (6%)

Query: 1   MSRIIKEYNHIRKLNALPDN--------MTTLHPVSNATSDLSNWHSIILGPKDSPYHNK 52
           MSRI KEY  IRK  A  D         + +L+P     +DLS W + I GP+ +PY   
Sbjct: 1   MSRITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDE--TDLSKWEATICGPEHTPYERY 58

Query: 53  SFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQ 112
            F + I +P  YP  PP I F K++I  HCN+N +TGEICL+ILK ++W+PVW+LL+ V 
Sbjct: 59  QFRMLIDVPDSYPMAPPKIMFEKDAIL-HCNINSSTGEICLDILKLQDWTPVWDLLHCVH 117

Query: 113 AIIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSLIKYYL 151
           A+ +LL  P   SPL++D+  ++   D +AY  ++KY+L
Sbjct: 118 AVWRLLREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFL 156

>Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W
           (REAL)
          Length = 162

 Score =  132 bits (333), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 68/159 (42%), Positives = 102/159 (64%), Gaps = 11/159 (6%)

Query: 1   MSRIIKEYNHIRK--------LNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNK 52
           MSRI KEY  I+K        +N     + +L+P+    +DLS W +II+GP  +PY + 
Sbjct: 1   MSRIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDE--TDLSKWEAIIIGPTHTPYEHY 58

Query: 53  SFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQ 112
            F + I +P+ YP  PP I+F++N+I  HCN+   TGEICL+ILK E+W+PVW+LL+ V 
Sbjct: 59  RFRILIDVPSSYPMAPPNIRFDRNNIL-HCNIKSPTGEICLDILKPEDWTPVWDLLHCVH 117

Query: 113 AIIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSLIKYYL 151
           AI +LL  P   SPL++D+  ++   D+ AY  +I+Y+L
Sbjct: 118 AIWRLLKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFL 156

>ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 153

 Score =  132 bits (332), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 68/152 (44%), Positives = 93/152 (61%), Gaps = 2/152 (1%)

Query: 1   MSRIIKEYNHIRKLNALPDNMTTLHPVS-NATSDLSNWHSIILGPKDSPYHNKSFLLEIH 59
           MSR  KEY  I K+    D + +   V      DL+ W ++I GP  +PY   +F L + 
Sbjct: 1   MSRAAKEYKTITKVLKEGDEVYSQLIVGMEPKEDLTRWEALIRGPSGTPYEGCNFRLHLS 60

Query: 60  IPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLA 119
           +P EYP  PP +KF   ++P H NV+F TGEICL+IL  ++WSP W+LL+ VQAI QLL 
Sbjct: 61  LPQEYPMSPPYVKFEPYAMP-HANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLD 119

Query: 120 YPDPSSPLNIDLSRLLTLKDSKAYNSLIKYYL 151
            P  SSPLN+D++ +L   D  AY  L+ YY+
Sbjct: 120 EPVSSSPLNVDIANILKANDMNAYYGLVHYYI 151

>AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR133W (PEX4)
          Length = 155

 Score =  130 bits (328), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 100/161 (62%), Gaps = 10/161 (6%)

Query: 1   MSRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHI 60
           M RI++EY  ++K  AL   + +L PV     DL  W +   GP+++PY   +F L I++
Sbjct: 1   MRRILREYKQLQKQLALHPAVLSLAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINV 60

Query: 61  PTEYPSIPPVIKFNKNSIPPH--C--NVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQ 116
           P  YP+ PP     K S PPH  C  N+ ++TGE+CL++LK+E WSPV+NLL  V+AI  
Sbjct: 61  PETYPNEPP-----KCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAIST 115

Query: 117 LLAYPDPSSPLNIDLSRLLTLKDSKAYNSLIKYYLYNFPKP 157
           LLA P   SPL++DLSRL T  D  AY+ ++ Y L   P+P
Sbjct: 116 LLAEPGVDSPLDVDLSRLYT-TDRAAYDGVVNYRLRTRPQP 155

>Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  128 bits (322), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 95/159 (59%), Gaps = 11/159 (6%)

Query: 1   MSRIIKEYNHIRKLNALPDNMT--------TLHPVSNATSDLSNWHSIILGPKDSPYHNK 52
           MSRI KEY  I K  A  D +         +L+P+    +DLS W + I GP  +PY N 
Sbjct: 1   MSRITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDE--TDLSRWEAKIYGPSHTPYENY 58

Query: 53  SFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQ 112
            F + I +P+ YP  PP I F +N I  HCNV   TGEICL+ILK E+W+PVW+LL+ V 
Sbjct: 59  QFHILIDVPSSYPMTPPRINFEQNDIL-HCNVKSATGEICLDILKPEDWTPVWDLLHCVH 117

Query: 113 AIIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSLIKYYL 151
           A+ +LL  P   SPL++D+  ++   D  AY  ++KY+L
Sbjct: 118 AVWRLLREPVCDSPLDVDMGNIIRCADESAYQGIVKYFL 156

>KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.495
           YGR133W
          Length = 151

 Score =  127 bits (319), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 98/155 (63%), Gaps = 6/155 (3%)

Query: 2   SRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIP 61
           SRI+KEY   R L +    +  L P+S  T DL++W   I GP  SP+ N +F L I IP
Sbjct: 3   SRILKEYKDSRSLQS--QYILALDPIS--TDDLTHWECTIKGPLHSPFANHTFKLRIDIP 58

Query: 62  TEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYP 121
             YP   P+ KF   ++P H NVNF TGEICL+IL + NWSPV+N+ Y V+AI+ LL  P
Sbjct: 59  QTYPLTTPICKFEPFAMP-HPNVNFETGEICLDIL-DTNWSPVFNIQYIVEAIVWLLNEP 116

Query: 122 DPSSPLNIDLSRLLTLKDSKAYNSLIKYYLYNFPK 156
           +  SPLN+DL+ LL   D KAY+ LI Y+L N  K
Sbjct: 117 NFKSPLNLDLANLLRFDDLKAYHDLISYHLNNSAK 151

>KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} similar
           to uniprot|P29340 Saccharomyces cerevisiae YGR133W PEX4
           Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 166

 Score =  127 bits (319), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 67/153 (43%), Positives = 93/153 (60%), Gaps = 6/153 (3%)

Query: 2   SRIIKEYNHIRK-LNALPDN--MTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEI 58
            R+ KEY  + K L   P+   + +L PVS    +L  W S+I GP D+PY    F L+I
Sbjct: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSE--ENLRKWESLITGPPDTPYFGHEFTLQI 60

Query: 59  HIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLL 118
                YP  PP ++F    +P HCNV+F +G ICL++L   +W+P W+LL+ V AI  LL
Sbjct: 61  EASEAYPLEPPKVQFQARCMP-HCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLL 119

Query: 119 AYPDPSSPLNIDLSRLLTLKDSKAYNSLIKYYL 151
           A P+P SPL++DL+ L+   D  A+NSLI YYL
Sbjct: 120 ASPEPDSPLDVDLACLVRAGDRSAHNSLIAYYL 152

>SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 161

 Score =  126 bits (317), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 98/155 (63%), Gaps = 5/155 (3%)

Query: 1   MSRIIKEYNHIRK-LNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIH 59
           + RI KE+  +RK L   P     L      T ++ +W + I GP ++PY +  F L++ 
Sbjct: 3   LQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALDVE 62

Query: 60  IPTEYPSIPPVIKF---NKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQ 116
           +P +YP  PP +KF   ++N+I  HCNV+F TGEICL+IL  E+WSPVW+L++ + AI  
Sbjct: 63  LPIQYPLEPPRVKFLPGSRNNIC-HCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIWI 121

Query: 117 LLAYPDPSSPLNIDLSRLLTLKDSKAYNSLIKYYL 151
           LL  P P SPLN+D++ +L   D +AY  LIKYY+
Sbjct: 122 LLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYI 156

>Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W
           (PEX4) - Member of ubiquitin-conjugating protein family
           [contig 130] FULL
          Length = 160

 Score =  126 bits (316), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 65/152 (42%), Positives = 90/152 (59%), Gaps = 13/152 (8%)

Query: 8   YNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSI 67
           Y+HIRKL  + D+            +L  W + I GP D+PY    F L I IP+ YP  
Sbjct: 22  YSHIRKLRPVSDD------------NLYVWEADITGPSDTPYQGHEFSLLITIPSAYPLE 69

Query: 68  PPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYPDPSSPL 127
           PP ++FN   +P HCNV+F +G IC+N+L+  +WSP W+LL+ V AI  LLA P+P SPL
Sbjct: 70  PPKVQFNARCVP-HCNVDFESGRICINLLERAHWSPAWDLLHLVHAIWLLLANPEPDSPL 128

Query: 128 NIDLSRLLTLKDSKAYNSLIKYYLYNFPKPEL 159
           ++DL+ L    D  A+N L+ YYL    +  L
Sbjct: 129 DVDLACLRRAGDYSAHNGLVAYYLNGGSRGSL 160

>KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON}
           Anc_3.495 YGR133W
          Length = 153

 Score =  125 bits (315), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 95/150 (63%), Gaps = 5/150 (3%)

Query: 2   SRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIP 61
            R+++EY  +        N + LHP   A  DL++W + + GP+ +PY   SF L + +P
Sbjct: 3   QRVLREYRRLVAAGGA-ANESNLHPTDPA--DLTHWEATLEGPQGTPYEGHSFPLRVTVP 59

Query: 62  TEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYP 121
            +YP++PP + F K ++P H NV + TGE+CL+ L    W+PV +L Y+V A+ +LLA P
Sbjct: 60  DKYPTLPPSVCFPKRTMP-HPNVKWDTGEVCLDTLAG-GWTPVMDLQYAVMAVRRLLAEP 117

Query: 122 DPSSPLNIDLSRLLTLKDSKAYNSLIKYYL 151
           +P SPLN++L+ L  L D KAY+ +IKY L
Sbjct: 118 NPESPLNLELAALSRLGDHKAYDGIIKYRL 147

>Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON}
           similar to Ashbya gossypii AFR314W
          Length = 161

 Score =  119 bits (297), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 96/150 (64%), Gaps = 3/150 (2%)

Query: 2   SRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIP 61
           SR++ EY  IR+     +++  L P  +  S LS W +   GP+++PY + +F L I IP
Sbjct: 10  SRMLAEYKQIREQLQSHESILMLCPAGDGGS-LSKWEAQFCGPENTPYADFTFTLSIEIP 68

Query: 62  TEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYP 121
             YP+ PP  +F  N I  H N+ ++TGE+CL++LK+E WSP++NLL  V+AI  LLA P
Sbjct: 69  EMYPNEPPNCRFPPNHIC-HPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEP 127

Query: 122 DPSSPLNIDLSRLLTLKDSKAYNSLIKYYL 151
              SPL++DL++L ++ D +AY  L+ Y L
Sbjct: 128 GVDSPLDVDLAKLYSV-DKQAYQGLVTYRL 156

>KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 158

 Score = 89.7 bits (221), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 60/155 (38%), Positives = 89/155 (57%), Gaps = 9/155 (5%)

Query: 1   MSRIIKEYNHIRKLNALPDN--MTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEI 58
           MSRI+KEY  ++K    P+   ++ L PV +   DLS W     GP +SP+      L I
Sbjct: 1   MSRIVKEYMGLQKRLQTPEFSWISFLAPVDD--DDLSEWVCRFQGPSESPFEGFELGLNI 58

Query: 59  HIPTE-YP-SIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQ 116
            I  E YP S  P + F   ++  H NV + TGEICL++LK+  W+P++ LL  V AI  
Sbjct: 59  TIDLEKYPISGGPRVLFEPRTVA-HPNVKWDTGEICLDLLKD-AWTPIYTLLDVVGAIRD 116

Query: 117 LLAYPDPSSPLNIDLSRLLTLKDSKAYNSLIKYYL 151
           LLA P   SPL++D++++    D +AY  +++Y L
Sbjct: 117 LLADPGLDSPLDLDIAQIYD-ADYEAYVQIVRYRL 150

>ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YDR177W
           (UBC1)
          Length = 211

 Score = 85.9 bits (211), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 77/133 (57%), Gaps = 5/133 (3%)

Query: 1   MSRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHI 60
           MSR  +    I+ +   PD   +L  VS   SD+ +     LGP  +PYH  +F+++I +
Sbjct: 1   MSRAKRLMKEIQSVKDDPDANISLAFVSE--SDIHHLKGTFLGPPGTPYHGGTFIVDIQV 58

Query: 61  PTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAY 120
           P EYP  PP ++F+      H N++  TG ICL+ILKN +WSPV  L  S+ ++  LL  
Sbjct: 59  PLEYPFKPPKMQFDTKVY--HPNISSVTGAICLDILKN-SWSPVLTLKTSLISLQALLQS 115

Query: 121 PDPSSPLNIDLSR 133
           P+P+ P + ++++
Sbjct: 116 PEPNDPQDAEVAK 128

>Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to
           Ashbya gossypii ADR169C
          Length = 211

 Score = 85.9 bits (211), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 53/164 (32%), Positives = 86/164 (52%), Gaps = 6/164 (3%)

Query: 1   MSRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHI 60
           MSR  +    I+ +   PD   +L  VS   SD+ +     LGP  +PYH   F+++I +
Sbjct: 1   MSRAKRLMKEIQSVKDDPDANISLSFVSE--SDIHHLKGTFLGPPGTPYHGGKFVVDIQV 58

Query: 61  PTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAY 120
           P EYP  PP ++F+      H N++  TG ICL+ILKN +WSPV  L  S+ ++  LL  
Sbjct: 59  PLEYPFKPPKMQFDTKVY--HPNISSVTGAICLDILKN-SWSPVLTLKTSLISLQALLQS 115

Query: 121 PDPSSPLNIDLSRLLTLKDSKAYNSLIKYYLYNFPKPELICDCE 164
           P+P+ P + ++++   L D  +++     +   +   E   D E
Sbjct: 116 PEPNDPQDAEVAKHY-LSDRSSFDKTAALWTKTYASGETGNDEE 158

>KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {ON} 
          Length = 147

 Score = 82.8 bits (203), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 56/152 (36%), Positives = 77/152 (50%), Gaps = 11/152 (7%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           RI KE N +RK    P    +  PV +   DL +W + I+GP DSPY    F L IH PT
Sbjct: 5   RISKELNDLRKD---PITSFSAGPVGD---DLFHWQASIMGPPDSPYAGGVFFLSIHFPT 58

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYPD 122
           +YP  PP I F      P+ N N   G ICL+ILK++ WSP   L   + +I  LL   +
Sbjct: 59  DYPFKPPKISFTTKIYHPNINAN---GNICLDILKDQ-WSPALTLSKVLLSICSLLTDAN 114

Query: 123 PSSPLNIDLSRLLTLKDSKAYNSLIKYYLYNF 154
           P  PL  +++ +     SK Y +  + +   F
Sbjct: 115 PDDPLVPEIAHIYKTDRSK-YETTAREWTKKF 145

>NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON} 
          Length = 214

 Score = 81.6 bits (200), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 81/144 (56%), Gaps = 6/144 (4%)

Query: 1   MSRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHI 60
           MSR  +    ++ +   P+    L  V+   SD+ +     LGP  +PY    F+++I +
Sbjct: 1   MSRAKRIMKELQAVKDDPEARIELEFVNE--SDIHHLKGSFLGPPGTPYEGGQFIVDIEV 58

Query: 61  PTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAY 120
           P EYP  PP++KF+      H N++  TG ICL+ILKN  WSPV  L  ++ ++  LL  
Sbjct: 59  PMEYPFKPPMMKFDTKVY--HPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQS 115

Query: 121 PDPSSPLNIDLSRLLTLKDSKAYN 144
           P+P+ P + ++++   LKD +++N
Sbjct: 116 PEPNDPQDAEVAQHY-LKDRESFN 138

>TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.375
           YDR177W
          Length = 214

 Score = 81.6 bits (200), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 52/158 (32%), Positives = 83/158 (52%), Gaps = 21/158 (13%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSI------ILGPKDSPYHNKSFLL 56
           RI+KE      + A+ D+     P +N T D  N   I       LGP  +PY    F++
Sbjct: 6   RIMKE------MQAVKDD-----PAANITLDFVNESDIHHLKGSFLGPPGTPYEGGRFMI 54

Query: 57  EIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQ 116
           +I +P EYP  PP +KF+      H N++  TG ICL+ILKN  WSPV  L  ++ ++  
Sbjct: 55  DIEVPMEYPFKPPKMKFDTKVY--HPNISSVTGAICLDILKNA-WSPVITLKSALISLQA 111

Query: 117 LLAYPDPSSPLNIDLSRLLTLKDSKAYNSLIKYYLYNF 154
           LL  P+P+ P + ++++   LKD + +N   + +   +
Sbjct: 112 LLQSPEPNDPQDAEVAQHY-LKDKEGFNKTARLWTQTY 148

>KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8.375
           YDR177W
          Length = 213

 Score = 81.6 bits (200), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 82/144 (56%), Gaps = 6/144 (4%)

Query: 1   MSRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHI 60
           MSR  +    ++ +   P+   TL  V    SD+ +     +GP  +PY N +F+++I +
Sbjct: 1   MSRAKRIMKELQAVKDDPEAKITLEFV--IESDIHHLKGSFIGPPGTPYENGAFVVDIEV 58

Query: 61  PTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAY 120
           P EYP  PP +KF+      H N++  TG ICL+ILKN  WSPV  L  ++ ++  LL  
Sbjct: 59  PMEYPFKPPQMKFDTKVY--HPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQS 115

Query: 121 PDPSSPLNIDLSRLLTLKDSKAYN 144
           P+P+ P + ++++   L+D +++N
Sbjct: 116 PEPNDPQDAEVAQHY-LRDRESFN 138

>Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 79.7 bits (195), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 70/139 (50%), Gaps = 10/139 (7%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           RI KE   +  L   P    +  PV +   DL +W + I+GP DSPY    F L IH PT
Sbjct: 6   RIAKE---LSDLERDPPTSCSAGPVGD---DLYHWQASIMGPADSPYAGGVFFLSIHFPT 59

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYPD 122
           +YP  PP I F      P+ N N   G ICL+ILK++ WSP   L   + +I  LL   +
Sbjct: 60  DYPFKPPKISFTTKIYHPNINAN---GNICLDILKDQ-WSPALTLSKVLLSICSLLTDAN 115

Query: 123 PSSPLNIDLSRLLTLKDSK 141
           P  PL  +++ +     SK
Sbjct: 116 PDDPLVPEIAHIYKTDRSK 134

>TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.375
           YDR177W
          Length = 216

 Score = 81.6 bits (200), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 81/142 (57%), Gaps = 9/142 (6%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           RI+KE   +R     P+    L  VS A  D+ +     LGP ++PY    F+++I +P 
Sbjct: 6   RIMKEMEAVRDD---PEANIDLEFVSEA--DIHHLKGSFLGPPETPYEGGKFIVDIEVPM 60

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYPD 122
           EYP  PP +KF+      H N++  TG ICL+ILKN  WSPV  L  ++ ++  LL  P+
Sbjct: 61  EYPFKPPKMKFDTKVY--HPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQSPE 117

Query: 123 PSSPLNIDLSRLLTLKDSKAYN 144
           P+ P + ++++   L+D +++N
Sbjct: 118 PNDPQDAEVAQHY-LRDRESFN 138

>Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 81.3 bits (199), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 80/144 (55%), Gaps = 6/144 (4%)

Query: 1   MSRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHI 60
           MSR  +    I+ +   P    TL  VS   SD+ +     LGP  +PY    F+++I +
Sbjct: 1   MSRAKRIMKEIQAVKDDPAAHITLEFVSE--SDIHHLKGTFLGPPGTPYEGGKFVVDIEV 58

Query: 61  PTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAY 120
           P EYP  PP ++F+      H N++  TG ICL+ILKN  WSPV  L  ++ ++  LL  
Sbjct: 59  PMEYPFKPPKMQFDTKVY--HPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQS 115

Query: 121 PDPSSPLNIDLSRLLTLKDSKAYN 144
           P+P+ P + ++++   L+D +++N
Sbjct: 116 PEPNDPQDAEVAQHY-LRDRESFN 138

>KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 79.7 bits (195), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 75/154 (48%), Gaps = 11/154 (7%)

Query: 1   MSRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHI 60
           + RI KE N    L   P    +  PV +   DL +W + I+GP DSPY    F L IH 
Sbjct: 3   LKRITKELN---DLGRDPPTSCSAGPVGD---DLYHWQASIMGPPDSPYAGGVFFLSIHF 56

Query: 61  PTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAY 120
           PT+YP  PP I F      P+ N N   G ICL+ILK++ WSP   +   + +I  LL  
Sbjct: 57  PTDYPFKPPKISFTTKIYHPNINAN---GNICLDILKDQ-WSPALTISKVLLSICSLLTD 112

Query: 121 PDPSSPLNIDLSRLLTLKDSKAYNSLIKYYLYNF 154
            +P  PL  +++ +    D   Y +  K +   +
Sbjct: 113 ANPDDPLVPEIAHIYK-TDRAKYEATAKEWTKKY 145

>SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444
           bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 79.7 bits (195), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 75/154 (48%), Gaps = 11/154 (7%)

Query: 1   MSRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHI 60
           + RI KE N    L   P    +  PV +   DL +W + I+GP DSPY    F L IH 
Sbjct: 3   LKRITKELN---DLGRDPPTSCSAGPVGD---DLYHWQASIMGPPDSPYAGGVFFLSIHF 56

Query: 61  PTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAY 120
           PT+YP  PP I F      P+ N N   G ICL+ILK++ WSP   +   + +I  LL  
Sbjct: 57  PTDYPFKPPKISFTTKIYHPNINAN---GNICLDILKDQ-WSPALTISKVLLSICSLLTD 112

Query: 121 PDPSSPLNIDLSRLLTLKDSKAYNSLIKYYLYNF 154
            +P  PL  +++ +    D   Y +  K +   +
Sbjct: 113 ANPDDPLVPEIAHIYK-TDRAKYEATAKEWTKKY 145

>AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR082C
           (UBC4) and YDR059C (UBC5)
          Length = 147

 Score = 79.7 bits (195), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 75/154 (48%), Gaps = 11/154 (7%)

Query: 1   MSRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHI 60
           + RI KE N    L   P    +  PV +   DL +W + I+GP DSPY    F L IH 
Sbjct: 3   LKRITKELN---DLGRDPPTSCSAGPVGD---DLYHWQASIMGPPDSPYAGGVFFLSIHF 56

Query: 61  PTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAY 120
           PT+YP  PP I F      P+ N N   G ICL+ILK++ WSP   +   + +I  LL  
Sbjct: 57  PTDYPFKPPKISFTTKIYHPNINAN---GNICLDILKDQ-WSPALTISKVLLSICSLLTD 112

Query: 121 PDPSSPLNIDLSRLLTLKDSKAYNSLIKYYLYNF 154
            +P  PL  +++ +    D   Y +  K +   +
Sbjct: 113 ANPDDPLVPEIAHIYK-TDRAKYEATAKEWTKKY 145

>KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 148
           aa] {ON} highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082C UBC4 Ubiquitin-conjugating enzyme
           that mediates degradation of short-lived and abnormal
           proteins interacts with E3-CaM in ubiquitinating
           calmodulin interacts with many SCF ubiquitin protein
           ligases component of the cellular stress response
          Length = 148

 Score = 79.7 bits (195), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 71/141 (50%), Gaps = 10/141 (7%)

Query: 1   MSRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHI 60
           + RI KE N    L   P    +  PV +   D+ +W + I+GP DSPY    F L IH 
Sbjct: 4   LKRITKELN---DLGRDPPTSCSAGPVGD---DVYHWQASIMGPPDSPYAGGVFFLSIHF 57

Query: 61  PTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAY 120
           PT+YP  PP I F      P+ N N   G ICL+ILK++ WSP   +   + +I  LL  
Sbjct: 58  PTDYPFKPPKISFTTKIYHPNINAN---GNICLDILKDQ-WSPALTISKVLLSICSLLTD 113

Query: 121 PDPSSPLNIDLSRLLTLKDSK 141
            +P  PL  +++ L     +K
Sbjct: 114 ANPDDPLVPEIAHLYKTDRAK 134

>Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON}
           (6121..6167,6406..6805) [447 nt, 149 aa]
          Length = 148

 Score = 79.7 bits (195), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 75/154 (48%), Gaps = 11/154 (7%)

Query: 1   MSRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHI 60
           + RI KE N    L   P    +  PV +   D+ +W + I+GP DSPY    F L IH 
Sbjct: 4   LKRITKELN---DLGRDPPTSCSAGPVGD---DVYHWQASIMGPPDSPYAGGVFFLSIHF 57

Query: 61  PTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAY 120
           PT+YP  PP I F      P+ N N   G ICL+ILK++ WSP   +   + +I  LL  
Sbjct: 58  PTDYPFKPPKISFTTKIYHPNINAN---GNICLDILKDQ-WSPALTISKVLLSICSLLTD 113

Query: 121 PDPSSPLNIDLSRLLTLKDSKAYNSLIKYYLYNF 154
            +P  PL  +++ L    D   Y +  K +   +
Sbjct: 114 ANPDDPLVPEIAHLYK-TDRAKYEATAKEWTKKY 146

>Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 81.3 bits (199), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 80/144 (55%), Gaps = 6/144 (4%)

Query: 1   MSRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHI 60
           MSR  +    I+ +   P    TL  VS   SD+ +     LGP  +PY    F+++I +
Sbjct: 1   MSRAKRIMKEIQAVKDDPAAHITLEFVSE--SDIHHLKGTFLGPPGTPYEGGKFVVDIEV 58

Query: 61  PTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAY 120
           P EYP  PP ++F+      H N++  TG ICL+ILKN  WSPV  L  ++ ++  LL  
Sbjct: 59  PMEYPFKPPKMQFDTKVY--HPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQS 115

Query: 121 PDPSSPLNIDLSRLLTLKDSKAYN 144
           P+P+ P + ++++   L+D +++N
Sbjct: 116 PEPNDPQDAEVAQHY-LRDRESFN 138

>Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 81.3 bits (199), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 80/144 (55%), Gaps = 6/144 (4%)

Query: 1   MSRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHI 60
           MSR  +    I+ +   P    TL  VS   SD+ +     LGP  +PY    F+++I +
Sbjct: 1   MSRAKRIMKEIQAVKDDPAAHITLEFVSE--SDIHHLKGTFLGPPGTPYEGGKFVVDIEV 58

