Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0C044903.493ON1861869071e-126
Kpol_1017.63.493ON1871514762e-60
ZYRO0D09966g3.493ON1781514586e-58
TPHA0D032803.493ON1841514501e-56
TDEL0D056103.493ON1751734403e-55
SAKL0F02750g3.493ON1701434143e-51
YPR149W (NCE102)3.493ON1731684049e-50
TBLA0D029603.493ON1891514051e-49
Skud_16.4443.493ON1731684012e-49
Smik_16.4023.493ON1731683952e-48
NDAI0B058803.493ON1821683944e-48
CAGL0L08448g3.493ON1731563849e-47
NCAS0F035603.493ON1831693832e-46
CAGL0I10494g3.493ON1721593762e-45
KAFR0C019703.493ON1791733762e-45
YGR131W (FHN1)3.493ON1741713711e-44
KNAG0B008003.493ON1821533684e-44
Suva_7.4193.493ON1741493604e-43
KNAG0A079503.493ON1821693581e-42
NDAI0G009303.493ON1761693572e-42
Suva_16.4783.493ON1661683562e-42
Smik_6.2273.493ON1741233432e-40
NCAS0E008003.493ON1741563371e-39
KLLA0D16280g3.493ON1691583241e-37
KLTH0F14850g3.493ON1711233222e-37
AFR312W3.493ON1681233144e-36
Skud_7.4423.493ON1741723066e-35
KAFR0G037003.493ON1861233041e-34
Kwal_55.212383.493ON1701572997e-34
Ecym_12363.493ON1691542597e-28
ACL138C5.119ON45566701.2
Kwal_34.159318.777ON139849655.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0C04490
         (186 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3....   353   e-126
Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}...   187   2e-60
ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly ...   181   6e-58
TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.49...   177   1e-56
TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3....   174   3e-55
SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {O...   164   3e-51
YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Prot...   160   9e-50
TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON...   160   1e-49
Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W...   159   2e-49
Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W...   156   2e-48
NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3....   156   4e-48
CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {...   152   9e-47
NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.49...   152   2e-46
CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa] ...   149   2e-45
KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.49...   149   2e-45
YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein...   147   1e-44
KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON...   146   4e-44
Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W (...   143   4e-43
KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3....   142   1e-42
NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON...   142   2e-42
Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W...   141   2e-42
Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W (...   136   2e-40
NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON...   134   1e-39
KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} simil...   129   1e-37
KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} simil...   128   2e-37
AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic h...   125   4e-36
Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W (...   122   6e-35
KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.49...   121   1e-34
Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W...   119   7e-34
Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON} ...   104   7e-28
ACL138C Chr3 complement(109749..111116) [1368 bp, 455 aa] {ON} S...    32   1.2  
Kwal_34.15931 s34 complement(120919..125115) [4197 bp, 1398 aa] ...    30   5.4  

>TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  353 bits (907), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 173/186 (93%), Positives = 173/186 (93%)

Query: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60
           MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA
Sbjct: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60

Query: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120
           NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR
Sbjct: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120

Query: 121 LAQXXXXXXXXXXXXXLVQLVKSSLLMWENGLFKPEERGGASFRNSRRRLATQQNSAMRR 180
           LAQ             LVQLVKSSLLMWENGLFKPEERGGASFRNSRRRLATQQNSAMRR
Sbjct: 121 LAQASIAFYYFSFFIYLVQLVKSSLLMWENGLFKPEERGGASFRNSRRRLATQQNSAMRR 180

Query: 181 RAFQQI 186
           RAFQQI
Sbjct: 181 RAFQQI 186

>Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}
           complement(22157..22720) [564 nt, 188 aa]
          Length = 187

 Score =  187 bits (476), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 90/151 (59%), Positives = 110/151 (72%), Gaps = 1/151 (0%)

Query: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60
           MLS   N++R INFCF VI  G+IG L+ +EK  HS RVNYCMF  PFA+VTDSFY I A
Sbjct: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEKG-HSSRVNYCMFVPPFAVVTDSFYGILA 59

Query: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120
           N W +PFAWPI+L++FDFLNF FTFTAGTVLSVGIRTHSC N++Y+ +NKI QGST+RCR
Sbjct: 60  NIWTTPFAWPIILFAFDFLNFAFTFTAGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCR 119

Query: 121 LAQXXXXXXXXXXXXXLVQLVKSSLLMWENG 151
            AQ              V++V S++ +  NG
Sbjct: 120 KAQASIAFFYFSFFIFFVKVVMSAINLLSNG 150

>ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 178

 Score =  181 bits (458), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 87/151 (57%), Positives = 107/151 (70%), Gaps = 1/151 (0%)

Query: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60
           ML+ T N+LR +NFCF VI+ G++GKLI+SEK  H+ RVN+CMFAA F +V DSFY I A
Sbjct: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60

Query: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120
           N +  PFA+P++L+  DFLNF FTFTA T L+VGIRTHSC N+HYL SNKITQGST RCR
Sbjct: 61  NIFV-PFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCR 119