Query: 61  PTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAY 120
           P EYP  PP ++F+      H N++  TG ICL+ILKN  WSPV  L  ++ ++  LL  
Sbjct: 59  PMEYPFKPPKMQFDTKVY--HPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQS 115

Query: 121 PDPSSPLNIDLSRLLTLKDSKAYN 144
           P+P+ P + ++++   L+D +++N
Sbjct: 116 PEPNDPQDAEVAQHY-LRDRESFN 138

>Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON}
           similar to Ashbya gossypii AER173C
          Length = 147

 Score = 79.3 bits (194), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 75/154 (48%), Gaps = 11/154 (7%)

Query: 1   MSRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHI 60
           + RI KE N    L   P    +  PV +   DL +W + I+GP DSPY    F L IH 
Sbjct: 3   LKRITKELN---DLGRDPPTSCSAGPVGD---DLYHWQASIMGPPDSPYAGGVFFLSIHF 56

Query: 61  PTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAY 120
           PT+YP  PP I F      P+ N N   G ICL+ILK++ WSP   +   + +I  LL  
Sbjct: 57  PTDYPFKPPKISFTTKIYHPNINAN---GNICLDILKDQ-WSPALTISKVLLSICSLLTD 112

Query: 121 PDPSSPLNIDLSRLLTLKDSKAYNSLIKYYLYNF 154
            +P  PL  +++ +    D   Y +  K +   +
Sbjct: 113 ANPDDPLVPEIAHIYK-TDRAKYEATAKEWTKKY 145

>YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}
           UBC1Ubiquitin-conjugating enzyme that mediates selective
           degradation of short-lived and abnormal proteins; plays
           a role in vesicle biogenesis and ER-associated protein
           degradation (ERAD); component of the cellular stress
           response
          Length = 215

 Score = 80.9 bits (198), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 80/144 (55%), Gaps = 6/144 (4%)

Query: 1   MSRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHI 60
           MSR  +    I+ +   P    TL  VS   SD+ +     LGP  +PY    F+++I +
Sbjct: 1   MSRAKRIMKEIQAVKDDPAAHITLEFVSE--SDIHHLKGTFLGPPGTPYEGGKFVVDIEV 58

Query: 61  PTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAY 120
           P EYP  PP ++F+      H N++  TG ICL+ILKN  WSPV  L  ++ ++  LL  
Sbjct: 59  PMEYPFKPPKMQFDTKVY--HPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQS 115

Query: 121 PDPSSPLNIDLSRLLTLKDSKAYN 144
           P+P+ P + ++++   L+D +++N
Sbjct: 116 PEPNDPQDAEVAQHY-LRDRESFN 138

>KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON}
           Anc_8.375 YDR177W
          Length = 214

 Score = 80.9 bits (198), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 81/144 (56%), Gaps = 6/144 (4%)

Query: 1   MSRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHI 60
           MSR  +    ++ +   P+   TL  V+   SD+ +      GP ++PY    F+++I +
Sbjct: 1   MSRAKRIMKEMQAVKDDPEAHITLEFVNE--SDIHHLKGTFQGPPETPYDRGQFVVDIEV 58

Query: 61  PTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAY 120
           P EYP  PP +KF+      H NV+  TG ICL+ILKN  WSPV  L  ++ ++  LL  
Sbjct: 59  PMEYPFKPPKMKFDTKVY--HPNVSSVTGAICLDILKN-AWSPVITLKSALISLQALLQS 115

Query: 121 PDPSSPLNIDLSRLLTLKDSKAYN 144
           P+P+ P + ++++   LKD +++N
Sbjct: 116 PEPNDPQDAEVAQHY-LKDRESFN 138

>TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa]
           {ON} Anc_3.308 YBR082C
          Length = 148

 Score = 79.0 bits (193), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 75/154 (48%), Gaps = 11/154 (7%)

Query: 1   MSRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHI 60
           + RI KE N    L   P    +  PV +   D+ +W + I+GP DSPY    F L IH 
Sbjct: 4   LKRITKELN---DLGRDPPTSCSAGPVGD---DIYHWQASIMGPPDSPYAGGVFFLSIHF 57

Query: 61  PTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAY 120
           PT+YP  PP I F      P+ N N   G ICL+ILK++ WSP   +   + +I  LL  
Sbjct: 58  PTDYPFKPPKISFTTKIYHPNINAN---GNICLDILKDQ-WSPALTISKVLLSICSLLTD 113

Query: 121 PDPSSPLNIDLSRLLTLKDSKAYNSLIKYYLYNF 154
            +P  PL  +++ L    D   Y +  K +   +
Sbjct: 114 ANPDDPLVPEIAHLYK-TDRPKYEATAKEWTKKY 146

>CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {ON}
           highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082c UBC4 E2 ubiquitin-conjugating enzyme
           or uniprot|P15732 Saccharomyces cerevisiae YDR059c UBC5
          Length = 147

 Score = 79.0 bits (193), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 51/139 (36%), Positives = 70/139 (50%), Gaps = 10/139 (7%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           RI KE   +  L   P    +  PV +   DL +W + I+GP DSPY    F L IH PT
Sbjct: 5   RIAKE---LSDLGRDPPTSCSAGPVGD---DLYHWQASIMGPPDSPYAGGVFFLSIHFPT 58

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYPD 122
           +YP  PP I F      P+ N N   G ICL+ILK++ WSP   L   + +I  LL   +
Sbjct: 59  DYPFKPPKISFTTKIYHPNINAN---GNICLDILKDQ-WSPALTLSKVLLSICSLLTDAN 114

Query: 123 PSSPLNIDLSRLLTLKDSK 141
           P  PL  +++ +     +K
Sbjct: 115 PDDPLVPEIAHIYKTDRAK 133

>ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 78.6 bits (192), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 71/141 (50%), Gaps = 10/141 (7%)

Query: 1   MSRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHI 60
           + RI KE N    L   P    +  PV +   D+ +W + I+GP DSPY    F L IH 
Sbjct: 3   LKRITKELN---DLGRDPPTSCSAGPVGD---DVYHWQASIMGPPDSPYAGGVFFLSIHF 56

Query: 61  PTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAY 120
           PT+YP  PP I F      P+ N N   G ICL+ILK++ WSP   +   + +I  LL  
Sbjct: 57  PTDYPFKPPKIAFTTKIYHPNINAN---GNICLDILKDQ-WSPALTISKVLLSICSLLTD 112

Query: 121 PDPSSPLNIDLSRLLTLKDSK 141
            +P  PL  +++ +     +K
Sbjct: 113 ANPDDPLVPEIAHIYKTDRAK 133

>TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa]
           {ON} 
          Length = 147

 Score = 78.6 bits (192), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 71/141 (50%), Gaps = 10/141 (7%)

Query: 1   MSRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHI 60
           + RI KE N    L   P    +  PV +   D+ +W + I+GP DSPY    F L IH 
Sbjct: 3   LKRITKELN---DLGRDPPTSCSAGPVGD---DIYHWQASIMGPPDSPYAGGVFFLSIHF 56

Query: 61  PTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAY 120
           PT+YP  PP I F      P+ N N   G ICL+ILK++ WSP   +   + +I  LL  
Sbjct: 57  PTDYPFKPPKIAFTTKIYHPNINAN---GNICLDILKDQ-WSPALTISKVLLSICSLLTD 112

Query: 121 PDPSSPLNIDLSRLLTLKDSK 141
            +P  PL  +++ +     +K
Sbjct: 113 ANPDDPLVPEIAHIYKTDRAK 133

>KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 215

 Score = 80.1 bits (196), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/154 (30%), Positives = 82/154 (53%), Gaps = 6/154 (3%)

Query: 1   MSRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHI 60
           MSR  +    ++ +   P+    L  V+   +D+       LGP  +PY N  F+++I +
Sbjct: 1   MSRAKRVMKELQAIKDDPEAKVDLQLVNE--NDIHLLKGSFLGPPGTPYENGKFIVDIEV 58

Query: 61  PTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAY 120
           P EYP  PP +KF+      H NV+  TG ICL+ILKN  WSPV  L  ++ ++  LL  
Sbjct: 59  PMEYPFKPPKMKFDTKVY--HPNVSSVTGAICLDILKN-AWSPVITLKSALISLQALLQS 115

Query: 121 PDPSSPLNIDLSRLLTLKDSKAYNSLIKYYLYNF 154
           P+P+ P + ++++   L+D  +++    ++   +
Sbjct: 116 PEPNDPQDAEVAQHF-LRDKASFDKTAAFWTKTY 148

>Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 78.2 bits (191), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 64/125 (51%), Gaps = 10/125 (8%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           RI KE   +  L   P    +  PV +   DL +W + I+GP DSPY    F L IH PT
Sbjct: 6   RIAKE---LSDLERDPPTSCSAGPVGD---DLYHWQASIMGPADSPYAGGVFFLSIHFPT 59

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYPD 122
           +YP  PP I F      P+ N N   G ICL+ILK++ WSP   L   + +I  LL   +
Sbjct: 60  DYPFKPPKISFTTKIYHPNINAN---GNICLDILKDQ-WSPALTLSKVLLSICSLLTDAN 115

Query: 123 PSSPL 127
           P  PL
Sbjct: 116 PDDPL 120

>Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 78.2 bits (191), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 64/125 (51%), Gaps = 10/125 (8%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           RI KE   +  L   P    +  PV +   DL +W + I+GP DSPY    F L IH PT
Sbjct: 6   RIAKE---LSDLERDPPTSCSAGPVGD---DLYHWQASIMGPADSPYAGGVFFLSIHFPT 59

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYPD 122
           +YP  PP I F      P+ N N   G ICL+ILK++ WSP   L   + +I  LL   +
Sbjct: 60  DYPFKPPKISFTTKIYHPNINAN---GNICLDILKDQ-WSPALTLSKVLLSICSLLTDAN 115

Query: 123 PSSPL 127
           P  PL
Sbjct: 116 PDDPL 120

>YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, 148
           aa] {ON}  UBC4Ubiquitin-conjugating enzyme (E2),
           mediates degradation of abnormal or excess proteins,
           including calmodulin and histone H3; interacts with many
           SCF ubiquitin protein ligases; component of the cellular
           stress response
          Length = 148

 Score = 78.2 bits (191), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 64/125 (51%), Gaps = 10/125 (8%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           RI KE   +  L   P    +  PV +   DL +W + I+GP DSPY    F L IH PT
Sbjct: 6   RIAKE---LSDLERDPPTSCSAGPVGD---DLYHWQASIMGPADSPYAGGVFFLSIHFPT 59

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYPD 122
           +YP  PP I F      P+ N N   G ICL+ILK++ WSP   L   + +I  LL   +
Sbjct: 60  DYPFKPPKISFTTKIYHPNINAN---GNICLDILKDQ-WSPALTLSKVLLSICSLLTDAN 115

Query: 123 PSSPL 127
           P  PL
Sbjct: 116 PDDPL 120

>Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON}
           complement(21147..21794) [648 nt, 216 aa]
          Length = 215

 Score = 79.7 bits (195), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 81/142 (57%), Gaps = 9/142 (6%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           RI+KE   ++   A   N+  +     + SD+ +     LGP ++PY    F+++I +P 
Sbjct: 6   RIMKEMQAVKDDPAANINLEFV-----SESDIHHLKGSFLGPPETPYQGGRFIVDIEVPM 60

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYPD 122
           EYP  PP +KF+      H N++  TG ICL+ILKN  WSPV  L  ++ ++  LL  P+
Sbjct: 61  EYPFKPPKMKFDTKVY--HPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQSPE 117

Query: 123 PSSPLNIDLSRLLTLKDSKAYN 144
           P+ P + ++++   L+D +++N
Sbjct: 118 PNDPQDAEVAQHY-LRDRESFN 138

>CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177w E2 ubiquitin-conjugating enzyme
          Length = 213

 Score = 79.7 bits (195), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/144 (32%), Positives = 81/144 (56%), Gaps = 6/144 (4%)

Query: 1   MSRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHI 60
           MSR  +    ++ +   P+   +L  VS   SD+ +     LGP  +PY    F+++I +
Sbjct: 1   MSRAKRIMKELQAVKDDPEANISLEFVSE--SDIHHLKGSFLGPPGTPYEGGKFIVDIEV 58

Query: 61  PTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAY 120
           P EYP  PP +KF+      H N++  TG ICL+ILKN  WSPV  L  ++ ++  LL  
Sbjct: 59  PMEYPFKPPKMKFDSKVY--HPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQS 115

Query: 121 PDPSSPLNIDLSRLLTLKDSKAYN 144
           P+P+ P + ++++   L+D ++++
Sbjct: 116 PEPNDPQDAEVAQHY-LRDRQSFD 138

>Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 78.2 bits (191), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 78/152 (51%), Gaps = 11/152 (7%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           RI KE   +  L   P    +  PV +   DL +W + I+GP DSPY    F L IH PT
Sbjct: 6   RIAKE---LSDLGRDPPASCSAGPVGD---DLYHWQASIMGPSDSPYAGGVFFLSIHFPT 59

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYPD 122
           +YP  PP + F       H N+N ++G ICL+ILK++ WSP   L   + +I  LL   +
Sbjct: 60  DYPFKPPKVNFTTKIY--HPNIN-SSGNICLDILKDQ-WSPALTLSKVLLSICSLLTDAN 115

Query: 123 PSSPLNIDLSRLLTLKDSKAYNSLIKYYLYNF 154
           P  PL  +++++     +K Y +  K +   +
Sbjct: 116 PDDPLVPEIAQIYKTDKAK-YEATAKEWTKKY 146

>Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 78.2 bits (191), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 78/152 (51%), Gaps = 11/152 (7%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           RI KE   +  L   P    +  PV +   DL +W + I+GP DSPY    F L IH PT
Sbjct: 6   RIAKE---LSDLGRDPPASCSAGPVGD---DLYHWQASIMGPSDSPYAGGVFFLSIHFPT 59

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYPD 122
           +YP  PP + F       H N+N ++G ICL+ILK++ WSP   L   + +I  LL   +
Sbjct: 60  DYPFKPPKVNFTTKIY--HPNIN-SSGNICLDILKDQ-WSPALTLSKVLLSICSLLTDAN 115

Query: 123 PSSPLNIDLSRLLTLKDSKAYNSLIKYYLYNF 154
           P  PL  +++++     +K Y +  K +   +
Sbjct: 116 PDDPLVPEIAQIYKTDKAK-YEATAKEWTKKY 146

>YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, 148
           aa] {ON}  UBC5Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived, abnormal, or
           excess proteins, including histone H3; central component
           of the cellular stress response; expression is heat
           inducible
          Length = 148

 Score = 78.2 bits (191), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 78/152 (51%), Gaps = 11/152 (7%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           RI KE   +  L   P    +  PV +   DL +W + I+GP DSPY    F L IH PT
Sbjct: 6   RIAKE---LSDLGRDPPASCSAGPVGD---DLYHWQASIMGPSDSPYAGGVFFLSIHFPT 59

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYPD 122
           +YP  PP + F       H N+N ++G ICL+ILK++ WSP   L   + +I  LL   +
Sbjct: 60  DYPFKPPKVNFTTKIY--HPNIN-SSGNICLDILKDQ-WSPALTLSKVLLSICSLLTDAN 115

Query: 123 PSSPLNIDLSRLLTLKDSKAYNSLIKYYLYNF 154
           P  PL  +++++     +K Y +  K +   +
Sbjct: 116 PDDPLVPEIAQIYKTDKAK-YEATAKEWTKKY 146

>ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 218

 Score = 79.7 bits (195), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 47/144 (32%), Positives = 80/144 (55%), Gaps = 6/144 (4%)

Query: 1   MSRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHI 60
           MSR  +    ++ +   P    TL  +S   SD+       LGP ++PY    F+++I +
Sbjct: 1   MSRAKRLMKELQAVRDDPAANITLEFISE--SDIHRLKGSFLGPPETPYQGGRFIIDIEV 58

Query: 61  PTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAY 120
           P EYP  PP +KF+      H N++  TG ICL+ILKN  WSPV  L  ++ ++  LL  
Sbjct: 59  PMEYPFKPPKMKFDTKVY--HPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQS 115

Query: 121 PDPSSPLNIDLSRLLTLKDSKAYN 144
           P+P+ P + ++++   L+D ++++
Sbjct: 116 PEPNDPQDAEVAQHY-LRDKESFS 138

>TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 bp,
           148 aa] {ON} 
          Length = 148

 Score = 78.2 bits (191), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 52/154 (33%), Positives = 75/154 (48%), Gaps = 11/154 (7%)

Query: 1   MSRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHI 60
           + RI KE N    L   P    +  PV +   D+ +W + I+GP DSPY    F L IH 
Sbjct: 4   LKRITKELN---DLGRDPPTSCSAGPVGD---DIYHWQASIMGPPDSPYAGGVFFLSIHF 57

Query: 61  PTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAY 120
           PT+YP  PP I F      P+ N N   G ICL+ILK++ WSP   +   + +I  LL  
Sbjct: 58  PTDYPFKPPKISFTTKIYHPNINAN---GNICLDILKDQ-WSPALTISKVLLSICSLLTD 113

Query: 121 PDPSSPLNIDLSRLLTLKDSKAYNSLIKYYLYNF 154
            +P  PL  +++ +    D   Y +  K +   +
Sbjct: 114 ANPDDPLVPEIAHIYK-TDRPKYEATAKEWTKKY 146

>Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 77.8 bits (190), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 51/152 (33%), Positives = 78/152 (51%), Gaps = 11/152 (7%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           RI KE   +  L   P    +  PV +   DL +W + I+GP DSPY    F L IH PT
Sbjct: 6   RIAKE---LSDLGRDPPASCSAGPVGD---DLYHWQASIMGPSDSPYAGGVFFLSIHFPT 59

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYPD 122
           +YP  PP + F       H N+N ++G ICL+ILK++ WSP   L   + ++  LL   +
Sbjct: 60  DYPFKPPKVNFTTKIY--HPNIN-SSGNICLDILKDQ-WSPALTLSKVLLSVCSLLTDAN 115

Query: 123 PSSPLNIDLSRLLTLKDSKAYNSLIKYYLYNF 154
           P  PL  +++++     +K Y +  K +   +
Sbjct: 116 PDDPLVPEIAQIYKTDKAK-YEATAKEWTKKY 146

>NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 147
           aa] {ON} Anc_3.308
          Length = 147

 Score = 77.4 bits (189), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 64/125 (51%), Gaps = 10/125 (8%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           RI KE   +  +   P    +  PV +   DL +W + I+GP DSPY    F L IH PT
Sbjct: 5   RITKE---LSDMGRDPPTSCSAGPVGD---DLYHWQASIMGPPDSPYAGGVFFLSIHFPT 58

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYPD 122
           +YP  PP I F      P+ N N   G ICL+ILK++ WSP   L   + +I  LL   +
Sbjct: 59  DYPFKPPKISFTTKIYHPNINAN---GNICLDILKDQ-WSPALTLSKVLLSICSLLTDAN 114

Query: 123 PSSPL 127
           P  PL
Sbjct: 115 PDDPL 119

>NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [447
           bp, 148 aa] {ON} Anc_3.308
          Length = 148

 Score = 77.4 bits (189), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 64/125 (51%), Gaps = 10/125 (8%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           RI KE   +  +   P    +  PV +   DL +W + I+GP DSPY    F L IH PT
Sbjct: 6   RITKE---LSDMGRDPPTSCSAGPVGD---DLYHWQASIMGPPDSPYAGGVFFLSIHFPT 59

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYPD 122
           +YP  PP I F      P+ N N   G ICL+ILK++ WSP   L   + +I  LL   +
Sbjct: 60  DYPFKPPKISFTTKIYHPNINAN---GNICLDILKDQ-WSPALTLSKVLLSICSLLTDAN 115

Query: 123 PSSPL 127
           P  PL
Sbjct: 116 PDDPL 120

>KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {ON} 
          Length = 161

 Score = 77.0 bits (188), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 46/122 (37%), Positives = 64/122 (52%), Gaps = 5/122 (4%)

Query: 33  DLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEIC 92
           DL +W + I+GP DSPY    F L IH PT+YP  PP I F      P+ N N   G IC
Sbjct: 43  DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIYHPNINAN---GNIC 99

Query: 93  LNILKNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSLIKYYLY 152
           L+ILK++ WSP   L   + +I  LL   +P  PL  +++ +     SK Y +  + +  
Sbjct: 100 LDILKDQ-WSPALTLSKVLLSICSLLTDANPDDPLVPEIAHIYKTDRSK-YEATAREWTK 157

Query: 153 NF 154
            F
Sbjct: 158 KF 159

>TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.375
           YDR177W
          Length = 217

 Score = 77.8 bits (190), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 48/142 (33%), Positives = 78/142 (54%), Gaps = 9/142 (6%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           RI+KE   ++   A   N+  +       SD+ +     LGP  +PY    F+++I +P 
Sbjct: 6   RIMKEMQAVKDDPAAKINLEFV-----TESDIHHLKGSFLGPPGTPYDGGLFIVDIEVPM 60

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYPD 122
           EYP  PP +KF+      H NV+  TG ICL+ILKN  WSPV  L  ++ ++  LL  P+
Sbjct: 61  EYPFKPPKMKFDTKVY--HPNVSSVTGAICLDILKNA-WSPVITLKSALISLQALLQSPE 117

Query: 123 PSSPLNIDLSRLLTLKDSKAYN 144
           P+ P + ++++   L+D  ++N
Sbjct: 118 PNDPQDAEVAQHY-LRDKDSFN 138

>Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 215
           aa] {ON} YEL012W (REAL)
          Length = 215

 Score = 77.4 bits (189), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 71/135 (52%), Gaps = 5/135 (3%)

Query: 25  HPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNV 84
           H V      +  +H   LGPKD+PY N  + L + +P  YP   P I F       H N+
Sbjct: 20  HEVDLVNDSMQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGFVNKIF--HPNI 77

Query: 85  NFTTGEICLNILKNENWSPVWNLLYSVQAII-QLLAYPDPSSPLNIDLSRLLTLKDSKAY 143
           +  +G ICL+++ N  WSP+++L+  V+ +I  LL  P+ S PLN + +  L L+D K Y
Sbjct: 78  DIASGSICLDVI-NSTWSPLYDLINIVEWMIPGLLKEPNGSDPLN-NEAATLQLRDKKLY 135

Query: 144 NSLIKYYLYNFPKPE 158
              IK Y+  +   E
Sbjct: 136 EEKIKEYIDKYATRE 150

>KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 228

 Score = 77.4 bits (189), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 80/143 (55%), Gaps = 9/143 (6%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           RI+KE   I+ +   P+    L  V+   SD+ +     +GP  +PY    F+++I+IP 
Sbjct: 6   RILKE---IQAVKEDPEAQIELKFVNE--SDIHHMKGSFIGPSGTPYEGGKFVVDINIPV 60

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYPD 122
           EYP  PP +KF+      H NV+  TG ICL+ILKN  W+PV  L  ++ ++  LL  P+
Sbjct: 61  EYPYKPPQMKFDTKVY--HPNVSSVTGAICLDILKNA-WTPVITLKSALISLQALLQSPE 117

Query: 123 PSSPLNIDLSRLLTLKDSKAYNS 145
           P+ P +  +++   L D K+++ 
Sbjct: 118 PNDPQDAQVAKHY-LTDKKSFDE 139

>YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {ON} 
           UBC8Ubiquitin-conjugating enzyme that negatively
           regulates gluconeogenesis by mediating the
           glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 218

 Score = 77.0 bits (188), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 71/135 (52%), Gaps = 5/135 (3%)

Query: 25  HPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNV 84
           H V      +  +H   LGPKD+PY N  + L + +P  YP   P I F       H N+
Sbjct: 20  HQVDLINDSMQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGFVNKIF--HPNI 77

Query: 85  NFTTGEICLNILKNENWSPVWNLLYSVQAII-QLLAYPDPSSPLNIDLSRLLTLKDSKAY 143
           +  +G ICL+++ N  WSP+++L+  V+ +I  LL  P+ S PLN + +  L L+D K Y
Sbjct: 78  DIASGSICLDVI-NSTWSPLYDLINIVEWMIPGLLKEPNGSDPLN-NEAATLQLRDKKLY 135

Query: 144 NSLIKYYLYNFPKPE 158
              IK Y+  +   E
Sbjct: 136 EEKIKEYIDKYATKE 150

>Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa]
           {ON} YEL012W (REAL)
          Length = 215

 Score = 77.0 bits (188), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 71/135 (52%), Gaps = 5/135 (3%)

Query: 25  HPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNV 84
           H V      +  +H   LGPKD+PY N  + L + +P  YP   P I F       H N+
Sbjct: 20  HQVDLINDSMQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGFVNKIF--HPNI 77

Query: 85  NFTTGEICLNILKNENWSPVWNLLYSVQAII-QLLAYPDPSSPLNIDLSRLLTLKDSKAY 143
           +  +G ICL+++ N  WSP+++L+  V+ +I  LL  P+ S PLN + +  L L+D K Y
Sbjct: 78  DIASGSICLDVI-NSTWSPLYDLINIVEWMIPGLLKEPNGSDPLN-NEAATLQLRDKKLY 135

Query: 144 NSLIKYYLYNFPKPE 158
              IK Y+  +   E
Sbjct: 136 EEKIKEYIDKYATKE 150

>Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W
           (REAL)
          Length = 210

 Score = 75.9 bits (185), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 71/135 (52%), Gaps = 5/135 (3%)

Query: 25  HPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNV 84
           H V      +  +H   LGPKD+PY N  + L + +P  YP   P I F       H N+
Sbjct: 19  HQVDLVNDSMQEFHVKFLGPKDTPYENGVWRLHVELPDNYPYKSPSIGFVNKIF--HPNI 76

Query: 85  NFTTGEICLNILKNENWSPVWNLLYSVQAII-QLLAYPDPSSPLNIDLSRLLTLKDSKAY 143
           +  +G ICL+++ N  WSP+++L+  ++ +I  LL  P+ S PLN + +  L L+D K Y
Sbjct: 77  DIASGSICLDVI-NSTWSPLYDLINILEWMIPGLLKEPNGSDPLN-NEAATLQLRDKKLY 134

Query: 144 NSLIKYYLYNFPKPE 158
              IK Y+  +   E
Sbjct: 135 EEKIKEYIDKYATKE 149

>NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON} 
          Length = 216

 Score = 75.9 bits (185), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 46/144 (31%), Positives = 77/144 (53%), Gaps = 6/144 (4%)

Query: 1   MSRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHI 60
           MSR  +    ++ +   P     L  V+   SD+ +      GP  +PY    F+++I +
Sbjct: 1   MSRAKRIMKELQAVKDDPTAKIGLEFVNE--SDIHHLKGSFFGPPGTPYEGGQFIIDIEV 58

Query: 61  PTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAY 120
           P EYP  PP +KF+      H N++  TG ICL+ILKN  WSPV  L  ++ ++  LL  
Sbjct: 59  PMEYPFKPPKMKFDTKVY--HPNISSVTGAICLDILKN-AWSPVITLKSALISLQALLQS 115

Query: 121 PDPSSPLNIDLSRLLTLKDSKAYN 144
           P+P+ P + ++++   LKD  +++
Sbjct: 116 PEPNDPQDAEVAQHY-LKDRASFD 138

>Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..14809)
           [504 nt, 168 aa]
          Length = 167

 Score = 74.7 bits (182), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 65/106 (61%), Gaps = 6/106 (5%)

Query: 37  WHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNIL 96
           W+++I+GP D+PY + +F L +    EYP+ PP +KF       H NV +  GEICL+IL
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFVSEMF--HPNV-YANGEICLDIL 92

Query: 97  KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKA 142
           +N  W+P +++   + +I  L   P+P+SP N++ + L   KD K+
Sbjct: 93  QNR-WTPTYDVASILTSIQSLFNDPNPASPANVEAATL--FKDHKS 135

>SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177W UBC1 Ubiquitin-conjugating enzyme
           that mediates selective degradation of short-lived and
           abnormal proteins plays a role in vesicle biogenesis and
           ER- associated protein degradation (ERAD) component of
           the cellular stress response
          Length = 215

 Score = 75.9 bits (185), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 48/142 (33%), Positives = 80/142 (56%), Gaps = 9/142 (6%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           RIIKE   I+     P+   TL  VS   SD+ +      GP  +PY   +F+++I +P 
Sbjct: 6   RIIKE---IQAAKDDPEANITLSFVSE--SDIHHLKGSFYGPPGTPYEGGNFIVDIQVPL 60

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYPD 122
           EYP  PP ++F+      H N++  TG ICL+ILKN  WSPV  L  ++ ++  LL  P+
Sbjct: 61  EYPFKPPKMQFDTKVY--HPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQSPE 117

Query: 123 PSSPLNIDLSRLLTLKDSKAYN 144
           P+ P + ++++   ++D  +++
Sbjct: 118 PNDPQDAEVAQHF-IRDKSSFD 138

>Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177W
           (UBC1) - ubiquitin-conjugating enzyme [contig 18] FULL
          Length = 215

 Score = 75.9 bits (185), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 81/154 (52%), Gaps = 6/154 (3%)

Query: 1   MSRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHI 60
           MSR  +    ++ +   P+    L  V+   +D+       LGP  +PY N  ++++I +
Sbjct: 1   MSRAKRVMKELQAIKDDPEARVDLQLVNE--NDIHLLKGSFLGPPGTPYENGKYIVDIEV 58

Query: 61  PTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAY 120
           P EYP  PP +KF       H NV+  TG ICL+ILKN  WSPV  L  ++ ++  LL  
Sbjct: 59  PMEYPFKPPKMKFQTKVY--HPNVSSVTGAICLDILKNA-WSPVITLKSALISLQALLQS 115

Query: 121 PDPSSPLNIDLSRLLTLKDSKAYNSLIKYYLYNF 154
           P+P+ P + ++++   ++D  +++    ++   +
Sbjct: 116 PEPNDPQDAEVAQHY-IRDKASFDKTAAFWTKTY 148

>SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 169

 Score = 74.7 bits (182), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 65/106 (61%), Gaps = 6/106 (5%)

Query: 37  WHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNIL 96
           W+++I+GP D+PY + +F L +    EYP+ PP +KF       H NV +  GEICL+IL
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMF--HPNV-YANGEICLDIL 92

Query: 97  KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKA 142
           +N  W+P +++   + +I  L   P+P+SP N++ + L   KD K+
Sbjct: 93  QNR-WTPTYDVASILTSIQSLFNDPNPASPANVEAATL--FKDHKS 135

>Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to
           Ashbya gossypii AAR156C
          Length = 170

 Score = 74.7 bits (182), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 65/106 (61%), Gaps = 6/106 (5%)

Query: 37  WHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNIL 96
           W+++I+GP D+PY + +F L +    EYP+ PP +KF       H NV +  GEICL+IL
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMF--HPNV-YANGEICLDIL 92

Query: 97  KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKA 142
           +N  W+P +++   + +I  L   P+P+SP N++ + L   KD K+
Sbjct: 93  QNR-WTPTYDVASILTSIQSLFNDPNPASPANVEAATL--FKDHKS 135

>YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}
           RAD6Ubiquitin-conjugating enzyme (E2), involved in
           postreplication repair (as a heterodimer with Rad18p),
           DSBR and checkpoint control (as a heterodimer with
           Bre1p), ubiquitin-mediated N-end rule protein
           degradation (as a heterodimer with Ubr1p
          Length = 172

 Score = 74.7 bits (182), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 65/106 (61%), Gaps = 6/106 (5%)

Query: 37  WHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNIL 96
           W+++I+GP D+PY + +F L +    EYP+ PP +KF       H NV +  GEICL+IL
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMF--HPNV-YANGEICLDIL 92

Query: 97  KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKA 142
           +N  W+P +++   + +I  L   P+P+SP N++ + L   KD K+
Sbjct: 93  QN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATL--FKDHKS 135

>TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa]
           {ON} Anc_6.109 YGL058W
          Length = 169

 Score = 74.7 bits (182), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 65/106 (61%), Gaps = 6/106 (5%)

Query: 37  WHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNIL 96
           W+++I+GP D+PY + +F L +    EYP+ PP +KF       H NV +  GEICL+IL
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMF--HPNV-YANGEICLDIL 92

Query: 97  KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKA 142
           +N  W+P +++   + +I  L   P+P+SP N++ + L   KD K+
Sbjct: 93  QN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATL--FKDHKS 135

>ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 aa]
           {ON} similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058W RAD6 Ubiquitin-conjugating enzyme (E2) involved
           in postreplication repair (with Rad18p) sporulation
           telomere silencing and ubiquitin-mediated N-end rule
           protein degradation (with Ubr1p)
          Length = 168

 Score = 74.7 bits (182), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 65/106 (61%), Gaps = 6/106 (5%)

Query: 37  WHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNIL 96
           W+++I+GP D+PY + +F L +    EYP+ PP +KF       H NV +  GEICL+IL
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMF--HPNV-YANGEICLDIL 92

Query: 97  KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKA 142
           +N  W+P +++   + +I  L   P+P+SP N++ + L   KD K+
Sbjct: 93  QNR-WTPTYDVASILTSIQSLFNDPNPASPANVEAATL--FKDHKS 135

>TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {ON}
           Anc_6.109 YGL058W
          Length = 169

 Score = 74.7 bits (182), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 65/106 (61%), Gaps = 6/106 (5%)

Query: 37  WHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNIL 96
           W+++I+GP D+PY + +F L +    EYP+ PP +KF       H NV +  GEICL+IL
Sbjct: 36  WNAMIIGPSDTPYEDGTFRLLLEFDEEYPNKPPHVKFISEMF--HPNV-YANGEICLDIL 92

Query: 97  KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKA 142
           +N  W+P +++   + +I  L   P+P+SP N++ + L   KD K+
Sbjct: 93  QNR-WTPTYDVASILTSIQSLFNDPNPASPANVEAATL--FKDHKS 135

>Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa]
           {ON} YBR082C (UBC4) - 1:1 [contig 457] FULL
          Length = 236

 Score = 75.9 bits (185), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 64/124 (51%), Gaps = 7/124 (5%)

Query: 18  PDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNS 77
           P    +  PV +   DL +W + I+GP DSPY    F L IH PT+YP  PP I F    
Sbjct: 106 PPTSCSAGPVGD---DLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTKI 162

Query: 78  IPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTL 137
             P+ N N   G ICL+ILK++ WSP   +   + +I  LL   +P  PL  +++ +   
Sbjct: 163 YHPNINAN---GNICLDILKDQ-WSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYKT 218

Query: 138 KDSK 141
             +K
Sbjct: 219 DRAK 222

>AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL058W
           (RAD6)
          Length = 170

 Score = 74.7 bits (182), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 65/106 (61%), Gaps = 6/106 (5%)

Query: 37  WHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNIL 96
           W+++I+GP D+PY + +F L +    EYP+ PP +KF       H NV +  GEICL+IL
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMF--HPNV-YANGEICLDIL 92

Query: 97  KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKA 142
           +N  W+P +++   + +I  L   P+P+SP N++ + L   KD K+
Sbjct: 93  QN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATL--FKDHKS 135

>Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W
           (REAL)
          Length = 171

 Score = 74.7 bits (182), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 65/106 (61%), Gaps = 6/106 (5%)

Query: 37  WHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNIL 96
           W+++I+GP D+PY + +F L +    EYP+ PP +KF       H NV +  GEICL+IL
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMF--HPNV-YANGEICLDIL 92

Query: 97  KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKA 142
           +N  W+P +++   + +I  L   P+P+SP N++ + L   KD K+
Sbjct: 93  QNR-WTPTYDVASILTSIQSLFNDPNPASPANVEAATL--FKDHKS 135

>Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W
           (REAL)
          Length = 173

 Score = 74.7 bits (182), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 65/106 (61%), Gaps = 6/106 (5%)

Query: 37  WHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNIL 96
           W+++I+GP D+PY + +F L +    EYP+ PP +KF       H NV +  GEICL+IL
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMF--HPNV-YANGEICLDIL 92

Query: 97  KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKA 142
           +N  W+P +++   + +I  L   P+P+SP N++ + L   KD K+
Sbjct: 93  QNR-WTPTYDVASILTSIQSLFNDPNPASPANVEAATL--FKDHKS 135

>TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON}
           Anc_6.109 YGL058W
          Length = 174

 Score = 74.3 bits (181), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 40/106 (37%), Positives = 65/106 (61%), Gaps = 6/106 (5%)

Query: 37  WHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNIL 96
           W+++I+GP D+PY + +F L +    EYP+ PP +KF       H NV +  GEICL+IL
Sbjct: 36  WNAMIIGPSDTPYEDGTFRLVLEFDEEYPNKPPHVKFLSEMF--HPNV-YANGEICLDIL 92

Query: 97  KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKA 142
           +N  W+P +++   + +I  L   P+P+SP N++ + L   KD +A
Sbjct: 93  QNR-WTPTYDVSSILTSIQSLFNDPNPASPANVEAATL--FKDHRA 135

>ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 159

 Score = 73.6 bits (179), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 73/132 (55%), Gaps = 12/132 (9%)

Query: 29  NATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPP--HCNVNF 86
           N   DL +W  +I+GP+ +PY +  F + +H P  YP +PP +KF    I P  H NV+ 
Sbjct: 37  NNEDDLRDWSGMIVGPEGTPYESLKFKISLHFPDSYPYVPPKVKF----ISPMWHPNVDM 92

Query: 87  TTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSL 146
            +G ICL+ILK++ WS V+N+   + ++  L   P+ SSPLN   + L   KD   Y   
Sbjct: 93  -SGNICLDILKDQ-WSAVYNVQTILLSLQSLFEEPNNSSPLNAVAAELWD-KDMVEYK-- 147

Query: 147 IKYYLYNFPKPE 158
            K  L  + +PE
Sbjct: 148 -KRLLSRYEEPE 158

>KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {ON}
           highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 164

 Score = 73.6 bits (179), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 61/99 (61%), Gaps = 4/99 (4%)

Query: 37  WHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNIL 96
           W+++I+GP D+PY + +F L +    EYP+ PP +KF       H NV +  GEICL+IL
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMF--HPNV-YANGEICLDIL 92

Query: 97  KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLL 135
           +N  W+P +++   + +I  L   P+P+SP N++ + L 
Sbjct: 93  QNR-WTPTYDVASILTSIQSLFNDPNPASPANVEAATLF 130

>KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON}
           Anc_1.436 YEL012W
          Length = 210

 Score = 74.7 bits (182), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 74/139 (53%), Gaps = 5/139 (3%)

Query: 21  MTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPP 80
           + + H V      +  +H    GPKD+PY N  + L + +P  YP   P I F  N I  
Sbjct: 17  LMSDHEVELINDSMQEFHIKFHGPKDTPYENGVWRLHVELPDNYPFKSPSIGF-VNKI-Y 74

Query: 81  HCNVNFTTGEICLNILKNENWSPVWNLLYSVQAII-QLLAYPDPSSPLNIDLSRLLTLKD 139
           H N++  +G ICL+++ N  WSP+++LL  V+ +I  LL  P+ S PLN + +  L L+D
Sbjct: 75  HPNIDIASGSICLDVI-NSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAA-TLQLRD 132

Query: 140 SKAYNSLIKYYLYNFPKPE 158
            K Y   IK Y+  +   E
Sbjct: 133 KKMYEEKIKEYIDKYATEE 151

>KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON}
           Anc_1.436 YEL012W
          Length = 187

 Score = 73.6 bits (179), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 72/135 (53%), Gaps = 5/135 (3%)

Query: 25  HPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNV 84
           H V+    ++  +H    GPKD+PY +  + L + +P  YP   P I F       H N+
Sbjct: 20  HKVTLVNDNMQEFHVKFHGPKDTPYEHGVWRLHVELPDNYPYKSPSIGFVNKIF--HPNI 77

Query: 85  NFTTGEICLNILKNENWSPVWNLLYSVQAII-QLLAYPDPSSPLNIDLSRLLTLKDSKAY 143
           +  +G ICL+++ N  WSP+++L+  V+ +I  LL  P+ S PLN + +  L L+D   Y
Sbjct: 78  DVASGSICLDVI-NSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKVLY 135

Query: 144 NSLIKYYLYNFPKPE 158
              IK Y+  +  PE
Sbjct: 136 EQKIKEYIDKYATPE 150

>CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly
           similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058w RAD6 E2 ubiquitin-conjugating
          Length = 167

 Score = 72.8 bits (177), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 65/106 (61%), Gaps = 6/106 (5%)

Query: 37  WHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNIL 96
           W+++I+GP D+PY + +F L +    +YP+ PP +KF       H NV +  GEICL+IL
Sbjct: 36  WNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFLSEMF--HPNV-YANGEICLDIL 92

Query: 97  KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKA 142
           +N  W+P +++   + +I  L   P+P+SP N++ + L   KD K+
Sbjct: 93  QNR-WTPTYDVASILTSIQSLFNDPNPASPANVEAATL--FKDHKS 135

>NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109
          Length = 171

 Score = 72.8 bits (177), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 64/106 (60%), Gaps = 6/106 (5%)

Query: 37  WHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNIL 96
           W+++I+GP ++PY + +F L +    EYP+ PP +KF      P+   N   GEICL+IL
Sbjct: 36  WNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMFHPNVYAN---GEICLDIL 92

Query: 97  KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKA 142
           +N  W+P +++   + +I  L   P+P+SP N++ + L   KD K+
Sbjct: 93  QN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATL--FKDHKS 135

>NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON}
           Anc_7.54
          Length = 164

 Score = 72.8 bits (177), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 45/108 (41%), Positives = 63/108 (58%), Gaps = 8/108 (7%)

Query: 29  NATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPP--HCNVNF 86
           N   DL++W +II GPKD+PY    F L       YP  PP++KF    I P  H NV+ 
Sbjct: 41  NDEEDLTHWSAIITGPKDTPYDGLRFKLSFQFSDSYPYAPPLVKF----ISPMWHPNVDM 96

Query: 87  TTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRL 134
            +G ICL+ILK++ WS V+N+   + ++  LL  P+ SSPLN   + L
Sbjct: 97  -SGNICLDILKDQ-WSAVYNVETILLSLQALLEEPNNSSPLNAVAAEL 142

>KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.109
           YGL058W
          Length = 151

 Score = 72.4 bits (176), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 65/106 (61%), Gaps = 6/106 (5%)

Query: 37  WHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNIL 96
           W+++I+GP D+PY + +F L +    +YP+ PP +KF       H NV +  GEICL+IL
Sbjct: 21  WNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFLSEMF--HPNV-YANGEICLDIL 77

Query: 97  KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKA 142
           +N  W+P +++   + +I  L   P+P+SP N++ + L   KD K+
Sbjct: 78  QNR-WTPTYDVASILTSIQSLFNDPNPASPANVEAATL--FKDYKS 120

>CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {ON}
           highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012w UBC8 E2 ubiquitin-conjugating enzyme
          Length = 214

 Score = 73.9 bits (180), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 71/139 (51%), Gaps = 5/139 (3%)

Query: 21  MTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPP 80
           + + H V      +  +H    GPKD+PY    + L + +P  YP   P I F       
Sbjct: 17  LMSDHEVELVEDSMQEFHVKFYGPKDTPYEGGVWRLHVELPDNYPYKSPSIGFVNKIF-- 74

Query: 81  HCNVNFTTGEICLNILKNENWSPVWNLLYSVQAII-QLLAYPDPSSPLNIDLSRLLTLKD 139
           H N++  +G ICL+++ N  WSP+++LL  V+ ++  LL  P+ S PLN + +  L LKD
Sbjct: 75  HPNIDIASGSICLDVI-NSTWSPLYDLLNIVEWMLPGLLKEPNGSDPLNNEAAN-LQLKD 132

Query: 140 SKAYNSLIKYYLYNFPKPE 158
            K Y   ++ Y+  +   E
Sbjct: 133 KKVYEEKVREYIDKYATKE 151

>NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa]
           {ON} 
          Length = 245

 Score = 74.3 bits (181), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 72/135 (53%), Gaps = 5/135 (3%)

Query: 21  MTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPP 80
           + + H V     ++  ++    GPKD+PY N  + L + +P  YP   P I F       
Sbjct: 34  LMSDHDVELVNDNMQEFYIKFCGPKDTPYENGVWRLHVELPDNYPYKSPSIGFVNKIF-- 91

Query: 81  HCNVNFTTGEICLNILKNENWSPVWNLLYSVQAII-QLLAYPDPSSPLNIDLSRLLTLKD 139
           H N++  +G ICL+++ N  WSP+++LL  V+ +I  LL  P+ S PLN + +  L LKD
Sbjct: 92  HPNIDIASGSICLDVI-NSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAA-TLELKD 149

Query: 140 SKAYNSLIKYYLYNF 154
            K Y   IK Y+  +
Sbjct: 150 KKLYEERIKEYIAKY 164

>KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 160

 Score = 72.4 bits (176), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 65/106 (61%), Gaps = 6/106 (5%)

Query: 37  WHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNIL 96
           W+++I+GP ++PY + +F L +    EYP+ PP +KF       H NV +  GEICL+IL
Sbjct: 32  WNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFLSEMF--HPNV-YANGEICLDIL 88

Query: 97  KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKA 142
           +N  W+P +++   + +I  L   P+P+SP N++ + L   KD K+
Sbjct: 89  QNR-WTPTYDVASILTSIQSLFNDPNPASPANVEAATL--FKDHKS 131

>KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.109
           YGL058W
          Length = 153

 Score = 72.0 bits (175), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 65/106 (61%), Gaps = 6/106 (5%)

Query: 37  WHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNIL 96
           W+++I+GP D+PY + +F L +    +YP+ PP +KF       H NV +  GEICL+IL
Sbjct: 21  WNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFLSEMF--HPNV-YANGEICLDIL 77

Query: 97  KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKA 142
           +N  W+P +++   + +I  L   P+P+SP N++ + L   KD K+
Sbjct: 78  QNR-WTPTYDVSSILTSIQSLFNDPNPASPANVEAATL--FKDHKS 120

>TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1.436
           YEL012W
          Length = 203

 Score = 72.8 bits (177), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 72/139 (51%), Gaps = 5/139 (3%)

Query: 21  MTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPP 80
           + + H V     ++  +H    GPKD+PY    + L + +P  YP   P I F    +  
Sbjct: 4   LMSDHEVELVNDNMQEFHVKFRGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVNKIL-- 61

Query: 81  HCNVNFTTGEICLNILKNENWSPVWNLLYSVQAII-QLLAYPDPSSPLNIDLSRLLTLKD 139
           H N++  +G ICL+++ N  WSP+++L   V+ +I  LL  P+ S PLN + +  L L+D
Sbjct: 62  HPNIDVASGSICLDVI-NSTWSPLYDLKNIVEWMIPGLLKEPNGSDPLN-NEAATLQLRD 119

Query: 140 SKAYNSLIKYYLYNFPKPE 158
            K Y   IK Y+  +   E
Sbjct: 120 KKLYEEKIKEYIDKYASDE 138

>Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W
           (RAD6) - Ubiquitin conjugating (E2) enzyme. The
           C-terminal 23 residues are critical for sporulation and
           histone polyubiquitinating activity, but not UV repair
           or induced mutagenesis. [contig 237] FULL
          Length = 152

 Score = 71.6 bits (174), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 65/106 (61%), Gaps = 6/106 (5%)

Query: 37  WHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNIL 96
           W+++I+GP ++PY + +F L +    EYP+ PP +KF       H NV +  GEICL+IL
Sbjct: 21  WNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFLSEIF--HPNV-YANGEICLDIL 77

Query: 97  KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKA 142
           +N  W+P +++   + +I  L   P+P+SP N++ + L   KD K+
Sbjct: 78  QN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATL--FKDHKS 120

>NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON} 
          Length = 231

 Score = 72.8 bits (177), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 70/135 (51%), Gaps = 5/135 (3%)

Query: 25  HPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNV 84
           H V    + +  +H    GPKD+PY    + L + +P  YP   P I F       H N+
Sbjct: 43  HEVELVNNSMQEFHIKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVNKIF--HPNI 100

Query: 85  NFTTGEICLNILKNENWSPVWNLLYSVQAII-QLLAYPDPSSPLNIDLSRLLTLKDSKAY 143
           +  +G ICL+++ N  WSP+++LL  V+ +I  LL  P+ S PLN + +  L L+D K Y
Sbjct: 101 DIASGSICLDVI-NSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAA-TLELRDKKLY 158

Query: 144 NSLIKYYLYNFPKPE 158
              I+ Y+  +   E
Sbjct: 159 EEKIREYIDKYATEE 173

>Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W
           (REAL)
          Length = 170

 Score = 71.6 bits (174), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 64/106 (60%), Gaps = 6/106 (5%)

Query: 37  WHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNIL 96
           W+++I+GP D+ Y + +F L +    EYP+ PP +KF       H NV +  GEICL+IL
Sbjct: 36  WNAMIIGPADTSYEDGTFRLLLEFDEEYPNKPPHVKFLSEMF--HPNV-YANGEICLDIL 92

Query: 97  KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKA 142
           +N  W+P +++   + +I  L   P+P+SP N++ + L   KD K+
Sbjct: 93  QNR-WTPTYDVASILTSIQSLFNDPNPASPANVEAATL--FKDHKS 135

>ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 aa]
           {ON} highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of fructose-1 6-
           bisphosphatase (FBPase) cytoplasmic enzyme that
           catalyzes the ubiquitination of histones in vitro
          Length = 209

 Score = 70.9 bits (172), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 69/135 (51%), Gaps = 5/135 (3%)

Query: 25  HPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNV 84
           H V     ++  +H    GPKD+PY    + L + +P  YP   P I F       H N+
Sbjct: 22  HEVELVNDNMQEFHVKFHGPKDTPYETGVWRLHVELPDNYPYKSPSIGFVNKIF--HPNI 79

Query: 85  NFTTGEICLNILKNENWSPVWNLLYSVQAII-QLLAYPDPSSPLNIDLSRLLTLKDSKAY 143
           +  +G ICL+++ N  WSP+++L   V+ +I  LL  P+ S PLN + +  L L+D K Y
Sbjct: 80  DIASGSICLDVI-NSTWSPLYDLKNIVEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKKLY 137

Query: 144 NSLIKYYLYNFPKPE 158
              IK Y+  +   E
Sbjct: 138 EEKIKEYIDKYACAE 152

>Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa]
           {ON} (30890..30894,31122..31788) [672 nt, 224 aa]
          Length = 223

 Score = 70.9 bits (172), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 69/135 (51%), Gaps = 5/135 (3%)

Query: 25  HPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNV 84
           H V     ++  ++    GPKD+PY N  + L + +P  YP   P I F      P  N+
Sbjct: 21  HDVELVNDNMQEFYVKFCGPKDTPYENGCWRLHVELPDNYPYKSPSIGFVNKIFHP--NI 78

Query: 85  NFTTGEICLNILKNENWSPVWNLLYSVQAII-QLLAYPDPSSPLNIDLSRLLTLKDSKAY 143
           +  +G ICL+++ N  WSP+++LL  V+ +I  LL  P+ S PLN + +  L L D   Y
Sbjct: 79  DIASGSICLDVI-NSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAAG-LQLHDKTLY 136

Query: 144 NSLIKYYLYNFPKPE 158
              IK Y+  +   E
Sbjct: 137 EQKIKEYIDKYATSE 151

>KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609
           bp, 202 aa] {ON} similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 202

 Score = 69.3 bits (168), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 69/139 (49%), Gaps = 5/139 (3%)

Query: 21  MTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPP 80
           + + H V      +  +H    GPKD+PY    + L + +P  YP   P I F       
Sbjct: 17  LMSDHDVELVEDKMQEFHIKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVNKIF-- 74

Query: 81  HCNVNFTTGEICLNILKNENWSPVWNLLYSVQAII-QLLAYPDPSSPLNIDLSRLLTLKD 139
           H N++  +G ICL+++ N  WSP+++LL  V+ +I  LL  P+ S PLN + +  L LKD
Sbjct: 75  HPNIDAASGSICLDVI-NSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLN-NEAATLQLKD 132

Query: 140 SKAYNSLIKYYLYNFPKPE 158
              Y   I  Y+  +   E
Sbjct: 133 KDMYEQKIHEYINKYATKE 151

>TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 bp,
           219 aa] {ON} Anc_1.436 YEL012W
          Length = 219

 Score = 69.3 bits (168), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 69/135 (51%), Gaps = 5/135 (3%)

Query: 25  HPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNV 84
           H V     ++  +     GP ++PY    + L + +P  YP   P I F       H N+
Sbjct: 20  HDVELVNDNMQEFFIKFFGPDETPYEKGVWRLHVELPDNYPYKSPSIGFVNKIF--HPNI 77

Query: 85  NFTTGEICLNILKNENWSPVWNLLYSVQAII-QLLAYPDPSSPLNIDLSRLLTLKDSKAY 143
           +  +G ICL+++ N  WSP+++L+  V+ +I  LL  P+ + PLN + +  L L+D K Y
Sbjct: 78  DIASGSICLDVI-NSTWSPLYDLINIVEWMIPGLLKEPNGTDPLNNEAAG-LQLRDKKLY 135

Query: 144 NSLIKYYLYNFPKPE 158
              IK Y+  +  PE
Sbjct: 136 EEKIKEYIDKYATPE 150

>NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON} 
          Length = 176

 Score = 68.2 bits (165), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/106 (34%), Positives = 62/106 (58%), Gaps = 6/106 (5%)

Query: 37  WHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNIL 96
           W+++I+GP ++PY + +F L +    EYP   P +KF      P+   N   GEICL+IL
Sbjct: 36  WNAMIIGPAETPYEDGTFRLLLEFDEEYPINRPHVKFLSEMFHPNVYAN---GEICLDIL 92

Query: 97  KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKA 142
           +N  W+P +++   + +I  L   P+P+SP N++ + L   KD K+
Sbjct: 93  QNR-WTPTYDVASILTSIQSLFNDPNPASPANVEAATL--FKDHKS 135

>Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp,
           211 aa] {ON} similar to Ashbya gossypii AEL045W
           1-intron
          Length = 211

 Score = 68.9 bits (167), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 70/135 (51%), Gaps = 5/135 (3%)

Query: 25  HPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNV 84
           H V     ++  +H   LGP+ +PY    + L + +P  YP   P I F       H N+
Sbjct: 20  HEVELVDDNMQEFHVKFLGPRGTPYERGVWRLHVELPDNYPYKSPSIGFVNKIF--HPNI 77

Query: 85  NFTTGEICLNILKNENWSPVWNLLYSVQAII-QLLAYPDPSSPLNIDLSRLLTLKDSKAY 143
           +  +G ICL+++ N  WSP+++L+  V+ +I  LL  P+ S PLN + +  L LK+ K Y
Sbjct: 78  DAASGSICLDVI-NSTWSPLYDLINIVEWMIPGLLKEPNGSDPLN-NEAATLQLKNPKMY 135

Query: 144 NSLIKYYLYNFPKPE 158
              I+ Y+  +   E
Sbjct: 136 EEKIQEYIDKYATSE 150

>TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON}
           Anc_7.54 YOR339C
          Length = 156

 Score = 67.4 bits (163), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 71/135 (52%), Gaps = 10/135 (7%)

Query: 2   SRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIP 61
           S + +  N + +L   P    +  P S    DL+ W  +I+GP+ +PY N  F L +   
Sbjct: 9   SVVKRLQNELVQLMMSPTPGLSAFPASE--DDLTQWFGVIVGPEGTPYENLKFRLSLKFT 66

Query: 62  TEYPSIPPVIKFNKNSIPP--HCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLA 119
            +YP  PP + F    + P  H NV+  +G ICL+ILK++ WS V+N+   + ++  LL 
Sbjct: 67  DQYPYQPPKVTF----VSPMWHPNVDM-SGNICLDILKDQ-WSAVYNVQTILLSLQALLE 120

Query: 120 YPDPSSPLNIDLSRL 134
            P+  SPLN   + L
Sbjct: 121 EPNNGSPLNAIAAEL 135

>KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.301
           YDR054C
          Length = 110

 Score = 66.2 bits (160), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 38/93 (40%), Positives = 51/93 (54%), Gaps = 4/93 (4%)

Query: 42  LGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENW 101
           +GP DSPY    F L IH PT+YP  PP I F      P+ N N   G ICL+ILK++ W
Sbjct: 1   MGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTTKIYHPNINAN---GNICLDILKDQ-W 56

Query: 102 SPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRL 134
           SP   L   + +I  LL   +P  PL  +++ +
Sbjct: 57  SPALTLSKVLLSICSLLTDANPDDPLVPEIAHI 89

>TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.436
           YEL012W
          Length = 226

 Score = 68.6 bits (166), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 43/128 (33%), Positives = 67/128 (52%), Gaps = 5/128 (3%)

Query: 25  HPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNV 84
           H V     ++  ++    GPKD+PY    + L + +P  YP   P I F      P  N+
Sbjct: 22  HDVRLVNDNMQEFYVKFHGPKDTPYEGGVWRLHVELPDNYPYKSPSIGFVNKIFHP--NI 79

Query: 85  NFTTGEICLNILKNENWSPVWNLLYSVQAII-QLLAYPDPSSPLNIDLSRLLTLKDSKAY 143
           +  +G ICL+++ N  WSP+++LL  ++ +I  LL  P+ S PLN + +  L L D K Y
Sbjct: 80  DIASGSICLDVI-NSTWSPLYDLLNIIEWMIPGLLKEPNGSDPLNNEAAG-LQLHDKKIY 137

Query: 144 NSLIKYYL 151
              IK Y+
Sbjct: 138 EEKIKEYI 145

>YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}
           UBC11Ubiquitin-conjugating enzyme most similar in
           sequence to Xenopus ubiquitin-conjugating enzyme E2-C,
           but not a true functional homolog of this E2; unlike
           E2-C, not required for the degradation of mitotic cyclin
           Clb2
          Length = 156

 Score = 67.0 bits (162), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 59/104 (56%), Gaps = 8/104 (7%)

Query: 33  DLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPP--HCNVNFTTGE 90
           DL+ W   I GPKD+PY    F + +  P  YP  PP+IKF    + P  H NV+  +G 
Sbjct: 37  DLTYWVGYITGPKDTPYSGLKFKVSLKFPQNYPFHPPMIKF----LSPMWHPNVD-KSGN 91

Query: 91  ICLNILKNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRL 134
           ICL+ILK E WS V+N+   + ++  LL  P+  SPLN   + L
Sbjct: 92  ICLDILK-EKWSAVYNVETILLSLQSLLGEPNNRSPLNAVAAEL 134

>Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON}
           (25814..26293) [480 nt, 160 aa]
          Length = 159

 Score = 67.0 bits (162), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 45/123 (36%), Positives = 64/123 (52%), Gaps = 18/123 (14%)

Query: 14  LNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKF 73
           L+A PD+            +L+ W   I GP DSPY    F + +  P  YP  PP +KF
Sbjct: 32  LSAFPDH----------EENLTKWSGTITGPDDSPYAGLRFKISLTFPDRYPYEPPKVKF 81

Query: 74  NKNSIPP--HCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDL 131
               + P  H NV+  +G ICL++LK E WS V+N+   + ++  LL  P+ SSPLN   
Sbjct: 82  ----VSPMWHPNVDL-SGNICLDVLK-EKWSAVYNVQTILLSLQALLGEPNNSSPLNAIA 135

Query: 132 SRL 134
           + L
Sbjct: 136 AEL 138

>SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {ON}
           highly similar to gnl|GLV|KLLA0A11198g Kluyveromyces
           lactis KLLA0A11198g and similar to YEL012W
           uniprot|P28263 Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin- conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6-bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 207

 Score = 67.8 bits (164), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 43/139 (30%), Positives = 71/139 (51%), Gaps = 5/139 (3%)

Query: 21  MTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPP 80
           + + H V      +  +H    GPKD+PY    + L + +P  YP   P I F       
Sbjct: 4   LMSDHEVDLVNDSMQEFHVKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGFVNKIF-- 61

Query: 81  HCNVNFTTGEICLNILKNENWSPVWNLLYSVQAII-QLLAYPDPSSPLNIDLSRLLTLKD 139
           H N++  +G ICL+++ N  WSP+++L+  V+ +I  LL  P+ S PLN + +  L LK+
Sbjct: 62  HPNIDAASGSICLDVI-NSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAAT-LQLKN 119

Query: 140 SKAYNSLIKYYLYNFPKPE 158
            + Y   I+ Y+  +   E
Sbjct: 120 KELYEEKIQEYIDKYATSE 138

>Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 66.2 bits (160), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 43/117 (36%), Positives = 65/117 (55%), Gaps = 9/117 (7%)

Query: 33  DLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPP--HCNVNFTTGE 90
           DL+ W   I+GP+ +PY +  F + ++ P  YP  PP +KF    + P  H NV+  +G 
Sbjct: 37  DLTYWTGYIMGPQGTPYSDLKFKISLNFPENYPFHPPKVKF----VSPMWHPNVD-KSGN 91

Query: 91  ICLNILKNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSLI 147
           ICL+ILK E WS V+N+   + ++  LL  P+  SPLN   + L   KD + Y   +
Sbjct: 92  ICLDILK-EKWSAVYNVETILLSLQSLLGEPNNRSPLNAVAAELWD-KDMEGYKKKV 146

>ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092W UBC13 Ubiquitin-conjugating enzyme involved in
           the error-free DNA postreplication repair pathway
           interacts with Mms2p to assemble ubiquitin chains at the
           Ub Lys-63 residue DNA damage triggers redistribution
           from the cytoplasm to the nucleus
          Length = 151

 Score = 65.5 bits (158), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/130 (34%), Positives = 70/130 (53%), Gaps = 10/130 (7%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           RIIKE     +L + P    +  P  +   +L  +   I GP++SPY N  F LE+++P 
Sbjct: 7   RIIKE---TERLASDPVPGISAEPHED---NLRYFAVTIEGPEESPYENGVFELELYLPD 60

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYPD 122
           +YP   P ++F      P+ +     G ICL++LKN NWSP   +   + +I  LLA P+
Sbjct: 61  DYPMEAPKVRFLTRIYHPNID---RLGRICLDVLKN-NWSPALQIRTVLLSIQALLASPN 116

Query: 123 PSSPLNIDLS 132
           P+ PL  D++
Sbjct: 117 PNDPLANDVA 126

>TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49
           YLR306W
          Length = 151

 Score = 65.5 bits (158), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 47/131 (35%), Positives = 68/131 (51%), Gaps = 10/131 (7%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           RIIKE     +L + P    T  P  +   +L  +   I GPKDS Y N  F LE+ +P 
Sbjct: 7   RIIKE---TERLISDPVPGITAQPHED---NLRYFSVTIEGPKDSAYENGVFELELFLPD 60

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYPD 122
           +YP   P ++F      P+ +     G ICL++LKN NWSP   +   + +I  LLA P+
Sbjct: 61  DYPMEAPKVRFLTKIYHPNID---RLGRICLDVLKN-NWSPALQIRTVLLSIQALLASPN 116

Query: 123 PSSPLNIDLSR 133
           P+ PL  D++ 
Sbjct: 117 PNDPLANDVAE 127

>AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL012W
           (UBC8); 1-intron
          Length = 211

 Score = 66.6 bits (161), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 43/139 (30%), Positives = 71/139 (51%), Gaps = 5/139 (3%)

Query: 21  MTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPP 80
           + + H V     ++  +H    GPK +PY    + L + +P  YP   P I F       
Sbjct: 16  LMSDHDVELVDDNMQEFHVKFHGPKGTPYERGVWRLHVELPDNYPYKSPSIGFVNKIF-- 73

Query: 81  HCNVNFTTGEICLNILKNENWSPVWNLLYSVQAII-QLLAYPDPSSPLNIDLSRLLTLKD 139
           H N++  +G ICL+++ N  WSP+++LL  V+ +I  LL  P+ S PLN + +  L LK+
Sbjct: 74  HPNIDAASGSICLDVI-NSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAA-TLQLKN 131

Query: 140 SKAYNSLIKYYLYNFPKPE 158
            + Y   I+ Y+  +   E
Sbjct: 132 PQMYEEKIQEYIDKYATEE 150

>KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 159
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus ,
          Length = 159

 Score = 65.5 bits (158), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 69/132 (52%), Gaps = 10/132 (7%)

Query: 2   SRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIP 61
            RIIKE     +L + P    T  P  +   +L  +   I GP+ SPY N  F LE+ +P
Sbjct: 6   KRIIKE---TERLVSDPVPGITAEPHED---NLRYFQVTIEGPQQSPYENGVFQLELFLP 59

Query: 62  TEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYP 121
            +YP   P ++F       H N++   G ICL++LKN NWSP   +   + ++  LLA P
Sbjct: 60  DDYPMEAPKVRFLTKIY--HPNID-RLGRICLDVLKN-NWSPALQIRTVLLSVQALLASP 115

Query: 122 DPSSPLNIDLSR 133
           +P+ PL  D++ 
Sbjct: 116 NPNDPLANDVAE 127

>Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 65.5 bits (158), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 72/138 (52%), Gaps = 19/138 (13%)

Query: 12  RKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVI 71
           R ++A P++           +DL+ W   I GP+ +PY +  F + ++ P  YP  PP +
Sbjct: 26  RSISAFPED----------DNDLTYWTGYITGPQGTPYSDLKFKISLNFPESYPFHPPKV 75

Query: 72  KFNKNSIPP--HCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNI 129
           KF    + P  H NV+  +G ICL+ILK E WS V+N+   + ++  LL  P+  SPLN 
Sbjct: 76  KF----VSPMWHPNVDM-SGNICLDILK-EKWSAVYNVETILLSLQSLLGEPNNRSPLNA 129

Query: 130 DLSRLLTLKDSKAYNSLI 147
             + L   KD + Y   +
Sbjct: 130 VAAELWD-KDMEEYKKKV 146

>Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..1958)
           [459 nt, 153 aa]
          Length = 152

 Score = 65.1 bits (157), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 52/155 (33%), Positives = 78/155 (50%), Gaps = 11/155 (7%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           RIIKE     +L + P    T  P  +   +L  +   I GP+ SPY N  F LE+ +P 
Sbjct: 7   RIIKE---TERLVSDPVPGITAEPHDD---NLRYFEVTIEGPQQSPYENGVFDLELFLPD 60

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYPD 122
           +YP   P ++F       H N++   G ICL++LK  NWSP   +   + +I  LLA P+
Sbjct: 61  DYPMEAPKVRFLTKIY--HPNID-RLGRICLDVLKT-NWSPALQIRTVLLSIQALLASPN 116

Query: 123 PSSPLNIDLSRLLTLKDSKAYNSLIKY-YLYNFPK 156
           P+ PL  D++      +S A +   ++  LY  PK
Sbjct: 117 PNDPLANDVAEDWIKDESSAIDKAKQWTQLYAQPK 151

>AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, 154
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDR092W (UBC13); 1-intron
          Length = 154

 Score = 64.7 bits (156), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 37/93 (39%), Positives = 55/93 (59%), Gaps = 4/93 (4%)

Query: 41  ILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNEN 100
           I GP+ SPY +  F LE+ +P EYP  PP ++F       H N++   G ICL++LK  N
Sbjct: 39  IEGPQQSPYEHGVFRLELFLPDEYPMEPPKVRFLTKIY--HPNID-RLGRICLDVLKT-N 94

Query: 101 WSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSR 133
           WSP   +   + +I  LLA P+P+ PL  D+++
Sbjct: 95  WSPALQIRTVLLSIQALLATPNPNDPLANDVAK 127

>KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa]
           {ON} Anc_8.230 YDR092W
          Length = 152

 Score = 64.7 bits (156), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 53/157 (33%), Positives = 78/157 (49%), Gaps = 13/157 (8%)

Query: 2   SRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIP 61
            RIIKE     +L   P    T  P  +   +L  +   + GP  SPY N  F LE+++P
Sbjct: 6   KRIIKE---TERLITDPVPGITAEPHDD---NLRYFEVTVEGPVGSPYENGIFQLELYLP 59

Query: 62  TEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYP 121
            +YP   P ++F       H N++   G ICL++LK  NWSP   +   + +I  LLA P
Sbjct: 60  DDYPMEAPKVRFLTKIY--HPNID-RLGRICLDVLKT-NWSPALQIRTVLLSIQALLASP 115

Query: 122 DPSSPLNIDLSRLLTLKDSKAYNSLIKYY--LYNFPK 156
           +P+ PL  D++    +KD +A     K +  LY  PK
Sbjct: 116 NPNDPLANDVAEDW-IKDEEAAKQTAKKWSKLYATPK 151

>SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741)
           [462 bp, 153 aa] {ON} highly similar to uniprot|P52490
           Saccharomyces cerevisiae YDR092W UBC13
           Ubiquitin-conjugating enzyme involved in the error-free
           DNA postreplication repair pathway interacts with Mms2p
           to assemble ubiquitin chains at the Ub Lys-63 residue
           DNA damage triggers redistribution from the cytoplasm to
           the nucleus
          Length = 153

 Score = 64.3 bits (155), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 56/101 (55%), Gaps = 4/101 (3%)

Query: 33  DLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEIC 92
           +L  +   I GP+ SPY N  F LE+ +P +YP   P ++F      P+ +     G IC
Sbjct: 31  NLRYFQVTIEGPQQSPYENGVFELELFLPEDYPMEAPKVRFLTKIYHPNID---RLGRIC 87

Query: 93  LNILKNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSR 133
           L++LKN NWSP   +   + +I  LLA P+P+ PL  D++ 
Sbjct: 88  LDVLKN-NWSPALQIRTVLLSIQALLASPNPNDPLANDVAE 127

>YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {ON} 
           UBC13Ubiquitin-conjugating enzyme involved in the
           error-free DNA postreplication repair pathway; interacts
           with Mms2p to assemble ubiquitin chains at the Ub Lys-63
           residue; DNA damage triggers redistribution from the
           cytoplasm to the nucleus
          Length = 153

 Score = 63.5 bits (153), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 52/159 (32%), Positives = 81/159 (50%), Gaps = 13/159 (8%)

Query: 2   SRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIP 61
            RIIKE     KL + P    T  P  +   +L  +   I GP+ SPY +  F LE+++P
Sbjct: 6   KRIIKE---TEKLVSDPVPGITAEPHDD---NLRYFQVTIEGPEQSPYEDGIFELELYLP 59

Query: 62  TEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYP 121
            +YP   P ++F       H N++   G ICL++LK  NWSP   +   + +I  LLA P
Sbjct: 60  DDYPMEAPKVRFLTKIY--HPNID-RLGRICLDVLKT-NWSPALQIRTVLLSIQALLASP 115

Query: 122 DPSSPLNIDLSRLLTLKDSKAYNSLIKYY--LYNFPKPE 158
           +P+ PL  D++    +K+ +   +  + +  LY   KPE
Sbjct: 116 NPNDPLANDVAEDW-IKNEQGAKAKAREWTKLYAKKKPE 153

>Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W
           (UBC8) - ubiquitin-conjugating enzyme; ubiquitin-protein
           ligase [contig 267] FULL
          Length = 213

 Score = 64.7 bits (156), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 71/139 (51%), Gaps = 5/139 (3%)

Query: 21  MTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPP 80
           + + H V     ++  +H    GP+++PY    + L + +P  YP   P I F       
Sbjct: 4   LMSDHDVELINDNMQEFHVKFHGPRETPYEGGVWRLHVELPDNYPYKSPSIGFVNKIF-- 61

Query: 81  HCNVNFTTGEICLNILKNENWSPVWNLLYSVQAII-QLLAYPDPSSPLNIDLSRLLTLKD 139
           H N++  +G ICL+++ N  WSP+++LL  ++ +I  LL  P+ S PLN + +  L LK 
Sbjct: 62  HPNIDAASGSICLDVI-NSAWSPLYDLLNILEWMIPGLLKEPNGSDPLNNEAA-TLQLKS 119

Query: 140 SKAYNSLIKYYLYNFPKPE 158
            + Y   I+ ++  F   E
Sbjct: 120 KELYERKIREFIDQFATEE 138

>Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 aa]
           {ON} similar to Ashbya gossypii AGR121C
          Length = 164

 Score = 63.5 bits (153), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 52/92 (56%), Gaps = 4/92 (4%)

Query: 41  ILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNEN 100
           I GP+ S Y N  F LE+ +P EYP  PP ++F      P+ +     G ICL++LK  N
Sbjct: 39  IEGPQQSAYENGVFRLELFLPDEYPMEPPKVRFLTKIYHPNID---RLGRICLDVLKT-N 94

Query: 101 WSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLS 132
           WSP   +   + +I  LLA P+P+ PL  D++
Sbjct: 95  WSPALQIRTVLLSIQALLATPNPNDPLANDVA 126

>Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 63.2 bits (152), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 58/104 (55%), Gaps = 8/104 (7%)

Query: 33  DLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPP--HCNVNFTTGE 90
           DL+ W   I GP+ +PY    F + ++ P  YP  PP IKF    + P  H NV+  +G 
Sbjct: 37  DLTYWVGYITGPQGTPYSGLKFKISLNFPENYPFHPPKIKF----VSPMWHPNVD-KSGN 91

Query: 91  ICLNILKNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRL 134
           ICL+ILK E WS V+N+   + ++  LL  P+  SPLN   + L
Sbjct: 92  ICLDILK-EKWSAVYNVETILLSLQSLLGEPNNKSPLNAVAAEL 134

>TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON}
           Anc_2.569 YMR022W
          Length = 165

 Score = 63.2 bits (152), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 67/140 (47%), Gaps = 20/140 (14%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           R++KE   + +     D    +       SDL  W  ++ GP D+PY    F  ++  PT
Sbjct: 8   RLLKELQQLTR-----DPPPGIIAAPKTESDLFTWDCLVAGPPDTPYAGGLFNCQLQFPT 62

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILK------------NENWSPVWNLLYS 110
           +YP  PP + F  + +  H NV +  GE+C++IL              E WSPV ++   
Sbjct: 63  DYPLSPPTLTFTPSIL--HPNV-YPNGEVCISILHAPGSDPNMYELPEERWSPVQSVEKI 119

Query: 111 VQAIIQLLAYPDPSSPLNID 130
           + +++ +L+ P+  S  NID
Sbjct: 120 LLSVVSMLSEPNVESGANID 139

>Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 62.4 bits (150), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 67/125 (53%), Gaps = 5/125 (4%)

Query: 32  SDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEI 91
            +L  +   I GP+ SPY +  F LE+++P +YP   P ++F       H N++   G I
Sbjct: 20  DNLRYFQVTIEGPEQSPYEDGVFELELYLPDDYPMEAPKVRFLTRIY--HPNID-RLGRI 76

Query: 92  CLNILKNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSLIKYYL 151
           CL++LK  NWSP   +   + +I  LLA P+P+ PL  D++    +K+ +   +  + + 
Sbjct: 77  CLDVLKT-NWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDW-IKNEEGAKAKAREWT 134

Query: 152 YNFPK 156
            +F K
Sbjct: 135 RSFAK 139

>TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 bp,
           157 aa] {ON} Anc_3.308 YBR082C
          Length = 157

 Score = 62.4 bits (150), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 67/131 (51%), Gaps = 10/131 (7%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           RIIKE     +L + P    T  P  +   +L  +   I GP+ SPY N  F LE+ +P 
Sbjct: 7   RIIKE---TERLVSDPVPGITAEPHED---NLRYFQVTIEGPQQSPYENGVFNLELFLPD 60

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYPD 122
           +YP   P ++F      P+ +     G ICL++LK  NWSP   +   + ++  LLA P+
Sbjct: 61  DYPMEAPKVRFLTKIYHPNID---KLGRICLDVLKT-NWSPALQIRTVLLSVQALLASPN 116

Query: 123 PSSPLNIDLSR 133
           P+ PL  D++ 
Sbjct: 117 PNDPLANDVAE 127

>CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092w UBC13 E2 ubiquitin-conjugating enzyme
          Length = 149

 Score = 62.0 bits (149), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 72/143 (50%), Gaps = 10/143 (6%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           RIIKE     +L + P    T  P  +   +L  +   I GP  SPY    F LE+++P 
Sbjct: 7   RIIKE---TERLVSDPVPGITAEPHED---NLRYFDVTIEGPSQSPYEKGIFKLELYLPE 60

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYPD 122
           +YP   P ++F       H N++   G ICL++LK  NWSP   +   + +I  LLA P+
Sbjct: 61  DYPMEAPKVRFLTKIY--HPNID-RLGRICLDVLKT-NWSPALQIRTVLLSIQALLASPN 116

Query: 123 PSSPLNIDLSRLLTLKDSKAYNS 145
           P+ PL  D++      ++KA  +
Sbjct: 117 PNDPLANDVAEDWIKDEAKAKQT 139

>KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 149
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus
          Length = 149

 Score = 62.0 bits (149), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 70/133 (52%), Gaps = 16/133 (12%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           RIIKE     +L + P    T  P  +   +L  +   I GP+ SPY +  F LE+ +P 
Sbjct: 7   RIIKE---TERLVSDPVPGITAQPHED---NLRYFQVTIEGPQQSPYESGVFQLELFLPD 60

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSP---VWNLLYSVQAIIQLLA 119
           +YP   P ++F      P+ +     G ICL++LK  NWSP   +  +L SVQA   LLA
Sbjct: 61  DYPMEAPKVRFLTKIYHPNID---RLGRICLDVLKT-NWSPALQIRTVLLSVQA---LLA 113

Query: 120 YPDPSSPLNIDLS 132
            P+P+ PL  D++
Sbjct: 114 SPNPNDPLANDVA 126

>Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {ON}
           YDR092W (UBC13) - ubiquitin-conjugating enzyme [contig
           176] FULL
          Length = 149

 Score = 62.0 bits (149), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 55/101 (54%), Gaps = 4/101 (3%)

Query: 32  SDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEI 91
            +L  +   I GP+ SPY N  F LE+ +P +YP   P ++F      P+ +     G I
Sbjct: 30  ENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRFLTKIYHPNID---RLGRI 86

Query: 92  CLNILKNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLS 132
           CL++LK  NWSP   +   + ++  LLA P+P+ PL  D++
Sbjct: 87  CLDVLKT-NWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON}
           Anc_8.230 YDR092W
          Length = 147

 Score = 61.6 bits (148), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 59/111 (53%), Gaps = 4/111 (3%)

Query: 41  ILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNEN 100
           I GP+ SPY    F LE+++P +YP   P ++F      P+ +     G ICL+ILK  N
Sbjct: 35  IEGPEQSPYEKGIFQLELYLPDDYPMEAPKVRFLTKIYHPNID---RLGRICLDILKT-N 90

Query: 101 WSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSLIKYYL 151
           WSP   +   + ++  LLA P+P+ PL  D++      +  A N+  ++ L
Sbjct: 91  WSPALQIRTVLLSVQALLASPNPNDPLANDVAEDWIKNEEGAKNTAREWTL 141

>NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 bp,
           153 aa] {ON} Anc_8.230
          Length = 153

 Score = 61.6 bits (148), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 68/130 (52%), Gaps = 10/130 (7%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           RIIKE     +L + P    T  P  +   +L  ++  + GP  SPY N  F LE+++P 
Sbjct: 7   RIIKE---TERLISDPVPGITAEPHED---NLRYFNVTVEGPAGSPYENGIFQLELYLPD 60

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYPD 122
           +YP   P ++F      P+ +     G ICL++LK  NWSP   +   + ++  LLA P+
Sbjct: 61  DYPMEAPKVRFLTKIYHPNID---RLGRICLDVLKT-NWSPALQIRTVLLSVQALLASPN 116

Query: 123 PSSPLNIDLS 132
           P+ PL  D++
Sbjct: 117 PNDPLANDVA 126

>NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465
           bp, 154 aa] {ON} Anc_8.230
          Length = 154

 Score = 61.6 bits (148), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 68/131 (51%), Gaps = 10/131 (7%)

Query: 2   SRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIP 61
            RIIKE     +L + P    T  P  +   +L  ++  + GP  SPY N  F LE+++P
Sbjct: 6   KRIIKE---TERLISDPVPGITAEPHDD---NLRYFNVTVEGPTQSPYENGIFKLELYLP 59

Query: 62  TEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYP 121
            +YP   P ++F      P+ +     G ICL++LK  NWSP   +   + +I  LLA P
Sbjct: 60  DDYPMEAPKVRFLTKIYHPNID---RLGRICLDVLKT-NWSPALQIRTVLLSIQALLASP 115

Query: 122 DPSSPLNIDLS 132
           +P+ PL  D++
Sbjct: 116 NPNDPLANDVA 126

>KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012)
           [702 bp, 233 aa] {ON} highly similar to uniprot|P28263
           Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin-conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6- bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 233

 Score = 63.2 bits (152), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 40/135 (29%), Positives = 69/135 (51%), Gaps = 5/135 (3%)

Query: 25  HPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNV 84
           H V     ++  +H    GP+ +PY    + L + +P  YP   P I F       H N+
Sbjct: 20  HDVELVDDNMQEFHIKFHGPQGTPYEAGVWRLHVELPDNYPYKSPSIGFVNKIF--HPNI 77

Query: 85  NFTTGEICLNILKNENWSPVWNLLYSVQAII-QLLAYPDPSSPLNIDLSRLLTLKDSKAY 143
           +  +G ICL+++ N  WSP+++L+  V+ +I  LL  P+ S PLN + +  L LK+ + Y
Sbjct: 78  DAASGSICLDVI-NSTWSPLYDLINIVEWMIPGLLKEPNGSDPLN-NEAATLQLKNKELY 135

Query: 144 NSLIKYYLYNFPKPE 158
              I+ ++  +   E
Sbjct: 136 EQKIREFIDKYATEE 150

>Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 61.2 bits (147), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 42/128 (32%), Positives = 65/128 (50%), Gaps = 5/128 (3%)

Query: 32  SDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEI 91
            +L  +   I GP+ SPY +  F LE+ +P +YP   P ++F       H N++   G I
Sbjct: 20  DNLRYFQVTIEGPEQSPYEDGVFKLELFLPDDYPMEAPKVRFLTKIY--HPNID-RLGRI 76

Query: 92  CLNILKNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSLIKY-Y 150
           CL++LK  NWSP   +   + +I  LLA P+P+ PL  D++      +  A     ++  
Sbjct: 77  CLDVLKT-NWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDWIKNEEGAKAKAREWTK 135

Query: 151 LYNFPKPE 158
           LY   KPE
Sbjct: 136 LYAKKKPE 143

>Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 60.8 bits (146), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 57/102 (55%), Gaps = 4/102 (3%)

Query: 32  SDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEI 91
            +L  +   I GP+ SPY +  F LE+++P +YP   P ++F       H N++   G I
Sbjct: 20  DNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFLTKIY--HPNID-RLGRI 76

Query: 92  CLNILKNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSR 133
           CL++LK  NWSP   +   + +I  LLA P+P+ PL  D++ 
Sbjct: 77  CLDVLKT-NWSPALQIRTVLLSIQALLASPNPNDPLANDVAE 117

>ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR022W (QRI8)
          Length = 165

 Score = 61.2 bits (147), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 69/140 (49%), Gaps = 20/140 (14%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           R++KE   +  L   PD +    PVS    +L  W  +I GP DSPY    F   +  P 
Sbjct: 8   RLMKELQQL--LRDSPDGIVA-GPVSE--DNLFLWDCLIEGPADSPYEGGVFNARLQFPR 62

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNIL------------KNENWSPVWNLLYS 110
           +YP  PP + F  + +  H NV +  GE+C++IL             +E WSPV ++   
Sbjct: 63  DYPLSPPKLTFTPSIL--HPNV-YPNGEVCISILHAPGEDPNMYEEASERWSPVQSVEKI 119

Query: 111 VQAIIQLLAYPDPSSPLNID 130
           + +++ +L+ P+  S  NID
Sbjct: 120 LLSVMSMLSEPNVESGANID 139

>ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 61.2 bits (147), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 68/140 (48%), Gaps = 20/140 (14%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           R++KE   + K     D+ T +     + +DL  W  +I GP D+PY    F  ++  P 
Sbjct: 8   RLLKELQQLMK-----DSSTGIVAGPRSENDLFVWDCLIQGPPDTPYEGGIFNAKLEFPK 62

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNI------------LKNENWSPVWNLLYS 110
           +YP  PP + F  + + P+    +  GE+C++I            L  E WSPV ++   
Sbjct: 63  DYPLSPPKLTFTPSILHPNI---YHNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKI 119

Query: 111 VQAIIQLLAYPDPSSPLNID 130
           + +++ +L+ P+  S  N+D
Sbjct: 120 LLSVMSMLSEPNVESGANVD 139

>KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.569
           YMR022W
          Length = 170

 Score = 60.1 bits (144), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 57/111 (51%), Gaps = 15/111 (13%)

Query: 32  SDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEI 91
           SDL  W  ++ GP DSPY    F  ++  P +YP  PP + F  + +  H NV +  GE+
Sbjct: 32  SDLFLWDCLVQGPPDSPYEGGVFEAQLRFPRDYPLSPPKLTFVPSVL--HPNV-YPNGEV 88

Query: 92  CLNI------------LKNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNID 130
           C++I            L  E WSPV ++   + +++ +L+ P+  S  NID
Sbjct: 89  CISILHAPGEDPNQYELAEERWSPVQSVEKILLSVVSMLSEPNVESGANID 139

>SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 161

 Score = 60.1 bits (144), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/123 (34%), Positives = 63/123 (51%), Gaps = 18/123 (14%)

Query: 14  LNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKF 73
           L+A P+N            DL+ W  II GP  +PY    F + +  P  YP   P + F
Sbjct: 34  LSAFPEN----------EDDLTKWSGIITGPDGTPYEGLRFKISLQFPQSYPYTAPRVTF 83

Query: 74  NKNSIPP--HCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDL 131
               + P  H NV+  +G ICL+ILK++ WS V+N+   + ++  LL  P+ SSPLN   
Sbjct: 84  ----VSPMWHPNVDM-SGNICLDILKDQ-WSAVYNVQTILLSLQSLLEEPNNSSPLNAVA 137

Query: 132 SRL 134
           + L
Sbjct: 138 AEL 140

>Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON}
           similar to Ashbya gossypii ABR059W
          Length = 165

 Score = 60.1 bits (144), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 69/140 (49%), Gaps = 20/140 (14%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           R++KE   +  L   P+ +    PV+     L  W  +I GP DSPY    F   +  PT
Sbjct: 8   RLMKEMQQL--LKDCPEGIVA-GPVNEENMFL--WDCLIAGPPDSPYEGGIFNARLQFPT 62

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNIL------------KNENWSPVWNLLYS 110
           +YP  PP + F  + +  H NV +  GE+C++IL             +E WSPV ++   
Sbjct: 63  DYPLSPPKLTFTPSIL--HPNV-YPNGEVCISILHAPGEDPNMYEEASERWSPVQSVEKI 119

Query: 111 VQAIIQLLAYPDPSSPLNID 130
           + +++ +L+ P+  S  NID
Sbjct: 120 LLSVMSMLSEPNVESGANID 139

>TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON}
           Anc_8.230 YDR092W
          Length = 152

 Score = 59.3 bits (142), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 67/131 (51%), Gaps = 10/131 (7%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           RIIKE     +L + P    T  P  +   +L  +   I GP+ SPY +  F LE+ +P 
Sbjct: 7   RIIKE---TERLVSDPVPGITAEPHDD---NLRYFSVTIEGPEGSPYEHGIFDLELFLPD 60

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYPD 122
           +YP   P ++F      P+ +     G ICL++LK  NWSP   +   + +I  LLA P+
Sbjct: 61  DYPMESPKVRFLTKIYHPNID---RLGRICLDVLKT-NWSPALQIRTVLLSIQALLASPN 116

Query: 123 PSSPLNIDLSR 133
           P+ PL  D++ 
Sbjct: 117 PNDPLANDVAE 127

>KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly
           similar to uniprot|P52492 Saccharomyces cerevisiae
           YOR339C
          Length = 161

 Score = 58.9 bits (141), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 64/121 (52%), Gaps = 10/121 (8%)

Query: 33  DLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPP--HCNVNFTTGE 90
           DL+ W  II GP  +PY    F + +     YP   P ++F    + P  H NV+  +G 
Sbjct: 43  DLTKWCGIITGPDGTPYEGMRFKIALEFAQTYPYTAPKVRF----VSPMWHPNVDM-SGN 97

Query: 91  ICLNILKNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKAY-NSLIKY 149
           ICL+ILK++ WS V+N+   + ++  LL  P+ SSPLN   + L   KD + Y   LI  
Sbjct: 98  ICLDILKDQ-WSAVYNVQTILLSLQSLLEEPNNSSPLNAVAAELWD-KDMREYKKKLIAR 155

Query: 150 Y 150
           Y
Sbjct: 156 Y 156

>Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON}
           complement(8947..9444) [498 nt, 166 aa]
          Length = 165

 Score = 57.8 bits (138), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 67/140 (47%), Gaps = 20/140 (14%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           R+ KEY  + +     D+   +       +DL  W  +I GP D+PY +  F  ++  P 
Sbjct: 8   RLFKEYQQLIR-----DSPPGIVAGPANENDLFLWDCLIQGPPDTPYEHGVFNAQLRFPR 62

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNI------------LKNENWSPVWNLLYS 110
           +YP  PP + F    +  H N+ +  GE+C++I            L  E WSPV ++   
Sbjct: 63  DYPLSPPTLTFTPAIL--HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKI 119

Query: 111 VQAIIQLLAYPDPSSPLNID 130
           + +++ +L+ P+  S  NID
Sbjct: 120 LLSVMSMLSEPNVESGANID 139

>Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 57.8 bits (138), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 54/102 (52%), Gaps = 4/102 (3%)

Query: 28  SNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFT 87
           S+ + DL  W + I G + + +    + + +  P EYPS PP +KF       H NV + 
Sbjct: 32  SDGSMDLQKWEAGIPGKEGTNWAGGVYPISVEYPNEYPSKPPKVKFPAGFY--HPNV-YP 88

Query: 88  TGEICLNIL-KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLN 128
           +G ICL+IL ++++W P   L   V  +  LL  P+P+SP  
Sbjct: 89  SGTICLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSPAQ 130

>TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 bp,
           194 aa] {ON} 
          Length = 194

 Score = 58.2 bits (139), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 52/96 (54%), Gaps = 4/96 (4%)

Query: 40  IILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNE 99
           I + P +  Y +  F   +     YP  PPV+KF K    P+ ++N   G+ICLNIL+ E
Sbjct: 71  ITIHPDEGIYKDGYFPFSMVFKDSYPIEPPVVKFLKKIYHPNIDLN---GKICLNILR-E 126

Query: 100 NWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLL 135
           +WSPV +L   +  ++ L   P+P  PLN+    LL
Sbjct: 127 DWSPVLDLQSIIIGLMFLFLEPNPRDPLNLKAGELL 162

>TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 57.4 bits (137), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/121 (29%), Positives = 62/121 (51%), Gaps = 5/121 (4%)

Query: 28  SNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFT 87
           ++ T DL +W + I G   + + +  + + I  P EYPS PP +KF       H N+ + 
Sbjct: 32  ADGTMDLQHWEAGIPGKAGTLWADAVYPISIEYPDEYPSKPPKVKFPAGFY--HPNI-YP 88

Query: 88  TGEICLNIL-KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSL 146
           +G +CL+IL ++++W P   L   V  +  LL  P+P+SP      R  + K+ + Y   
Sbjct: 89  SGTVCLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSPAQEPAWRAFS-KNKEEYQKK 147

Query: 147 I 147
           +
Sbjct: 148 V 148

>KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 57.0 bits (136), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 73/158 (46%), Gaps = 21/158 (13%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           R++KE   + K     D+   +        ++  W  ++ GP DSPY    F  ++  P 
Sbjct: 8   RLLKELQQLMK-----DSPPGIVAGPKTEDNIFQWDCLVQGPPDSPYEGGVFNAQLDFPK 62

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNI------------LKNENWSPVWNLLYS 110
           +YP  PP + F  + +  H N+ +  GE+C++I            L  E WSPV ++   
Sbjct: 63  DYPLSPPKLTFTPSIL--HPNI-YPNGEVCISILHSPGEDPNMYELAEERWSPVQSVEKI 119

Query: 111 VQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSLIK 148
           + +++ +L+ P+  S  NID   +L   + K +   +K
Sbjct: 120 LLSVMSMLSEPNIESGANIDAC-ILWRDNRKEFERQVK 156

>KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 56.6 bits (135), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 55/109 (50%), Gaps = 4/109 (3%)

Query: 29  NATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTT 88
           + T DL  W + I G + + + +  + L I  P EYPS PP +K   N    H NV + +
Sbjct: 33  DGTMDLQRWEAGIPGKQGTLWADGLYPLTIEYPDEYPSKPPKVKLPANFY--HPNV-YPS 89

Query: 89  GEICLNIL-KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLT 136
           G ICL+IL ++++W P   L      I  LL  P+P+SP      R  +
Sbjct: 90  GTICLSILNEDQDWRPAITLKQICLGIQDLLDSPNPNSPAQEPAWRAFS 138

>Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C
           (UBC11) - homolog of ubiquitin carrier protein E2-C
           [contig 46] FULL
          Length = 161

 Score = 57.0 bits (136), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 39/113 (34%), Positives = 59/113 (52%), Gaps = 8/113 (7%)

Query: 24  LHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPP--H 81
           L     +  DL+ W  II GP  +PY    F + +     YP   P ++F    + P  H
Sbjct: 34  LSAFPESEDDLTKWCGIITGPDGTPYEGLRFKIALEFAQTYPYTAPKVRF----VSPMWH 89

Query: 82  CNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRL 134
            NV+  +G ICL+ILK++ WS V+N+   + ++  LL  P+ SSPLN   + L
Sbjct: 90  PNVDM-SGNICLDILKDQ-WSAVYNVQTILLSLQSLLEEPNNSSPLNAVAAEL 140

>TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 57.0 bits (136), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 67/140 (47%), Gaps = 20/140 (14%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           R++KEY  + +     D    +     + S+L  W  +I GP D+PY    F   +  P 
Sbjct: 8   RLLKEYQQLIR-----DPPPGILAAPKSESNLFLWDCLIQGPPDTPYEGGIFNARLDFPK 62

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNI------------LKNENWSPVWNLLYS 110
           +YP  PP + F  + +  H N+ +  GE+C++I            L  E WSPV ++   
Sbjct: 63  DYPLSPPKLTFTPSIL--HPNI-YHNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKI 119

Query: 111 VQAIIQLLAYPDPSSPLNID 130
           + +++ +L+ P+  S  N+D
Sbjct: 120 LLSVMSMLSEPNIESGANVD 139

>YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {ON} 
           UBC9SUMO-conjugating enzyme involved in the Smt3p
           conjugation pathway; nuclear protein required for S- and
           M-phase cyclin degradation and mitotic control; involved
           in proteolysis mediated by the anaphase-promoting
           complex cyclosome (APCC)
          Length = 157

 Score = 56.6 bits (135), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 54/102 (52%), Gaps = 4/102 (3%)

Query: 28  SNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFT 87
           ++ + DL  W + I G + + +    + + +  P EYPS PP +KF       H NV + 
Sbjct: 32  ADGSMDLQKWEAGIPGKEGTNWAGGVYPITVEYPNEYPSKPPKVKFPAGFY--HPNV-YP 88

Query: 88  TGEICLNIL-KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLN 128
           +G ICL+IL ++++W P   L   V  +  LL  P+P+SP  
Sbjct: 89  SGTICLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSPAQ 130

>Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 56.2 bits (134), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 54/102 (52%), Gaps = 4/102 (3%)

Query: 28  SNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFT 87
           ++ + DL  W + I G + + +    + + +  P EYPS PP +KF       H NV + 
Sbjct: 32  ADGSMDLQKWEAGIPGREGTNWAGGVYPITVEYPNEYPSKPPKVKFPAGFY--HPNV-YP 88

Query: 88  TGEICLNIL-KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLN 128
           +G ICL+IL ++++W P   L   V  +  LL  P+P+SP  
Sbjct: 89  SGTICLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSPAQ 130

>NCAS0I01430 Chr9 (264456..265232) [777 bp, 258 aa] {ON} 
          Length = 258

 Score = 57.8 bits (138), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 39/115 (33%), Positives = 62/115 (53%), Gaps = 19/115 (16%)

Query: 32  SDLSNWH-SIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPP--HCNVNFTT 88
           S++  W+  +++  KDS YH   F  ++  P ++P  PP  KF    IPP  H NV +  
Sbjct: 44  SNIFTWNIGVMVLNKDSIYHGGYFQSQMKFPKDFPFSPPQFKF----IPPIYHPNV-YRD 98

Query: 89  GEICLNIL-----------KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLS 132
           G++C++IL            NE WSPV ++   + +I+ LL  P+ SSP N+D +
Sbjct: 99  GKLCISILHQSGDAMTSEPDNETWSPVQSVESVLISIVSLLEDPNVSSPANVDAA 153

>CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064w UBC9 E2 ubiquitin-conjugating enzyme
          Length = 157

 Score = 56.2 bits (134), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 56/109 (51%), Gaps = 4/109 (3%)

Query: 29  NATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTT 88
           + T +L  W + I G + + + +  F + +  P EYPS PP +KF       H N+ + +
Sbjct: 33  DGTLNLQKWEAGIPGKEGTIWQDGVFPITVEYPDEYPSKPPKVKFPAGFY--HPNI-YPS 89

Query: 89  GEICLNIL-KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLT 136
           G +CL+IL ++++W P   L   V  +  LL  P+P+SP      R  +
Sbjct: 90  GTVCLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSPAQEPAWRAFS 138

>Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W
           (QRI8) - ubiquitin conjugating enzyme [contig 58] FULL
          Length = 165

 Score = 55.8 bits (133), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 65/140 (46%), Gaps = 20/140 (14%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           R+ KE   + K     D+   +     +  +L  W  +I GP DSPY    F   +  P 
Sbjct: 8   RLFKELQQLLK-----DSPEGIVAGPKSEDNLFVWDCLISGPPDSPYQGGVFNATLEFPK 62

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNI------------LKNENWSPVWNLLYS 110
           +YP  PP + F  + +  H N+ +  GE+C++I            L  E WSPV ++   
Sbjct: 63  DYPLSPPKLLFTPSIL--HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKI 119

Query: 111 VQAIIQLLAYPDPSSPLNID 130
           + +++ +L+ P+  S  NID
Sbjct: 120 LLSVMSMLSEPNVESGANID 139

>SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 55.8 bits (133), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 65/140 (46%), Gaps = 20/140 (14%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           R++KE   + +     D+   +     +  +L  W  +I GP DSPY    F   +  P 
Sbjct: 8   RLLKELQQLAR-----DSPEGIVAGPKSEDNLFLWDCLITGPPDSPYEGGVFNAMLEFPK 62

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNI------------LKNENWSPVWNLLYS 110
           +YP  PP + F  + +  H N+ +  GE+C++I            L  E WSPV ++   
Sbjct: 63  DYPLSPPRLTFTPSIL--HPNI-YPNGEVCISILHSPGEDPNMYELAEERWSPVQSVEKI 119

Query: 111 VQAIIQLLAYPDPSSPLNID 130
           + ++  +L+ P+  S  NID
Sbjct: 120 LLSVTSMLSEPNVESGANID 139

>NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49
          Length = 193

 Score = 56.2 bits (134), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 56/115 (48%), Gaps = 5/115 (4%)

Query: 40  IILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNE 99
           +I+ P +  Y N  F   +     YP  PP +        P+ +V    G++CLNIL+ E
Sbjct: 73  VIISPDEGYYKNGHFRFSLEFNDNYPMEPPKVVCRNRIYHPNIDVQ---GKVCLNILR-E 128

Query: 100 NWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSLIKYYLYNF 154
           +WSP  +L   +  ++ L   P+   PLN D + + + KDS A+   ++  +  +
Sbjct: 129 DWSPALDLQSIIVGLLFLFLEPNAKDPLNTDAAAVFS-KDSNAFAKFVRKTMEGY 182

>Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 55.5 bits (132), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 53/102 (51%), Gaps = 4/102 (3%)

Query: 28  SNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFT 87
           ++ + DL  W + I G   + +    + + +  P EYPS PP +KF       H NV + 
Sbjct: 32  ADGSMDLQKWEAGIPGKDATNWAGGVYPITVEYPNEYPSKPPKVKFPAGFY--HPNV-YP 88

Query: 88  TGEICLNIL-KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLN 128
           +G ICL+IL ++++W P   L   V  +  LL  P+P+SP  
Sbjct: 89  SGTICLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSPAQ 130

>KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 55.5 bits (132), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 65/140 (46%), Gaps = 20/140 (14%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           R+ KE   + K     D+   +     +  +L  W  +I GP DSPY    F   +  P 
Sbjct: 8   RLFKELQQLLK-----DSPEGIVAGPRSEDNLFLWDCLISGPPDSPYQGGVFNATLEFPK 62

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNI------------LKNENWSPVWNLLYS 110
           +YP  PP + F  + +  H N+ +  GE+C++I            L  E WSPV ++   
Sbjct: 63  DYPLSPPKLLFTPSIL--HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKI 119

Query: 111 VQAIIQLLAYPDPSSPLNID 130
           + +++ +L+ P+  S  NID
Sbjct: 120 LLSVMSMLSEPNVESGANID 139

>Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON}
           complement(45694..46062) [369 nt, 123 aa]
          Length = 122

 Score = 54.3 bits (129), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 56/122 (45%), Gaps = 7/122 (5%)

Query: 33  DLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEIC 92
           DL  W + I G   + +    + + I  P EYPS PP + F K     H NV + +G IC
Sbjct: 2   DLQRWEAGIPGRTGTLWAEGVYPITIEYPDEYPSKPPKVMFPKGFY--HPNV-YPSGTIC 58

Query: 93  LNILKNE-NWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDS---KAYNSLIK 148
           L+IL  E +W P   L   V  +  LL  P+P+SP      R  +   S   K  +S  K
Sbjct: 59  LSILNEEQDWRPAITLKQIVLGVQDLLDSPNPNSPAQEPAWRAFSRNKSEYEKKVSSQAK 118

Query: 149 YY 150
            Y
Sbjct: 119 QY 120

>TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.569
           YMR022W
          Length = 167

 Score = 55.1 bits (131), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 69/144 (47%), Gaps = 20/144 (13%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           R++KEY  +  +   P  +       N   ++  W  +I GP ++PY N  F   +  P 
Sbjct: 10  RLLKEYQQL--IRESPPGIVAGPSDEN---NMFEWDCLISGPPETPYENGVFNATLLFPK 64

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNI------------LKNENWSPVWNLLYS 110
           +YP  PP + F  + +  H N+ +  GE+C++I            L  E WSPV ++   
Sbjct: 65  DYPLSPPKLTFTPSLL--HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKI 121

Query: 111 VQAIIQLLAYPDPSSPLNIDLSRL 134
           + +++ +L+ P+  S  NID S L
Sbjct: 122 LLSVMSMLSEPNIESGANIDASIL 145

>KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022W QRI8 Ubiquitin conjugating enzyme
           involved in the ER-associated protein degradation
           pathway requires Cue1p for recruitment to the ER
           membrane proposed to be involved in chromatin assembly
          Length = 165

 Score = 54.7 bits (130), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 70/140 (50%), Gaps = 20/140 (14%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           R++KE   + K +  P+ +    P+ +  S+L  W  +I+GP DS Y    F   +  P 
Sbjct: 8   RLLKELEKLTKDS--PEGILA-SPIDD--SNLFQWDCLIMGPPDSCYEGGVFNARLDFPK 62

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKN------------ENWSPVWNLLYS 110
           +YP  PP + F  + + P+    +  GE+C++IL +            E WSPV ++   
Sbjct: 63  DYPLNPPKLTFQPSILHPNI---YPNGEVCISILHSPGSDPNMYEHECERWSPVQSVEMI 119

Query: 111 VQAIIQLLAYPDPSSPLNID 130
           + +++ +L+ P+  S  NID
Sbjct: 120 LLSVMSILSEPNIESGANID 139

>NDAI0A07570 Chr1 complement(1734788..1735507) [720 bp, 239 aa] {ON}
          Length = 239

 Score = 55.5 bits (132), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 58/110 (52%), Gaps = 19/110 (17%)

Query: 37  WH-SIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPP--HCNVNFTTGEICL 93
           WH   I+  +DS Y+   F  E+  P+ +P  PP  KF    +PP  H NV +  G++C+
Sbjct: 43  WHIGFIILNEDSIYNGGYFKSEMKFPSNFPYSPPHFKF----VPPIYHPNV-YKDGKLCI 97

Query: 94  NIL-----------KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLS 132
           +IL            NE WSPV ++   + +II LL  P+ SSP N+D S
Sbjct: 98  SILHQSGDSMTSEPDNETWSPVQSVESVLISIISLLEDPNISSPANVDAS 147

>TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 54.3 bits (129), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 58/114 (50%), Gaps = 4/114 (3%)

Query: 29  NATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTT 88
           + + +L  W + I G + + +H   + + I  P EYPS PP +KF       H N+ + +
Sbjct: 33  DGSMNLQLWEAGIPGKESTIWHGALYPITIEYPDEYPSKPPKVKFPAGFY--HPNI-YPS 89

Query: 89  GEICLNIL-KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSK 141
           G +CL+IL ++++W P   L   V  +  LL  P+P+SP      R  +   S+
Sbjct: 90  GTVCLSILNEDQDWRPAITLKQIVLGVQDLLDTPNPNSPAQEPAWRAFSKNKSE 143

>Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 54.3 bits (129), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 69/140 (49%), Gaps = 20/140 (14%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           R++KE   + K     D+   +     + +++  W  +I GP D+PY +  F  ++  P 
Sbjct: 8   RLLKELQQLIK-----DSPPGIVAGPKSENNIFVWDCLIQGPPDTPYADGVFNAKLEFPK 62

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNI------------LKNENWSPVWNLLYS 110
           +YP  PP + F  + +  H N+ +  GE+C++I            L  E WSPV ++   
Sbjct: 63  DYPLSPPKLTFTPSIL--HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKI 119

Query: 111 VQAIIQLLAYPDPSSPLNID 130
           + +++ +L+ P+  S  NID
Sbjct: 120 LLSVMSMLSEPNIESGANID 139

>CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022w E2 ubiquitin-conjugation enzyme
          Length = 165

 Score = 54.3 bits (129), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 59/118 (50%), Gaps = 17/118 (14%)

Query: 27  VSNATSD--LSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNV 84
           V+   SD  L  W  +I GP D+PY    F  ++  P +YP  PP + F  + +  H N+
Sbjct: 25  VAGPKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEFPKDYPLSPPKLTFTPSIL--HPNI 82

Query: 85  NFTTGEICLNIL------------KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNID 130
            +  GE+C++IL              E WSPV ++   + +++ +L+ P+  S  NID
Sbjct: 83  -YPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEKILLSVMSMLSEPNIESGANID 139

>Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 54.3 bits (129), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 69/140 (49%), Gaps = 20/140 (14%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           R++KE   + K     D+   +     + +++  W  +I GP D+PY +  F  ++  P 
Sbjct: 8   RLLKELQQLIK-----DSPPGIVAGPKSENNIFVWDCLIQGPPDTPYADGVFNTKLEFPK 62

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNI------------LKNENWSPVWNLLYS 110
           +YP  PP + F  + +  H N+ +  GE+C++I            L  E WSPV ++   
Sbjct: 63  DYPLSPPKLTFTPSIL--HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKI 119

Query: 111 VQAIIQLLAYPDPSSPLNID 130
           + +++ +L+ P+  S  NID
Sbjct: 120 LLSVMSMLSEPNIESGANID 139

>KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064W UBC9 SUMO-conjugating enzyme involved in the
           Smt3p conjugation pathway nuclear protein required for
           S- and M-phase cyclin degradation and mitotic control
           involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 53.9 bits (128), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 61/121 (50%), Gaps = 5/121 (4%)

Query: 28  SNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFT 87
           ++ + +L  W + I G   + + N  + L I  P +YPS PP +KF       H NV + 
Sbjct: 32  TDGSMNLQKWEAGIPGRDGTLWKNGLYPLTIEYPDDYPSKPPKVKFPAGFY--HPNV-YP 88

Query: 88  TGEICLNIL-KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSL 146
           +G ICL+IL ++++W P   L   +  +  LL  P+P+SP      R  + K+ K Y   
Sbjct: 89  SGTICLSILNEDQDWRPAITLKQLLLGVQDLLDSPNPNSPAQEPAWRAFS-KNIKEYERK 147

Query: 147 I 147
           +
Sbjct: 148 V 148

>KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 53.9 bits (128), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 60/130 (46%), Gaps = 5/130 (3%)

Query: 28  SNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFT 87
            + + +L  W + I G + + +H   + L I  P EYPS PP +K        H NV + 
Sbjct: 32  QDGSLNLQRWEAGIPGKEGTLWHEGVYPLTIEYPDEYPSKPPKVKLPAGFY--HPNV-YP 88

Query: 88  TGEICLNIL-KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSL 146
           +G ICL+IL ++++W P   L      I  LL  P+P+SP      R  + K+   Y   
Sbjct: 89  SGTICLSILNEDQDWRPAITLKQICLGIQDLLDSPNPNSPAQEPAWRAFS-KNKAEYEKK 147

Query: 147 IKYYLYNFPK 156
           I      + K
Sbjct: 148 IALQAKQYSK 157

>YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiquitin
           conjugating enzyme, involved in the ER-associated
           protein degradation pathway; requires Cue1p for
           recruitment to the ER membrane; proposed to be involved
           in chromatin assembly
          Length = 165

 Score = 53.9 bits (128), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 69/140 (49%), Gaps = 20/140 (14%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           R++KE   + K     D+   +     + +++  W  +I GP D+PY +  F  ++  P 
Sbjct: 8   RLLKELQQLIK-----DSPPGIVAGPKSENNIFIWDCLIQGPPDTPYADGVFNAKLEFPK 62

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNI------------LKNENWSPVWNLLYS 110
           +YP  PP + F  + +  H N+ +  GE+C++I            L  E WSPV ++   
Sbjct: 63  DYPLSPPKLTFTPSIL--HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKI 119

Query: 111 VQAIIQLLAYPDPSSPLNID 130
           + +++ +L+ P+  S  NID
Sbjct: 120 LLSVMSMLSEPNIESGANID 139

>TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 53.9 bits (128), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 55/102 (53%), Gaps = 4/102 (3%)

Query: 28  SNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFT 87
           ++ T +L  W + I G + + + +  + + I  P EYPS PP ++F       H N+ + 
Sbjct: 32  ADGTMNLQKWEAGIPGREGTLWDHGVYPISIEYPDEYPSKPPKVRFPAGFY--HPNI-YP 88

Query: 88  TGEICLNIL-KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLN 128
           +G +CL+IL ++++W P   L   V  +  LL  P+P+SP  
Sbjct: 89  SGTVCLSILNEDQDWRPAITLKQIVIGVQDLLDTPNPNSPAQ 130

>ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 53.9 bits (128), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 61/121 (50%), Gaps = 5/121 (4%)

Query: 28  SNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFT 87
           ++ + +L  W + I G + + + +  + + I  P EYPS PP +KF       H N+ + 
Sbjct: 32  ADGSMNLQKWEAGIPGKEGTIWQDGVYPITIEYPDEYPSKPPKVKFPAGFY--HPNI-YP 88

Query: 88  TGEICLNIL-KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSL 146
           +G +CL+IL ++++W P   L      +  LL  P+P+SP      R   L++   Y+  
Sbjct: 89  SGTVCLSILNEDQDWRPAITLKQIALGVQDLLDSPNPNSPAQEPAWRAF-LRNRADYDKK 147

Query: 147 I 147
           +
Sbjct: 148 V 148

>Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 53.9 bits (128), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 69/140 (49%), Gaps = 20/140 (14%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           R++KE   + K     D+   +     + +++  W  +I GP D+PY +  F  ++  P 
Sbjct: 8   RLLKELQQLIK-----DSPPGIVAGPKSENNIFVWDCLIQGPPDTPYADGIFNAKLEFPK 62

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNI------------LKNENWSPVWNLLYS 110
           +YP  PP + F  + +  H N+ +  GE+C++I            L  E WSPV ++   
Sbjct: 63  DYPLSPPKLTFTPSIL--HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKI 119

Query: 111 VQAIIQLLAYPDPSSPLNID 130
           + +++ +L+ P+  S  NID
Sbjct: 120 LLSVMSMLSEPNIESGANID 139

>KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413)
           [474 bp, 157 aa] {ON} highly similar to uniprot|P50623
           Saccharomyces cerevisiae YDL064W UBC9 SUMO-conjugating
           enzyme involved in the Smt3p conjugation pathway nuclear
           protein required for S- and M-phase cyclin degradation
           and mitotic control involved in proteolysis mediated by
           the anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 53.5 bits (127), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 60/120 (50%), Gaps = 5/120 (4%)

Query: 29  NATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTT 88
           + + +L  W + I G + + + +  F + I  P +YPS PP +KF       H N+ + +
Sbjct: 33  DGSMNLQKWEAGIPGKEGTIWKDGVFPITIEYPDDYPSKPPKVKFPAGFY--HPNI-YPS 89

Query: 89  GEICLNIL-KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSLI 147
           G +CL+IL ++++W P   L      +  LL  P+P+SP      R  + K+ K Y   +
Sbjct: 90  GTVCLSILNEDQDWRPAITLKQIALGVQDLLDSPNPNSPAQEPAWRAFS-KNVKEYERKV 148

>NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 53.1 bits (126), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 62/126 (49%), Gaps = 7/126 (5%)

Query: 23  TLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHC 82
           T HP  + + +L  W + I G + + +    + + I  P EYPS PP +K   N    H 
Sbjct: 29  TRHP--DGSMNLQKWEAGIPGKEGTIWAEGVYPITIEYPNEYPSKPPKVKLPANFY--HP 84

Query: 83  NVNFTTGEICLNIL-KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSK 141
           NV + +G ICL+IL ++++W P   L      I  LL  P+P+SP      R  + K+ +
Sbjct: 85  NV-YPSGTICLSILNEDQDWRPAITLKQICLGIQDLLDSPNPNSPAQEPAWRSFS-KNKE 142

Query: 142 AYNSLI 147
            Y   +
Sbjct: 143 EYEKKV 148

>SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 52.8 bits (125), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 60/121 (49%), Gaps = 5/121 (4%)

Query: 28  SNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFT 87
           ++ + +L  W + I G + + +    + + I  P +YPS PP +KF       H N+ + 
Sbjct: 32  ADGSMNLQKWEAGIPGKEGTIWKEGVYPITIEYPDDYPSKPPKVKFPAGFY--HPNI-YP 88

Query: 88  TGEICLNIL-KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSL 146
           +G +CL+IL ++++W P   L   V  +  LL  P+P SP      R  + K+ K Y   
Sbjct: 89  SGTVCLSILNEDQDWRPAITLKQIVLGVQDLLNSPNPDSPAQEPAWRAFS-KNIKEYEKK 147

Query: 147 I 147
           +
Sbjct: 148 V 148

>Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W
           (UBC9) - ubiquitin-conjugating enzyme [contig 1] FULL
          Length = 122

 Score = 52.0 bits (123), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 57/116 (49%), Gaps = 5/116 (4%)

Query: 33  DLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEIC 92
           +L  W + I G + + +    F + I  P +YPS PP +KF       H N+ + +G +C
Sbjct: 2   NLQKWEAGIPGKEGTIWKEGVFPITIEYPDDYPSKPPKVKFPAGFY--HPNI-YPSGTVC 58

Query: 93  LNIL-KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSLI 147
           L+IL ++++W P   L      +  LL  P+P+SP      R  + K+ K Y   +
Sbjct: 59  LSILNEDQDWRPAITLKQIALGVQDLLDSPNPNSPAQEPAWRAFS-KNVKEYERKV 113

>Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 52.8 bits (125), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 56/110 (50%), Gaps = 5/110 (4%)

Query: 39  SIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKN 98
            I + P +  Y + S    +     YP  PP +   K     H N++F  G +CLNIL+ 
Sbjct: 64  EITVNPDEGYYTHGSINFSLDFNEVYPIEPPKVACLKRIF--HPNIDFK-GNVCLNILR- 119

Query: 99  ENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSLIK 148
           E+WSP  +L   V  ++ L   P+P+ PLN D ++LL  +D K +   ++
Sbjct: 120 EDWSPALDLQSIVTGLLFLFLEPNPNDPLNKDAAKLLC-QDEKEFAEAVR 168

>NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2.569
          Length = 165

 Score = 51.6 bits (122), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 64/140 (45%), Gaps = 20/140 (14%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           R++KE   + K     D+   +       ++L  W  ++ GP D+ Y    F   +  P 
Sbjct: 8   RLLKELQQLTK-----DSPPGIVACPKNENNLFIWDCLVQGPPDTAYEGGIFNARLEFPK 62

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNI------------LKNENWSPVWNLLYS 110
           +YP  PP + F  + + P+    +  GE+C++I            L  E WSPV ++   
Sbjct: 63  DYPLSPPKLTFTPSILHPNI---YPNGEVCISILHSPGDDPNMYELAEERWSPVQSIEKI 119

Query: 111 VQAIIQLLAYPDPSSPLNID 130
           + +++ +L+ P+  S  NID
Sbjct: 120 LLSVMSMLSEPNIESGANID 139

>NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 157
           aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 51.2 bits (121), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 50/102 (49%), Gaps = 4/102 (3%)

Query: 28  SNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFT 87
           ++ T +L  W + I G + + +    + + I  P EYPS PP +K        H NV + 
Sbjct: 32  TDGTMNLQKWEAGIPGKEGTLWAEGVYPITIEYPNEYPSKPPKVKLPAGFY--HPNV-YP 88

Query: 88  TGEICLNILKNE-NWSPVWNLLYSVQAIIQLLAYPDPSSPLN 128
           +G ICL+IL  E +W P   L      I  LL  P+P+SP  
Sbjct: 89  SGTICLSILNEEQDWRPAITLKQICLGIQDLLDSPNPNSPAQ 130

>Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 51.6 bits (122), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 55/109 (50%), Gaps = 4/109 (3%)

Query: 39  SIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKN 98
            +++ P +  Y++ S    +     YP  PP +   K    P+ ++N   G +CLNIL+ 
Sbjct: 64  EVVVSPDEGYYNHGSISFSLDFNEVYPIEPPKVTCLKKIFHPNIDLN---GNVCLNILR- 119

Query: 99  ENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSLI 147
           E+WSP  +L   +  ++ L   P+P+ PLN D ++L      K   ++I
Sbjct: 120 EDWSPALDLQSIIIGLLFLFLEPNPNDPLNKDAAKLFCQDQKKFAETVI 168

>AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, 157
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDL064W (UBC9); 1-intron
          Length = 157

 Score = 50.8 bits (120), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 54/102 (52%), Gaps = 4/102 (3%)

Query: 28  SNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFT 87
            + + +L  W + I G + + + +  + + I  P +YPS PP +KF       H N+ + 
Sbjct: 32  EDGSMNLQKWEAGIPGREGTIWKDGVYPITIEYPDDYPSKPPRVKFPAGFY--HPNI-YP 88

Query: 88  TGEICLNIL-KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLN 128
           +G +CL+IL ++++W P   +   +  +  LL  P+P+SP  
Sbjct: 89  SGTVCLSILNEDQDWKPAITMKQILLGVQDLLTSPNPNSPAQ 130

>Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa]
           {ON} similar to Ashbya gossypii AER056C
          Length = 157

 Score = 50.8 bits (120), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 53/102 (51%), Gaps = 4/102 (3%)

Query: 28  SNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFT 87
            + + +L  W + I G + + + +  + + I  P +YPS PP +KF       H N+ + 
Sbjct: 32  EDGSMNLQKWEAGIPGREGTIWKDAVYPITIEYPDDYPSKPPKVKFPAGFY--HPNI-YP 88

Query: 88  TGEICLNIL-KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLN 128
           +G +CL+IL ++++W P   +   +  +  LL  P+P SP  
Sbjct: 89  SGTVCLSILNEDQDWKPAITMKQILLGVQDLLTSPNPDSPAQ 130

>NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON}
           Anc_2.569
          Length = 165

 Score = 50.4 bits (119), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 71/158 (44%), Gaps = 21/158 (13%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           R++KE   + K     D+   +       ++L  W  ++ GP D+ Y    F   +  P 
Sbjct: 8   RLLKELQQLNK-----DSPPGIVAGPANENNLFVWDCLVQGPPDTAYEGGIFNARLDFPK 62

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNI------------LKNENWSPVWNLLYS 110
           +YP  PP + F  + + P+    +  GE+C++I            L  E WSPV ++   
Sbjct: 63  DYPLSPPKLTFTPSILHPNI---YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEKI 119

Query: 111 VQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSLIK 148
           + +++ +L+ P+  S  NID   +L   + K +   +K
Sbjct: 120 LLSVMSMLSEPNIESGANIDAC-ILWRDNRKEFERQVK 156

>KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON}
           Anc_4.49 YLR306W
          Length = 169

 Score = 49.7 bits (117), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 65/129 (50%), Gaps = 7/129 (5%)

Query: 20  NMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIP 79
           ++TTL P  + +   S    I + P +  Y+   F   +     YP  PP +   +    
Sbjct: 31  SLTTLVPPEDTSR--SPLLQITICPDEGFYNGGRFKFNLTTSESYPIDPPSVVCLQKIYH 88

Query: 80  PHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKD 139
           P+ ++N   G+ICLNIL+ E+WSP  ++   +  ++ L   P+P  PLN D +  L +++
Sbjct: 89  PNIDLN---GKICLNILR-EDWSPALDIQSVIVGLLFLFLEPNPRDPLNKDAASTL-IRN 143

Query: 140 SKAYNSLIK 148
           S  +  L++
Sbjct: 144 SHDFARLVE 152

>Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C
           (CDC34) - ubiquitin-conjugating enzyme, E2 [contig 36]
           FULL
          Length = 278

 Score = 50.4 bits (119), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 69/143 (48%), Gaps = 18/143 (12%)

Query: 2   SRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWH-SIILGPKDSPYHNKSFLLEIHI 60
           S ++++Y   R+L      + + H   +  S++  W+  +++  +DS YH   F  ++  
Sbjct: 10  SLLLRQY---RELTDAKKAIPSFHIELDDDSNIFLWNVGVMVLNEDSIYHGGYFKAQMRF 66

Query: 61  PTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNIL-----------KNENWSPVWNLLY 109
           P ++P  PP  +F      P+    +  G +C++IL            +E WSPV  +  
Sbjct: 67  PEDFPFSPPTFRFTPAIYHPNV---YRDGRLCISILHTSGDPTSEEPDSETWSPVQTVES 123

Query: 110 SVQAIIQLLAYPDPSSPLNIDLS 132
            + +I+ LL  P+ SSP N+D +
Sbjct: 124 VLISIVSLLEDPNISSPANVDAA 146

>KLTH0C04818g Chr3 (416167..416994) [828 bp, 275 aa] {ON} highly
           similar to uniprot|P14682 Saccharomyces cerevisiae
           YDR054C CDC34 Ubiquitin-conjugating enzyme or E2
           together with Skp1p Rbx1p Cdc53p and an F-box protein
           forms a ubiquitin-protein ligase called the SCF complex
           which regulates cell cycle progression by targeting key
           substrates for degradation
          Length = 275

 Score = 50.4 bits (119), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 36/143 (25%), Positives = 69/143 (48%), Gaps = 18/143 (12%)

Query: 2   SRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWH-SIILGPKDSPYHNKSFLLEIHI 60
           S ++++Y   R+L      + + H   +  S++  W+  +++  +DS YH   F  ++  
Sbjct: 10  SLLLRQY---RELTDAKKAIPSFHIELDDDSNIFLWNIGVMVLNEDSIYHGGYFKAQMRF 66

Query: 61  PTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNIL-----------KNENWSPVWNLLY 109
           P ++P  PP  +F      P+    +  G +C++IL            +E WSPV  +  
Sbjct: 67  PEDFPFSPPTFRFTPAIYHPNV---YRDGRLCISILHTSGDPTSEEPDSETWSPVQTVES 123

Query: 110 SVQAIIQLLAYPDPSSPLNIDLS 132
            + +I+ LL  P+ SSP N+D +
Sbjct: 124 VLISIVSLLEDPNISSPANVDAA 146

>CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar to
           uniprot|P52491 Saccharomyces cerevisiae YLR306w UBC12 E2
           ubiquitin-conjugating enzyme
          Length = 187

 Score = 49.3 bits (116), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 56/117 (47%), Gaps = 13/117 (11%)

Query: 39  SIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKN----SIPPHCNVNFTTGEICLN 94
           +II+ P +  Y    F         YP  PP +  N      +I PH       G+ICLN
Sbjct: 66  NIIIIPDEGFYKGGKFRFTATFLETYPIDPPKVICNNKIFHPNIDPH-------GKICLN 118

Query: 95  ILKNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSLIKYYL 151
           IL+ E+WSP  +L   V  ++ L   P+ + PLN + + +L  KD   + +L++  +
Sbjct: 119 ILR-EDWSPALDLQCIVLGLLSLFQEPNGNDPLNKEAAEVLN-KDKLEFGNLVRLAM 173

>NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3.301
           YDR054C
          Length = 273

 Score = 50.1 bits (118), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 77/161 (47%), Gaps = 23/161 (14%)

Query: 2   SRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWH-SIILGPKDSPYHNKSFLLEIHI 60
           S ++++Y   R+L      + + H   +  S+L  W+  +++  +DS YH   F  ++  
Sbjct: 10  SLLLRQY---RELTDPKKAIPSFHIELDDDSNLFVWNIGVMVLNEDSIYHGGYFKAQMRF 66

Query: 61  PTEYPSIPPVIKFNKNSIPP--HCNVNFTTGEICLNILKN-----------ENWSPVWNL 107
           P ++P  PP  +F     P   H NV +  G +C++IL             E WSPV  +
Sbjct: 67  PEDFPFSPPQFRF----TPAIYHPNV-YRDGRLCISILHQGGDPMTDEPDAETWSPVQTV 121

Query: 108 LYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSLIK 148
              + +I+ LL  P+ SSP N+D + +   K+ + Y   +K
Sbjct: 122 ESVLISIVSLLEDPNISSPANVDAA-VDYRKNQEQYKQRVK 161

>AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR054C
           (CDC34)
          Length = 270

 Score = 49.7 bits (117), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 78/159 (49%), Gaps = 19/159 (11%)

Query: 2   SRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWH-SIILGPKDSPYHNKSFLLEIHI 60
           S ++++Y   R+L      + + H   +  S++ +W+  +++  +DS YH   F  ++  
Sbjct: 10  SLLLRQY---RELTDPKKAIPSFHIELDDDSNIFSWNIGVMVLNEDSIYHGGYFKAQMRF 66

Query: 61  PTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNIL-----------KNENWSPVWNLLY 109
           P ++P  PP  +F       H NV +  G +C++IL            +E WSPV  +  
Sbjct: 67  PEDFPFSPPSFRFTPAIY--HPNV-YRDGRLCISILHQSGDPTSDEPDSETWSPVQTVES 123

Query: 110 SVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSLIK 148
            + +I+ LL  P+ SSP N+D + +   K+ + Y   +K
Sbjct: 124 VLISIVSLLEDPNISSPANVDAA-VDYRKNPEQYKQRVK 161

>NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {ON}
           Anc_3.301
          Length = 273

 Score = 49.7 bits (117), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 76/159 (47%), Gaps = 19/159 (11%)

Query: 2   SRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWH-SIILGPKDSPYHNKSFLLEIHI 60
           S ++++Y   R+L      + + H   +  S+L  W+  +++  +DS YH   F  ++  
Sbjct: 10  SLLLRQY---RELTDPKKAIPSFHIELDDDSNLFVWNIGVMVLNEDSIYHGGYFKAQMRF 66

Query: 61  PTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKN-----------ENWSPVWNLLY 109
           P ++P  PP  +F       H NV +  G +C++IL             E WSPV  +  
Sbjct: 67  PEDFPFSPPQFRFTPAIY--HPNV-YRDGRLCISILHQGGDPMTDEPDAETWSPVQTVES 123

Query: 110 SVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSLIK 148
            + +I+ LL  P+ SSP N+D + +   K+ + Y   +K
Sbjct: 124 VLISIVSLLEDPNISSPANVDAA-VDYRKNPEQYKQRVK 161

>Kpol_1045.39 s1045 complement(92062..92823) [762 bp, 253 aa] {ON}
           complement(92064..92825) [762 nt, 254 aa]
          Length = 253

 Score = 48.5 bits (114), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 49/96 (51%), Gaps = 7/96 (7%)

Query: 32  SDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEI 91
           S++  WH +I GP DSPYH+  +   +  P++YP  PP I+     + P+      T  +
Sbjct: 32  SNILEWHYVITGPPDSPYHDGQYHGTLTFPSDYPYKPPAIRM----VTPNGRFKENT-RL 86

Query: 92  CLNILKN--ENWSPVWNLLYSVQAIIQLLAYPDPSS 125
           CL++     + W+P W++   +  ++  +   + ++
Sbjct: 87  CLSMSDYHPDTWNPGWSVATILNGLLSFMTGDEQTT 122

>KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON} 
          Length = 296

 Score = 48.5 bits (114), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 47/99 (47%), Gaps = 14/99 (14%)

Query: 45  KDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKN------ 98
           +DS YH   F  ++  P ++P  PP  +F      P+    +  G +C++IL        
Sbjct: 51  EDSLYHGGYFKAQMRFPEDFPFSPPQFRFTPAIYHPNV---YRDGRLCISILHQSGDPMT 107

Query: 99  -----ENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLS 132
                E WSPV  +   + +I+ LL  P+ SSP N+D +
Sbjct: 108 DEPDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>Ecym_2669 Chr2 (1289437..1290243) [807 bp, 268 aa] {ON} similar to
           Ashbya gossypii AGL203C
          Length = 268

 Score = 48.5 bits (114), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 49/99 (49%), Gaps = 14/99 (14%)

Query: 45  KDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNIL-------- 96
           +DS YH   F  ++  P ++P  PP  +F       H NV +  G +C++IL        
Sbjct: 51  EDSIYHGGYFKAQMRFPEDFPFSPPSFRFTPAIY--HPNV-YRDGRLCISILHQSGDPTS 107

Query: 97  ---KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLS 132
               +E WSPV  +   + +I+ LL  P+ SSP N+D +
Sbjct: 108 DEPDSETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 47.8 bits (112), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 57/113 (50%), Gaps = 5/113 (4%)

Query: 39  SIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKN 98
            + + P +  Y++ S    +     YP  PP +   K    P+ ++    G +CLNIL+ 
Sbjct: 64  EVTVSPDEGYYNHGSINFGLDFNEVYPIEPPKVACLKKIFHPNIDLK---GNVCLNILR- 119

Query: 99  ENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSLIKYYL 151
           E+WSP  +L   +  ++ L   P+P+ PLN D ++L   ++ K +  +++  +
Sbjct: 120 EDWSPALDLQSIITGLLFLFLEPNPNDPLNKDAAKLFC-QNEKKFAEIVRSTM 171

>TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [564
           bp, 187 aa] {ON} Anc_4.49 YLR306W
          Length = 187

 Score = 47.8 bits (112), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 67/146 (45%), Gaps = 8/146 (5%)

Query: 12  RKLNALPDNMTTLHPVSNATSDLSN---WHSIILGPKDSPYHNKSFLLEIHIPTEYPSIP 68
           R L++L    TT   +  A +D S       +I+ P +  Y    F  E+    +YP  P
Sbjct: 35  RDLDSLEVPPTTQLQILRAPTDQSRDPPLLRLIVSPDEGFYRKGHFTFEMTFTEKYPIEP 94

Query: 69  PVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYPDPSSPLN 128
           P ++       P+ ++    G+ICLNIL+ E+WSP  +L   +  I+ L        PLN
Sbjct: 95  PQVRCMNQIFHPNIDLQ---GKICLNILR-EDWSPALDLQSVIIGILFLFLEVSGRDPLN 150

Query: 129 IDLSRLLTLKDSKAYNSLIKYYLYNF 154
              + LL    +K ++ L++  +  +
Sbjct: 151 KQAASLLDENPNK-FSRLVQQTMAGY 175

>CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {ON}
           highly similar to uniprot|P14682 Saccharomyces
           cerevisiae YDR054c CDC34 E2 ubiquitin-conjugating enzyme
          Length = 295

 Score = 48.5 bits (114), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 54/115 (46%), Gaps = 15/115 (13%)

Query: 45  KDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKN------ 98
           +DS YH   F  ++  P ++P  PP  +F      P+    +  G +C++IL        
Sbjct: 51  EDSIYHGGYFKAQMRFPDDFPFSPPQFRFTPAIYHPNV---YRDGRLCISILHQSGDPMT 107

Query: 99  -----ENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSLIK 148
                E WSPV  +   + +I+ LL  P+ SSP N+D + +   K+ + Y   +K
Sbjct: 108 DEPDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAA-VDFRKNPEQYKQRVK 161

>ZYRO0G12650g Chr7 complement(1002296..1003153) [858 bp, 285 aa]
           {ON} highly similar to uniprot|Q750Z0 Ashbya gossypii
           AGL203C AGL203Cp and similar to YDR054C uniprot|P14682
           Saccharomyces cerevisiae YDR054C CDC34 Ubiquitin-
           conjugating enzyme or E2 together with Skp1p Rbx1p
           Cdc53p and an F-box protein forms a ubiquitin-protein
           ligase called the SCF complex which regulates cell cycle
           progression by targeting key substrates for degradation
          Length = 285

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 49/101 (48%), Gaps = 18/101 (17%)

Query: 45  KDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPP--HCNVNFTTGEICLNILKN---- 98
           +DS YH   F  ++  P ++P  PP  +F     P   H NV +  G +C++IL      
Sbjct: 51  EDSIYHGGFFKAQMRFPEDFPFSPPQFRF----TPAIYHPNV-YRDGRLCISILHQSGDP 105

Query: 99  -------ENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLS 132
                  E WSPV  +   + +I+ LL  P+ SSP N+D +
Sbjct: 106 MTDEPDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON} 
          Length = 287

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 49/101 (48%), Gaps = 18/101 (17%)

Query: 45  KDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPP--HCNVNFTTGEICLNILKN---- 98
           +DS YH   F  ++  P ++P  PP  +F     P   H NV +  G +C++IL      
Sbjct: 51  EDSIYHGGYFKAQMRFPDDFPFSPPQFRF----TPAIYHPNV-YRDGRLCISILHQSGDP 105

Query: 99  -------ENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLS 132
                  E WSPV  +   + +I+ LL  P+ SSP N+D +
Sbjct: 106 MTDEPDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} similar
           to uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 251

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 57/124 (45%), Gaps = 10/124 (8%)

Query: 37  WHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNIL 96
           WH +I GP  +PY N  +   +  P++YP  PP I+     I P+      T  +CL++ 
Sbjct: 37  WHYVITGPPSTPYENGQYHGTLTFPSDYPFNPPAIRM----ITPNGRFKENT-RLCLSMS 91

Query: 97  KN--ENWSPVWNLLYSVQAIIQLLAYPDPS--SPLNIDLSRLLTLKDSKAYNSLIKYYLY 152
               E W+P W+++  +  ++  +   + +  S    D  +    K SK +N+   +   
Sbjct: 92  DYHPEAWNPAWSVVTILNGLLSFMTGDEQTTGSVSTSDKDKRTLAKKSKHFNTYSNFKFK 151

Query: 153 N-FP 155
           N FP
Sbjct: 152 NMFP 155

>TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON}
           Anc_3.301 YDR054C
          Length = 330

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 54/115 (46%), Gaps = 15/115 (13%)

Query: 45  KDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKN------ 98
           +DS YH   F  ++  P ++P  PP  +F      P+    +  G +C++IL        
Sbjct: 51  EDSIYHGGYFKSQMRFPEDFPFSPPQFRFTPAIYHPNV---YRDGRLCISILHQSGDPTT 107

Query: 99  -----ENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSLIK 148
                E WSPV  +   + +I+ LL  P+ SSP N+D + +   K+ + Y   IK
Sbjct: 108 DEPDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAA-VDYRKNPEQYKQRIK 161

>YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {ON}
            UBC12Enzyme that mediates the conjugation of Rub1p, a
           ubiquitin-like protein, to other proteins; related to E2
           ubiquitin-conjugating enzymes
          Length = 188

 Score = 47.4 bits (111), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 50/97 (51%), Gaps = 4/97 (4%)

Query: 39  SIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKN 98
            +I+ P +  Y+  S    +     YP  PP +   K    P+ ++    G +CLNIL+ 
Sbjct: 65  EVIVRPDEGYYNYGSINFNLDFNEVYPIEPPKVVCLKKIFHPNIDL---KGNVCLNILR- 120

Query: 99  ENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLL 135
           E+WSP  +L   +  ++ L   P+P+ PLN D ++LL
Sbjct: 121 EDWSPALDLQSIITGLLFLFLEPNPNDPLNKDAAKLL 157

>Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON}
           (121426..122397) [972 nt, 324 aa]
          Length = 323

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 49/101 (48%), Gaps = 18/101 (17%)

Query: 45  KDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPP--HCNVNFTTGEICLNILKN---- 98
           +DS YH   F  ++  P ++P  PP  +F     P   H NV +  G +C++IL      
Sbjct: 51  EDSIYHGGYFKAQMRFPDDFPFSPPQFRF----TPAIYHPNV-YRDGRLCISILHQSGDP 105

Query: 99  -------ENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLS 132
                  E WSPV  +   + +I+ LL  P+ SSP N+D +
Sbjct: 106 MTDELDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>TBLA0D00600 Chr4 complement(156677..157447) [771 bp, 256 aa] {ON}
           Anc_7.392 YER100W
          Length = 256

 Score = 47.8 bits (112), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 46/89 (51%), Gaps = 7/89 (7%)

Query: 32  SDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEI 91
           S++  WH II+GP+D+PY    +   +  P++YP  PP I+     I P+      T  +
Sbjct: 32  SNILEWHYIIIGPQDTPYDGGQYHGTLTFPSDYPYKPPAIRM----ITPNGRFKENT-RL 86

Query: 92  CLNILKN--ENWSPVWNLLYSVQAIIQLL 118
           CL++     + W+P W++   +  ++  +
Sbjct: 87  CLSMSDYHPDTWNPGWSVATILNGLLSFM 115

>KLLA0D09196g Chr4 (772795..773673) [879 bp, 292 aa] {ON} similar to
           uniprot|P14682 Saccharomyces cerevisiae YDR054C CDC34
           Ubiquitin-conjugating enzyme or E2 together with Skp1p
           Rbx1p Cdc53p and an F-box protein forms a
           ubiquitin-protein ligase called the SCF complex which
           regulates cell cycle progression by targeting key
           substrates for degradation
          Length = 292

 Score = 47.8 bits (112), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 62/137 (45%), Gaps = 18/137 (13%)

Query: 11  IRKLNALPDNMTTLHPVSNATSDLSN---WH-SIILGPKDSPYHNKSFLLEIHIPTEYPS 66
           +R+   L D    +     A  D SN   W+  +++  ++S YH   F  ++  P ++P 
Sbjct: 12  LRQYRELTDPKKAIPSFHIALEDDSNIFLWNIGVMVLNEESIYHGGYFKAQMKFPDDFPF 71

Query: 67  IPPVIKFNKNSIPPHCNVNFTTGEICLNIL-----------KNENWSPVWNLLYSVQAII 115
            PP  +F      P+    +  G +C++IL             E WSPV  +   + +I+
Sbjct: 72  SPPTFRFTPAIYHPNV---YRDGRLCISILHQSGNPTSDEPDEETWSPVQTVESVLISIV 128

Query: 116 QLLAYPDPSSPLNIDLS 132
            LL  P+ SSP N+D +
Sbjct: 129 SLLEDPNISSPANVDAA 145

>SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly
           similar to uniprot|Q750Z0 Ashbya gossypii AGL203C
           AGL203Cp and similar to YDR054C uniprot|P14682
           Saccharomyces cerevisiae YDR054C CDC34 Ubiquitin-
           conjugating enzyme or E2 together with Skp1p Rbx1p
           Cdc53p and an F-box protein forms a ubiquitin-protein
           ligase called the SCF complex which regulates cell cycle
           progression by targeting key substrates for degradation
          Length = 272

 Score = 47.4 bits (111), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 49/99 (49%), Gaps = 14/99 (14%)

Query: 45  KDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNIL-------- 96
           +DS YH   F  ++  P ++P  PP  +F       H NV +  G +C++IL        
Sbjct: 51  EDSIYHGGYFKAQMKFPEDFPFSPPNFRFTPAIY--HPNV-YRDGRLCISILHQSGDPTS 107

Query: 97  ---KNENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLS 132
               +E WSPV  +   + +I+ LL  P+ SSP N+D +
Sbjct: 108 DEPDSETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa]
           {ON} Anc_4.49 YLR306W
          Length = 197

 Score = 46.6 bits (109), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 55/110 (50%), Gaps = 7/110 (6%)

Query: 40  IILGPKDSPYHNKSFLLEIHIPTEYPSIPP-VIKFNKNSIPPHCNVNFTTGEICLNILKN 98
           +IL   +  Y+   F  +  I   YP  PP V+   K     H N+N  TGEICLNIL+ 
Sbjct: 77  LILSIDEGFYNLGHFRFQFTINENYPIEPPKVVCLTKIY---HPNIN-RTGEICLNILR- 131

Query: 99  ENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSLIK 148
           E+WSP  +L   +  ++ L   P+P  PLN   +  L L D   +  +++
Sbjct: 132 EDWSPALDLQSVIIGLLFLFIEPNPKDPLNKQAADTL-LHDPAVFKHIVQ 180

>KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa]
           {ON} similar to uniprot|P52491 Saccharomyces cerevisiae
           YLR306W UBC12 Enzyme that mediates the conjugation of
           Rub1p a ubiquitin-like protein to other proteins related
           to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 46.2 bits (108), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 49/97 (50%), Gaps = 4/97 (4%)

Query: 39  SIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKN 98
           ++ + P    Y   ++   + I   YP  PPV+K       P+ +++   G +CLN+L+ 
Sbjct: 62  NLAIKPDIGYYAGGTYYFNVFIKDTYPMEPPVVKCMHRIYHPNIDID---GNVCLNLLR- 117

Query: 99  ENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLL 135
           E+W+P  ++   +  I+ L   P+   PLN D ++ L
Sbjct: 118 EDWTPALDIQSIIIGILFLFHEPNGRDPLNKDAAKTL 154

>Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 47.0 bits (110), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 67/143 (46%), Gaps = 18/143 (12%)

Query: 2   SRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWH-SIILGPKDSPYHNKSFLLEIHI 60
           S ++++Y   R+L      + + H      S++  W+  +++  +DS YH   F  ++  
Sbjct: 10  SLLLRQY---RELTDPKKAIPSFHIELEDDSNIFTWNIGVMVLNEDSIYHGGFFKAQMRF 66

Query: 61  PTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKN-----------ENWSPVWNLLY 109
           P ++P  PP  +F      P+    +  G +C++IL             E WSPV  +  
Sbjct: 67  PEDFPFSPPQFRFTPAIYHPNV---YRDGRLCISILHQSGDPMTDEPDAETWSPVQTVES 123

Query: 110 SVQAIIQLLAYPDPSSPLNIDLS 132
            + +I+ LL  P+ +SP N+D +
Sbjct: 124 VLISIVSLLEDPNINSPANVDAA 146

>Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 47.0 bits (110), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 67/143 (46%), Gaps = 18/143 (12%)

Query: 2   SRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWH-SIILGPKDSPYHNKSFLLEIHI 60
           S ++++Y   R+L      + + H      S++  W+  +++  +DS YH   F  ++  
Sbjct: 10  SLLLRQY---RELTDPKKAIPSFHIELEDDSNIFTWNIGVMVLNEDSIYHGGFFKAQMRF 66

Query: 61  PTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKN-----------ENWSPVWNLLY 109
           P ++P  PP  +F      P+    +  G +C++IL             E WSPV  +  
Sbjct: 67  PEDFPFSPPQFRFTPAIYHPNV---YRDGRLCISILHQSGDPMTDEPDAETWSPVQTVES 123

Query: 110 SVQAIIQLLAYPDPSSPLNIDLS 132
            + +I+ LL  P+ +SP N+D +
Sbjct: 124 VLISIVSLLEDPNINSPANVDAA 146

>YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}
           CDC34Ubiquitin-conjugating enzyme (E2) and catalytic
           subunit of SCF ubiquitin-protein ligase complex
           (together with Skp1p, Rbx1p, Cdc53p, and an F-box
           protein) that regulates cell cycle progression by
           targeting key substrates for degradation
          Length = 295

 Score = 47.0 bits (110), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 67/143 (46%), Gaps = 18/143 (12%)

Query: 2   SRIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWH-SIILGPKDSPYHNKSFLLEIHI 60
           S ++++Y   R+L      + + H      S++  W+  +++  +DS YH   F  ++  
Sbjct: 10  SLLLRQY---RELTDPKKAIPSFHIELEDDSNIFTWNIGVMVLNEDSIYHGGFFKAQMRF 66

Query: 61  PTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKN-----------ENWSPVWNLLY 109
           P ++P  PP  +F      P+    +  G +C++IL             E WSPV  +  
Sbjct: 67  PEDFPFSPPQFRFTPAIYHPNV---YRDGRLCISILHQSGDPMTDEPDAETWSPVQTVES 123

Query: 110 SVQAIIQLLAYPDPSSPLNIDLS 132
            + +I+ LL  P+ +SP N+D +
Sbjct: 124 VLISIVSLLEDPNINSPANVDAA 146

>TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.301
           YDR054C
          Length = 289

 Score = 46.6 bits (109), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 47/99 (47%), Gaps = 14/99 (14%)

Query: 45  KDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKN------ 98
           ++S YH   F  ++  P ++P  PP  +F      P+    +  G +C++IL        
Sbjct: 51  EESIYHGGYFKAQMRFPEDFPFSPPQFRFTPAIYHPNV---YRDGRLCISILHQSGDPMT 107

Query: 99  -----ENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLS 132
                E WSPV  +   + +I+ LL  P+ SSP N+D +
Sbjct: 108 DEPDAETWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON}
           similar to Ashbya gossypii AGR372W
          Length = 243

 Score = 46.6 bits (109), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 52/115 (45%), Gaps = 11/115 (9%)

Query: 36  NWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTT-GEICLN 94
            WH +I GP D+PY    +   +H P EYP  PP I+    S P   N  F     +CL+
Sbjct: 36  EWHYVITGPPDTPYEGGQYHGTLHFPPEYPFKPPAIRI---STP---NGRFKQHTRLCLS 89

Query: 95  ILKN--ENWSPVWNLLYSVQAIIQLLAYPDPS--SPLNIDLSRLLTLKDSKAYNS 145
           +     + W+P W++   +  ++  +   + +  S    D ++      SK YN+
Sbjct: 90  MSDYHPDTWNPSWSVATILNGLLSFMTGDEQTGGSITTSDYTKKTLALSSKEYNA 144

>TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {ON}
           Anc_3.301 YDR054C
          Length = 435

 Score = 46.6 bits (109), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 60/123 (48%), Gaps = 19/123 (15%)

Query: 39  SIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPP--HCNVNFTTGEICLNIL 96
            +++  ++S YH   F  ++  P ++P  PP  +F     P   H NV +  G +C++IL
Sbjct: 45  GVMVLNEESIYHGGYFKAQMRFPDDFPFSPPQFRF----TPAIYHPNV-YRDGRLCISIL 99

Query: 97  KN-----------ENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNS 145
                        E WSPV ++   + +I+ LL  P+ SSP N+D + +   K+ + Y  
Sbjct: 100 HQSGDPMTDELDAETWSPVQSVESVLISIVSLLEDPNISSPANVDAA-VDYRKNPEQYKQ 158

Query: 146 LIK 148
            IK
Sbjct: 159 RIK 161

>Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 46.6 bits (109), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 47/99 (47%), Gaps = 14/99 (14%)

Query: 45  KDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKN------ 98
           +DS YH   F  ++  P ++P  PP  +F      P+    +  G +C++IL        
Sbjct: 51  EDSIYHGGFFKAQMRFPEDFPFSPPQFRFTPAIYHPNV---YRDGRLCISILHQSGDPMT 107

Query: 99  -----ENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLS 132
                E WSPV  +   + +I+ LL  P+ +SP N+D +
Sbjct: 108 DEPDAETWSPVQTVESVLISIVSLLEDPNINSPANVDAA 146

>Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W
           (REAL)
          Length = 250

 Score = 46.2 bits (108), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 54/114 (47%), Gaps = 9/114 (7%)

Query: 37  WHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNIL 96
           WH II GP D+PY    +   +  P++YP  PP I+     + P+      T  +CL++ 
Sbjct: 37  WHYIITGPADTPYKGGQYHGTLTFPSDYPYKPPAIRM----VTPNGRFKPNT-RLCLSMS 91

Query: 97  KN--ENWSPVWNLLYSVQAIIQLLAYPDPSSP--LNIDLSRLLTLKDSKAYNSL 146
               + W+P W++   +  ++  +   + ++      D  + +  ++S +YNS 
Sbjct: 92  DYHPDTWNPGWSVSTILNGLLSFMTSDEATTGSITTSDHQKKMLARNSISYNSF 145

>NCAS0E02600 Chr5 complement(519792..520559) [768 bp, 255 aa] {ON}
           Anc_7.392
          Length = 255

 Score = 45.8 bits (107), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 54/112 (48%), Gaps = 9/112 (8%)

Query: 37  WHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNIL 96
           WH II GP D+PY +  +   +  P++YP  PP I+     I P+      T  +CL++ 
Sbjct: 37  WHYIITGPPDTPYKDGQYHGTLTFPSDYPYKPPAIRM----ITPNGRFKENT-RLCLSMS 91

Query: 97  KN--ENWSPVWNLLYSVQAIIQLLAYPDPS--SPLNIDLSRLLTLKDSKAYN 144
               + W+P W++   +  ++  +   D +  S +  D  + L  K+S  +N
Sbjct: 92  DYHPDLWNPGWSVNTILNGLLSFMTGDDSTTGSIVTTDSQKRLLAKNSVEFN 143

>SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 185
           aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 185

 Score = 45.4 bits (106), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 48/104 (46%), Gaps = 6/104 (5%)

Query: 27  VSNATSDLSNWHSIILG--PKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNV 84
           VS  TS L +  ++     P +  Y    F   +     YP  PP +K       P+ + 
Sbjct: 49  VSADTSGLESSSTLFFTIHPDEGYYKPGYFRFSLFFKDTYPIEPPAVKCVNKIYHPNID- 107

Query: 85  NFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYPDPSSPLN 128
             T G +CLNIL+ E+WSPV +L   V  ++ L   P+   PLN
Sbjct: 108 --TQGNVCLNILR-EDWSPVLDLQSVVIGLLFLFLEPNDKDPLN 148

>Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to
           Ashbya gossypii ADL035C 1-intron
          Length = 267

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 44/87 (50%), Gaps = 4/87 (4%)

Query: 42  LGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENW 101
           + P +  Y +  F   +     YP  PP++K       P+ + N   G ICLN+L+ E+W
Sbjct: 148 ISPDEGFYKHGHFGFSVSFKDSYPIDPPIVKCLTTIYHPNIDYN---GNICLNVLR-EDW 203

Query: 102 SPVWNLLYSVQAIIQLLAYPDPSSPLN 128
           +PV +L   V  ++ L   P+P  PLN
Sbjct: 204 TPVLDLQTIVIGLLFLFLEPNPKDPLN 230

>KNAG0J02280 Chr10 complement(424795..425448) [654 bp, 217 aa] {ON} 
          Length = 217

 Score = 45.4 bits (106), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 59/138 (42%), Gaps = 19/138 (13%)

Query: 9   NHIRKLNALPDNMTTLHPVSNATSDLSNWH-SIILGPKDSPYHNKSFLLEIHIPTEYPSI 67
              R+L      M   H      S++  W    ++  +DS YH       +  P  +P  
Sbjct: 15  RQFRELRDPRRRMPCFHIELVEKSNIFEWEVGFMVTNEDSIYHGAYLTGLLCFPRNFPFS 74

Query: 68  PPVIKFNKNSIPP--HCNVNFTTGEICLNIL-----------KNENWSPVWNLLYSVQAI 114
           PP   F     PP  H NV F+ G +C++IL            +E WSPV  +   + +I
Sbjct: 75  PPTFLF----CPPIYHPNV-FSNGSLCISILHECGDDTNEEPDSETWSPVQTVETVLISI 129

Query: 115 IQLLAYPDPSSPLNIDLS 132
           I LL  P+ SSP N+D +
Sbjct: 130 ISLLDDPNVSSPANVDAA 147

>ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, 200
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YLR306W (UBC12); 1-intron
          Length = 200

 Score = 44.7 bits (104), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 48/87 (55%), Gaps = 4/87 (4%)

Query: 42  LGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENW 101
           + P++  Y    F   +     YP  PP +K   N+I  H N++++ G ICLN+L+ E+W
Sbjct: 81  ISPEEGVYRGGHFRFSVVFRDTYPIEPPTVKC-LNTIY-HPNIDYS-GNICLNVLR-EDW 136

Query: 102 SPVWNLLYSVQAIIQLLAYPDPSSPLN 128
           SPV +L   V  ++ L   P+ S PLN
Sbjct: 137 SPVMDLQTVVLGLLFLFLEPNGSDPLN 163

>Suva_5.219 Chr5 (333753..334502) [750 bp, 249 aa] {ON} YER100W
           (REAL)
          Length = 249

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 54/114 (47%), Gaps = 9/114 (7%)

Query: 37  WHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNIL 96
           WH II GP D+PY    +   +  P++YP  PP I+     I P+      T  +CL++ 
Sbjct: 37  WHYIITGPADTPYKAGQYHGTLTFPSDYPYKPPAIRM----ITPNGRFKPNT-RLCLSMS 91

Query: 97  KN--ENWSPVWNLLYSVQAIIQLLAYPDPS--SPLNIDLSRLLTLKDSKAYNSL 146
               + W+P W++   +  ++  +   + +  S    D  + +  K+S +YN+ 
Sbjct: 92  DYHPDTWNPGWSVSTILNGLLSFMTSDEATTGSITTSDHQKKVLAKNSVSYNTF 145

>KAFR0L01750 Chr12 (320295..321050) [756 bp, 251 aa] {ON} Anc_7.392
           YER100W
          Length = 251

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 54/114 (47%), Gaps = 9/114 (7%)

Query: 37  WHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNIL 96
           WH +I GP D+PY +  +   +  P++YP  PP I+     I P+      T  +CL++ 
Sbjct: 37  WHYVITGPSDTPYSSGQYHGTLTFPSDYPYKPPAIRM----ITPNGRFKENT-RLCLSMS 91

Query: 97  KN--ENWSPVWNLLYSVQAIIQLLAYPDPS--SPLNIDLSRLLTLKDSKAYNSL 146
               + W+P W++   +  ++  +   + +  S +  D  + L  K S  +N+ 
Sbjct: 92  DYHPDLWNPGWSVSTILTGLLSFMTGDEATTGSIVTTDQQKKLLAKRSIQFNTF 145

>TPHA0K00820 Chr11 complement(172380..173153) [774 bp, 257 aa] {ON}
           Anc_7.392 YER100W
          Length = 257

 Score = 44.7 bits (104), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 64/147 (43%), Gaps = 15/147 (10%)

Query: 3   RIIKEYNHIRKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPT 62
           R+ KEY   + +N  P       P     +++  WH II GP DSPY    +   +  P+
Sbjct: 9   RLTKEY---KMMNENPTPFIMARPNE---ANILEWHYIINGPPDSPYFEGQYHGTLTFPS 62

Query: 63  EYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKN--ENWSPVWNLLYSVQAIIQLLAY 120
           +YP  PP I+     I P+      T  +CL++     + W+P W++   +  ++  +  
Sbjct: 63  DYPYKPPAIRM----ITPNGRFKENT-RLCLSMSDYHPDTWNPGWSVATILNGLLSFMTG 117

Query: 121 PD--PSSPLNIDLSRLLTLKDSKAYNS 145
            +    S    +  + +  K S  YN+
Sbjct: 118 DEITTGSITTTEQQKKILAKKSMDYNT 144

>TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, 193
           aa] {ON} Anc_4.49 YLR306W
          Length = 193

 Score = 43.9 bits (102), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 56/114 (49%), Gaps = 7/114 (6%)

Query: 39  SIILGPKDSPYHNKSFLLEIHIPTEYPSIPP-VIKFNKNSIPPHCNVNFTTGEICLNILK 97
           ++ + P++ PY   +F   +     YP  PP  I  NK    P+ ++N   G+ICLNIL+
Sbjct: 72  TLCISPREGPYLGGAFKFNLKFNEMYPIEPPSAICLNK-IFHPNIDLN---GKICLNILR 127

Query: 98  NENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSLIKYYL 151
            E+WSP  +L   V  ++ L      + PLN   + +L   D   +  L++  +
Sbjct: 128 -EDWSPALDLTSIVIGLLYLFLDFTSTDPLNQQAAEVLA-NDRNRFCELVQRAM 179

>NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49
          Length = 189

 Score = 43.9 bits (102), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 55/111 (49%), Gaps = 5/111 (4%)

Query: 44  PKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSP 103
           P +  Y    F  ++     YP  PP +        P+ +++   G++CLNIL+ E+WSP
Sbjct: 73  PDEGFYKGGHFTFKLEFNDAYPIEPPTVICTSKLYHPNIDID---GKVCLNILR-EDWSP 128

Query: 104 VWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLLTLKDSKAYNSLIKYYLYNF 154
             ++   +  ++ LL  P+   PLN D + +L+  D+  + SL+   +  +
Sbjct: 129 ALDVQSIIIGLLFLLLEPNAKDPLNKDAAMMLST-DTARFASLVNRSMAGY 178

>YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}
           UBC6Ubiquitin-conjugating enzyme involved in
           ER-associated protein degradation; located at the
           cytosolic side of the ER membrane; tail region contains
           a transmembrane segment at the C-terminus; substrate of
           the ubiquitin-proteasome pathway
          Length = 250

 Score = 44.3 bits (103), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 53/114 (46%), Gaps = 9/114 (7%)

Query: 37  WHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNIL 96
           WH II GP D+PY    +   +  P++YP  PP I+     I P+      T  +CL++ 
Sbjct: 37  WHYIITGPADTPYKGGQYHGTLTFPSDYPYKPPAIRM----ITPNGRFKPNT-RLCLSMS 91

Query: 97  KN--ENWSPVWNLLYSVQAIIQLLAYPDPSSP--LNIDLSRLLTLKDSKAYNSL 146
               + W+P W++   +  ++  +   + ++      D  +    ++S +YN+ 
Sbjct: 92  DYHPDTWNPGWSVSTILNGLLSFMTSDEATTGSITTSDHQKKTLARNSISYNTF 145

>NDAI0E04170 Chr5 complement(940288..941061) [774 bp, 257 aa] {ON}
           Anc_7.392
          Length = 257

 Score = 44.3 bits (103), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 42/83 (50%), Gaps = 9/83 (10%)

Query: 37  WHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNIL 96
           WH II GP DSPY    +   +  PT+YP  PP I+     I P+      T  +CL++ 
Sbjct: 37  WHYIITGPPDSPYSEGQYHGTLTFPTDYPYKPPAIRM----ITPNGRFKENT-RLCLSM- 90

Query: 97  KNENWSP-VWNLLYSVQAIIQLL 118
              ++ P +WN  +SV  I+  L
Sbjct: 91  --SDYHPDLWNPSWSVSTILTGL 111

>Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W
           (REAL)
          Length = 250

 Score = 43.9 bits (102), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 54/114 (47%), Gaps = 9/114 (7%)

Query: 37  WHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNIL 96
           WH II GP ++PY    +   +  P++YP  PP I+     + P+      T  +CL++ 
Sbjct: 37  WHYIITGPAETPYKGGQYHGTLTFPSDYPYKPPAIRM----VTPNGRFKPNT-RLCLSMS 91

Query: 97  KN--ENWSPVWNLLYSVQAIIQLLAYPDPS--SPLNIDLSRLLTLKDSKAYNSL 146
               + W+P W++   +  ++  +   + +  S    D  + +  K+S +YN+ 
Sbjct: 92  DYHPDTWNPGWSVSTILNGLLSFMTSDEATTGSVTTSDHQKKILAKNSLSYNAF 145

>SAKL0F12474g Chr6 (974485..975240) [756 bp, 251 aa] {ON} similar to
           uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 251

 Score = 43.9 bits (102), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 53/123 (43%), Gaps = 23/123 (18%)

Query: 3   RIIKEYNHI-----RKLNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLE 57
           R+ KEY  I     + +NA P+    L            WH II GP D+PY +  +   
Sbjct: 9   RLTKEYKAIIENPPQFINAQPNEDNILE-----------WHYIITGPPDTPYTDGQYHGT 57

Query: 58  IHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKN--ENWSPVWNLLYSVQAII 115
           +  P +YP  PP I+     I P+      T  +C+ +     + W+P W++   +  ++
Sbjct: 58  LVFPADYPFKPPAIRM----ITPNGRFKENT-RLCMTMSDYHPDTWNPAWSVATILMGLL 112

Query: 116 QLL 118
             +
Sbjct: 113 SFM 115

>ZYRO0B03344g Chr2 (278107..278859) [753 bp, 250 aa] {ON} similar to
           uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 250

 Score = 43.9 bits (102), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/118 (22%), Positives = 54/118 (45%), Gaps = 9/118 (7%)

Query: 32  SDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEI 91
           S++ +WH II GP  +PY N  +   +  P++YP  PP I+     + P       T  +
Sbjct: 32  SNILDWHYIITGPPGTPYENGQYHGTLTFPSDYPFQPPAIRM----VTPSGRFQENT-RL 86

Query: 92  CLNILKNE--NWSPVWNLLYSVQAIIQLLAYPDPSSP--LNIDLSRLLTLKDSKAYNS 145
           CL++       W+P W++   +  ++  +   + ++      +  + +  K S  YN+
Sbjct: 87  CLSMSDYHPTTWNPGWSVSTILNGLLSFMTSEEGTTGSITTTEQQKKVFCKRSMEYNT 144

>TDEL0G01580 Chr7 (311978..311988,312055..312460) [417 bp, 138 aa]
           {ON} Anc_6.187 YGL087C
          Length = 138

 Score = 42.4 bits (98), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 63/130 (48%), Gaps = 15/130 (11%)

Query: 1   MSRIIKEYNHIRKLNALPDNMTTLHPVSN----ATSD---LSNWHSIILGPKDSPYHNKS 53
           MS++ + +   R L  L      L P S     A SD   ++NW+  ILGP  S + N+ 
Sbjct: 1   MSKVPRNF---RLLEELEKGEKGLGPESCSYGLADSDDITMTNWNGTILGPPHSNHENRI 57

Query: 54  FLLEIHIPTEYPSIPPVIKF-NKNSIPPHCNVNFTTGEICLNILKN-ENWSPVWNLLYSV 111
           + + I     YP  PP IKF +K ++P  C V+ TTGE+  ++     +W   + +   +
Sbjct: 58  YSVSIECGPNYPDEPPKIKFVSKVNVP--C-VDSTTGEVKSSVFHTLRDWKRAYTMETLL 114

Query: 112 QAIIQLLAYP 121
             + + +A P
Sbjct: 115 LDLRKEMATP 124

>NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON}
           Anc_7.392
          Length = 251

 Score = 43.5 bits (101), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 40/85 (47%), Gaps = 7/85 (8%)

Query: 37  WHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNIL 96
           WH II GP D+PY    +   +  P +YP  PP I+     I P+      T  +CL++ 
Sbjct: 37  WHYIITGPPDTPYDGGQYHGTLTFPNDYPYKPPAIRM----ITPNGRFKENT-RLCLSMS 91

Query: 97  KN--ENWSPVWNLLYSVQAIIQLLA 119
               + W+P W++   +  ++  + 
Sbjct: 92  DYHPDTWNPGWSVSTILNGLLSFMT 116

>CAGL0I05478g Chr9 complement(518933..519673) [741 bp, 246 aa] {ON}
           highly similar to uniprot|P33296 Saccharomyces
           cerevisiae YER100w UBC6 E2 ubiquitin-conjugating enzyme
          Length = 246

 Score = 43.1 bits (100), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 54/116 (46%), Gaps = 11/116 (9%)

Query: 36  NWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNI 95
            WH +I GP D+PY    +   +  P++YP  PP I+     I P+      T  +CL++
Sbjct: 36  EWHYVISGPPDTPYDGGQYHGTLTFPSDYPYKPPAIRM----ITPNGRFKENT-RLCLSM 90

Query: 96  LKN--ENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLS---RLLTLKDSKAYNSL 146
                + W+P W++   +  ++  +   D S+  +I  +   + +  K S  YN+ 
Sbjct: 91  SDYHPDTWNPGWSVATILNGLLSFMT-GDESTTGSITTTQQEKKILAKKSMYYNTF 145

>Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, 193
           aa] {ON} ANNOTATED BY YGOB -
          Length = 193

 Score = 42.7 bits (99), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 50/97 (51%), Gaps = 4/97 (4%)

Query: 39  SIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKN 98
           ++++ P +  Y +  F  ++     YP  PP++        P+ +++   G+ICLNIL+ 
Sbjct: 72  TLLISPDEGYYKSGKFKFDLKFNENYPIEPPIVLCMNKIFHPNIDLD---GKICLNILR- 127

Query: 99  ENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLL 135
           E+WSP  +L   +  ++ L    +   PLN + + +L
Sbjct: 128 EDWSPALDLNSIIIGLLYLFLECNAKDPLNKEAANIL 164

>TDEL0C01550 Chr3 complement(267010..267756) [747 bp, 248 aa] {ON}
           Anc_7.392 YER100W
          Length = 248

 Score = 43.1 bits (100), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 43/91 (47%), Gaps = 7/91 (7%)

Query: 37  WHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNIL 96
           WH II GP D+PY    +   +  P++YP  PP I+     + P+      T  +CL++ 
Sbjct: 37  WHYIITGPADTPYFEGQYHGTLTFPSDYPYKPPAIRM----VTPNGRFRENT-RLCLSMS 91

Query: 97  KNE--NWSPVWNLLYSVQAIIQLLAYPDPSS 125
                 W+P W++   +  ++  +   + ++
Sbjct: 92  DYHPNTWNPSWSVSTILNGLLSFMTGDEATT 122

>Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF}
           complement(6958..7536) [579 nt, 193 aa]
          Length = 192

 Score = 42.7 bits (99), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 50/97 (51%), Gaps = 4/97 (4%)

Query: 39  SIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKN 98
           ++++ P +  Y +  F  ++     YP  PP++        P+ +++   G+ICLNIL+ 
Sbjct: 71  TLLISPDEGYYKSGKFKFDLKFNENYPIEPPIVLCMNKIFHPNIDLD---GKICLNILR- 126

Query: 99  ENWSPVWNLLYSVQAIIQLLAYPDPSSPLNIDLSRLL 135
           E+WSP  +L   +  ++ L    +   PLN + + +L
Sbjct: 127 EDWSPALDLNSIIIGLLYLFLECNAKDPLNKEAANIL 163

>Kwal_27.10837 s27 complement(519750..520490) [741 bp, 246 aa] {ON}
           YER100W (UBC6) - ubiquitin-conjugating enzyme [contig
           33] FULL
          Length = 246

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/115 (22%), Positives = 52/115 (45%), Gaps = 9/115 (7%)

Query: 36  NWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNI 95
            WH +I GP D+PY    +   +  P++YP  PP I+     + P       T  +CL++
Sbjct: 36  EWHYVITGPPDTPYMGGQYHGTLVFPSDYPFKPPAIRM----VTPSGRFKEDT-RLCLSM 90

Query: 96  LKN--ENWSPVWNLLYSVQAIIQLLAYPDPSSP--LNIDLSRLLTLKDSKAYNSL 146
                + W+P W++   +  ++  +   + ++   +     +    + SK YN+L
Sbjct: 91  SDYHPDTWNPSWSVSTILTGLLSFMTSEENTTGAIVTTQEHKRKMARASKEYNAL 145

>NCAS0D03660 Chr4 complement(683552..683957,684062..684072) [417 bp,
           138 aa] {ON} Anc_6.187 YGL087C
          Length = 138

 Score = 42.0 bits (97), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 69/144 (47%), Gaps = 24/144 (16%)

Query: 1   MSRIIKEYNHIRKLNALPDNMTTLHPVSN----ATSD---LSNWHSIILGPKDSPYHNKS 53
           MS++ + +   R L  L      L P S     A SD   ++ W+  ILGP  S + N+ 
Sbjct: 1   MSKVPRNF---RLLEELEKGEKGLGPESCSYGLADSDDITMTKWNGTILGPPHSNHENRI 57

Query: 54  FLLEIHIPTEYPSIPPVIKF-NKNSIPPHCNVNFTTGEI---CLNILKNENWSPVWNLLY 109
           + + IH    YP  PP IKF +K ++P  C V+  TGE+     + L++      W   Y
Sbjct: 58  YSVAIHCGPHYPDAPPTIKFVSKINLP--C-VDEKTGEVKQASFHTLRD------WKRSY 108

Query: 110 SVQAIIQLLAYPDPSSPLNIDLSR 133
           +++ ++ L    + +SP N  L +
Sbjct: 109 TMETLL-LDLRKEMASPANKKLKQ 131

>KNAG0F02130 Chr6 (405648..406064) [417 bp, 138 aa] {ON} Anc_6.187
           YGL087C
          Length = 138

 Score = 41.6 bits (96), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 69/143 (48%), Gaps = 22/143 (15%)

Query: 1   MSRIIKEYNHIRKLNALPDNMTTLHPVSN----ATSD---LSNWHSIILGPKDSPYHNKS 53
           MS++ + +   R L  L        P S     A SD   ++ W+  ILGP  S + N+ 
Sbjct: 1   MSKVPRSF---RLLEELEKGEKGFGPESCSYGLADSDDITMTKWNGTILGPPHSNHENRI 57

Query: 54  FLLEIHIPTEYPSIPPVIKF-NKNSIPPHCNVNFTTGEICLNILKNENWSPV--WNLLYS 110
           + LEI     YP  PP++KF +K ++P  C V+ TTG     ++  E +  +  W   Y+
Sbjct: 58  YSLEIVCGDRYPDEPPLVKFISKVNLP--C-VDQTTG-----VVSAEKFHTLRDWKRSYT 109

Query: 111 VQAIIQLLAYPDPSSPLNIDLSR 133
           +Q ++ L    +  +P N  LS+
Sbjct: 110 MQTVL-LDLRKEMGTPANKKLSQ 131

>SAKL0A05192g Chr1 (468949..468959,469039..469450) [423 bp, 140
          aa] {ON} highly similar to uniprot|P53152 Saccharomyces
          cerevisiae YGL087C MMS2 Protein involved in error-free
          postreplication DNA repair forms a heteromeric complex
          with Ubc13p that has a ubiquitin-conjugating activity
          cooperates with chromatin-associated RING finger
          proteins Rad18p and Rad5p
          Length = 140

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 37/59 (62%), Gaps = 4/59 (6%)

Query: 34 LSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKF-NKNSIPPHCNVNFTTGEI 91
          ++NW+  ILGP  S + N+ + + I     YP  PP+IKF +K ++P  C V+ TTGE+
Sbjct: 40 MTNWNGTILGPPHSNHENRIYSVAIECGANYPDEPPLIKFVSKINLP--C-VDQTTGEV 95

>CAGL0H03157g Chr8 complement(297272..297680,297881..297891) [420
           bp, 139 aa] {ON} highly similar to uniprot|P53152
           Saccharomyces cerevisiae YGL087c MMS2 part of the
           error-free postreplication repair pathway
          Length = 139

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 69/142 (48%), Gaps = 24/142 (16%)

Query: 1   MSRIIKEYNHIRKLNALPDNMTTLHPVSN----ATSD---LSNWHSIILGPKDSPYHNKS 53
           MS++ + +   R L  L      L P S     A +D   ++ W+  ILGP  S + N+ 
Sbjct: 1   MSKVPRSF---RLLEELEKGEKGLGPESCSYGLADADDITMTRWNGTILGPPHSNHENRI 57

Query: 54  FLLEIHIPTEYPSIPPVIKF-NKNSIPPHCNVNFTTGEI---CLNILKNENWSPVWNLLY 109
           + + I    +YP  PP I F +K ++P  C V+ +TGE+     N LK+      W  LY
Sbjct: 58  YSVSIECGPKYPDEPPTITFISKINLP--C-VDQSTGEVNKEKFNTLKD------WKRLY 108

Query: 110 SVQAIIQLLAYPDPSSPLNIDL 131
           +++ I+ L    + +SP N  L
Sbjct: 109 NMETIL-LDLRKEMASPANKKL 129

>KLTH0C06688g Chr3 complement(581697..582437) [741 bp, 246 aa] {ON}
           similar to uniprot|P33296 Saccharomyces cerevisiae
           YER100W UBC6 Ubiquitin-conjugating enzyme involved in
           ER- associated protein degradation located at the
           cytosolic side of the ER membrane tail region contains a
           transmembrane segment at the C-terminus substrate of the
           ubiquitin-proteasome pathway
          Length = 246

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/85 (24%), Positives = 40/85 (47%), Gaps = 7/85 (8%)

Query: 36  NWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNI 95
            WH +I GP D+PY    +   +  P++YP  PP I+     + P       T  +CL++
Sbjct: 36  EWHYVITGPPDTPYEGGQYHGTLVFPSDYPFKPPAIRM----VTPSGRFKEDT-RLCLSM 90

Query: 96  LKN--ENWSPVWNLLYSVQAIIQLL 118
                + W+P W++   +  ++  +
Sbjct: 91  SDYHPDTWNPSWSVSTILTGLLSFM 115

>Suva_7.182 Chr7 complement(339292..339694,339786..339796) [414 bp,
           137 aa] {ON} YGL087C (REAL)
          Length = 137

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 45/89 (50%), Gaps = 4/89 (4%)

Query: 34  LSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKF-NKNSIPPHCNVNFTTGEIC 92
           ++ W+  ILGP  S + N+ + L I     YP  PP + F +K ++P  C VN TTGEI 
Sbjct: 38  MTKWNGTILGPPHSNHENRIYSLSIECGPNYPDSPPKVTFISKINLP--C-VNQTTGEIQ 94

Query: 93  LNILKNENWSPVWNLLYSVQAIIQLLAYP 121
            +     +W   + +   +  + + +A P
Sbjct: 95  TDFHTLRDWKRAYTMETLLLDLRKEMATP 123

>NCAS0A14390 Chr1 (2833944..2834666) [723 bp, 240 aa] {ON} Anc_7.392
           YER100W
          Length = 240

 Score = 42.0 bits (97), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 52/113 (46%), Gaps = 9/113 (7%)

Query: 37  WHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNIL 96
           WH II GP D+PY    +   +  P++YP  PP I+     I P+      T  +CL++ 
Sbjct: 37  WHYIITGPPDTPYVGGQYHGTLTFPSDYPFKPPAIRM----ITPNGRFKENT-RLCLSMS 91

Query: 97  KN--ENWSPVWNLLYSVQAIIQLLAYPDPSSP--LNIDLSRLLTLKDSKAYNS 145
               + W+P W++   +  ++  +   + ++      +  +    K+S  YN+
Sbjct: 92  DYHPDLWNPGWSVATILNGLLSFMTGDEATTGSITTTEFQKRTLAKNSIHYNT 144

>KLTH0H04796g Chr8 (428760..428770,428834..429239) [417 bp, 138 aa]
           {ON} highly similar to uniprot|P53152 Saccharomyces
           cerevisiae YGL087C MMS2 Protein involved in error-free
           postreplication DNA repair forms a heteromeric complex
           with Ubc13p that has a ubiquitin-conjugating activity
           cooperates with chromatin-associated RING finger
           proteins Rad18p and Rad5p
          Length = 138

 Score = 40.8 bits (94), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 62/125 (49%), Gaps = 21/125 (16%)

Query: 1   MSRIIKEYNHIRKLNALPDNMTTLHPVSN----ATSD---LSNWHSIILGPKDSPYHNKS 53
           MSR+ + +   R L  L      + P S     A SD   +++W+  ILGP  S + N+ 
Sbjct: 1   MSRVPRSF---RLLEELEKGEKGMGPESCSYGLAHSDDITMTHWNGTILGPPHSNHENRI 57

Query: 54  FLLEIHIPTEYPSIPPVIKF-NKNSIPPHCNVNFTTGEICLNILKNENWSPV--WNLLYS 110
           + + I     YP  PP I+F +K ++P  C V+  TGE+     K E +S +  W   Y+
Sbjct: 58  YSVAIECGEAYPDQPPKIRFLSKVNLP--C-VDQNTGEV-----KKEQFSTLRDWKRSYT 109

Query: 111 VQAII 115
           ++ ++
Sbjct: 110 METLL 114

>Ecym_2230 Chr2 (447891..447901,447985..448390) [417 bp, 138 aa]
           {ON} similar to Ashbya gossypii AFL064W 1-intron
          Length = 138

 Score = 40.8 bits (94), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 57/123 (46%), Gaps = 17/123 (13%)

Query: 1   MSRIIKEYNHIRKLNALPDNMTTLHPVSNATS-------DLSNWHSIILGPKDSPYHNKS 53
           MSR+ + +   R L  L      L P S +          ++ W+  ILGP  S + N+ 
Sbjct: 1   MSRVPRSF---RLLEELEKGEKGLGPESCSYGLANGEDITMTTWNGTILGPPHSNHENRI 57

Query: 54  FLLEIHIPTEYPSIPPVIKF-NKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQ 112
           + + I    EYP  PP +KF +K ++P  C V+  TGE+  N+         W   Y+++
Sbjct: 58  YSVVIKCGDEYPDKPPTVKFISKINLP--C-VDQATGEVETNMFHTLR---DWKRSYTME 111

Query: 113 AII 115
            ++
Sbjct: 112 TLL 114

>ZYRO0G19910g Chr7 (1650667..1651206) [540 bp, 179 aa] {ON} similar
           to uniprot|P52491 Saccharomyces cerevisiae YLR306W UBC12
           Enzyme that mediates the conjugation of Rub1p a
           ubiquitin-like protein to other proteins related to E2
           ubiquitin-conjugating enzymes
          Length = 179

 Score = 41.2 bits (95), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 48/107 (44%), Gaps = 5/107 (4%)

Query: 22  TTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPH 81
           T LH V   T D      + + P +  Y   +F  E+    +YP  PP +K       P+
Sbjct: 40  TQLHIVR-GTDDSIPLLQLAVKPDEGYYKGGNFTFELLFNEQYPMEPPKVKCLNRIYHPN 98

Query: 82  CNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYPDPSSPLN 128
            +   T G +CLNIL+ ++W+P  +L   +  ++ L        PLN
Sbjct: 99  ID---TDGRVCLNILR-QDWTPALDLQSVIIGLLFLFLEISGVDPLN 141

>KAFR0C02140 Chr3 complement(427907..428312,428412..428422) [417 bp,
           138 aa] {ON} Anc_6.187 YGL087C
          Length = 138

 Score = 40.4 bits (93), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 61/126 (48%), Gaps = 23/126 (18%)

Query: 1   MSRIIKEYNHIRKLNALPDNMTTLHPVSN----ATSD---LSNWHSIILGPKDSPYHNKS 53
           MS+I + +   R L  L        P S     A SD   ++NW+  ILGP  S + N+ 
Sbjct: 1   MSKIPRSF---RLLEELEKGEKGFGPESCSYGLADSDDITMTNWNGTILGPPHSNHENRI 57

Query: 54  FLLEIHIPTEYPSIPPVIKF-NKNSIPPHCNVNFTTGEIC---LNILKNENWSPVWNLLY 109
           + LEI     YP  PP +KF +K ++P  C ++  TGEI     + L++      W   Y
Sbjct: 58  YSLEIVCGPNYPDEPPKVKFVSKVNLP--C-IDDKTGEIKEKEFHTLRD------WKRSY 108

Query: 110 SVQAII 115
           ++Q ++
Sbjct: 109 TMQTVL 114

>KNAG0B02360 Chr2 complement(462478..463233) [756 bp, 251 aa] {ON}
           Anc_7.392 YER100W
          Length = 251

 Score = 41.2 bits (95), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/84 (28%), Positives = 42/84 (50%), Gaps = 9/84 (10%)

Query: 36  NWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNI 95
            WH +I GP ++PY    +   +  P++YP  PP I+     + P+      T  +CL++
Sbjct: 36  EWHYVITGPPETPYEGGQYHGTLTFPSDYPYKPPAIRM----VTPNGRFKENT-RLCLSM 90

Query: 96  LKNENWSP-VWNLLYSVQAIIQLL 118
               ++ P +WN  +SV  I+  L
Sbjct: 91  ---SDYHPDLWNPGWSVSTILTGL 111

>Skud_7.195 Chr7 complement(349627..349929) [303 bp, 100 aa] {ON}
           YGL087C (REAL)
          Length = 100

 Score = 39.3 bits (90), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 45/89 (50%), Gaps = 4/89 (4%)

Query: 34  LSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKF-NKNSIPPHCNVNFTTGEIC 92
           ++ W+  ILGP  S + N+ + L I     YP  PP + F +K ++P  C V+ TTGE+ 
Sbjct: 1   MTKWNGTILGPPHSNHENRIYSLSIECGPNYPDSPPNVTFISKINLP--C-VSQTTGEVQ 57

Query: 93  LNILKNENWSPVWNLLYSVQAIIQLLAYP 121
            N     +W   + +   +  + + +A P
Sbjct: 58  TNFHTLRDWKRAYTMETLLLDLRKEMATP 86

>Smik_7.196 Chr7 complement(340809..341111) [303 bp, 100 aa] {ON}
           YGL087C (REAL)
          Length = 100

 Score = 38.9 bits (89), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 44/89 (49%), Gaps = 4/89 (4%)

Query: 34  LSNWHSIILGPKDSPYHNKSFLLEIHIPTEYPSIPPVIKF-NKNSIPPHCNVNFTTGEIC 92
           ++ W+  ILGP  S + N+ + L I     YP  PP + F +K ++P  C VN TTGE+ 
Sbjct: 1   MTKWNGTILGPPHSNHENRIYSLSIECGPNYPDSPPKVTFISKINLP--C-VNPTTGEVQ 57

Query: 93  LNILKNENWSPVWNLLYSVQAIIQLLAYP 121
            +      W   + +   +  + + +A P
Sbjct: 58  TDFHTLRGWKRAYTMETLLLDLRKEMATP 86

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 21,505,186
Number of extensions: 1012293
Number of successful extensions: 3429
Number of sequences better than 10.0: 284
Number of HSP's gapped: 3115
Number of HSP's successfully gapped: 284
Length of query: 165
Length of database: 53,481,399
Length adjustment: 101
Effective length of query: 64
Effective length of database: 41,900,133
Effective search space: 2681608512
Effective search space used: 2681608512
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 61 (28.1 bits)