Query: 121 LAQXXXXXXXXXXXXXLVQLVKSSLLMWENG 151
            AQ             L ++V S L +  NG
Sbjct: 120 EAQAVVAFFYFAFFIFLFKMVMSFLSLLSNG 150

>TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.493
           YPR149W
          Length = 184

 Score =  177 bits (450), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 84/151 (55%), Positives = 105/151 (69%), Gaps = 1/151 (0%)

Query: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60
           ML    N+LR +NFCF VI  G++G L+ ++ + HS RVNYC+F  PFALVTD+FY   A
Sbjct: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQ-HSSRVNYCIFVPPFALVTDTFYGALA 59

Query: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120
           N W +P AWPI+L+ FDFLNF FTFTAGTVL+VG RTHSC N+ YL SN ITQGST+RCR
Sbjct: 60  NIWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCR 119

Query: 121 LAQXXXXXXXXXXXXXLVQLVKSSLLMWENG 151
            AQ             L +L+ SS+ ++ NG
Sbjct: 120 KAQAATAFFYFSFFIFLAKLIMSSINLFTNG 150

>TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3.493
           YPR149W
          Length = 175

 Score =  174 bits (440), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 112/173 (64%), Gaps = 7/173 (4%)

Query: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60
           ML+   N LR++NF FLVI+ G++G+LI SE   HS RVN+CMFAA F +VTDSFY I A
Sbjct: 1   MLAIVDNALRLVNFAFLVILLGLVGELISSED-GHSSRVNFCMFAAAFGIVTDSFYGILA 59

Query: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120
           N W   FAWP++L++ DFLNF FTF+A T L+VGIRTHSC N+ YL SN ITQGST+RCR
Sbjct: 60  NIWE-VFAWPVILFALDFLNFAFTFSAATALAVGIRTHSCKNQDYLDSNNITQGSTQRCR 118

Query: 121 LAQXXXXXXXXXXXXXLVQLVKSSLLMWENGLFKPEERGGASFRNSRRRLATQ 173
           LAQ             L +++ S + +  NG F            SRRR + Q
Sbjct: 119 LAQASVAFFYFSFFIFLAKMIMSLIGIITNGPFSSRTT-----LTSRRRKSAQ 166

>SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {ON}
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 170

 Score =  164 bits (414), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 101/143 (70%), Gaps = 2/143 (1%)

Query: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60
           MLS   N LR++NF FLVII G+ G LI ++   HSPRVN+ +F A FALVTDSFYA+ A
Sbjct: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDE-HSPRVNFAIFTAAFALVTDSFYAVFA 59

Query: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120
           N + S FAWPILL ++DFLNF FTF+A T L+VGIRTHSC N+ YLFSN ITQGST+RCR
Sbjct: 60  NLF-SAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCR 118

Query: 121 LAQXXXXXXXXXXXXXLVQLVKS 143
            AQ             L +LV S
Sbjct: 119 KAQATVAFLYFSFFIFLTKLVLS 141

>YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Protein
           of unknown function; contains transmembrane domains;
           involved in secretion of proteins that lack classical
           secretory signal sequences; component of the
           detergent-insoluble glycolipid-enriched complexes (DIGs)
          Length = 173

 Score =  160 bits (404), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 103/168 (61%), Gaps = 7/168 (4%)

Query: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60
           ML+   N+LRIINF FLVI  G+I  L+ ++ R HS RVNYCMFA  + + TDS Y + A
Sbjct: 1   MLALADNILRIINFLFLVISIGLISSLLNTQHR-HSSRVNYCMFACAYGIFTDSLYGVFA 59

Query: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120
           NF   P AWP++L++ DFLNF FTFTAGTVL+VGIR HSC N  Y+ SNKITQGS  RCR
Sbjct: 60  NFIE-PLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCR 118

Query: 121 LAQXXXXXXXXXXXXXLVQLVKSSLLMWENGLFKPEERGGASFRNSRR 168
            AQ             L + + S   M  NG F     G  SF   RR
Sbjct: 119 QAQAAVAFLYFSCAIFLAKTLMSVFNMISNGAF-----GSGSFSKRRR 161

>TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON}
           Anc_3.493 YPR149W
          Length = 189

 Score =  160 bits (405), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 81/151 (53%), Positives = 96/151 (63%)

Query: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60
           ML    NV RI NFCF VI  GMIG L+ +E   HS RVNYCMF   + LV+DSFY I A
Sbjct: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60

Query: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120
           N  P PFA+P +L++FDFLNF FTFTAGTVL+VGIRTHSC NK Y   N I QGS  RCR
Sbjct: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120

Query: 121 LAQXXXXXXXXXXXXXLVQLVKSSLLMWENG 151
            AQ             LV+++ + +  +  G
Sbjct: 121 EAQACIAFFYFSMFLFLVKVLITLVTYFTGG 151

>Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  159 bits (401), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 106/168 (63%), Gaps = 7/168 (4%)

Query: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60
           ML+   N+LRIINF FLVI+ G+I  L+ ++ R +S RVN+CMFAA + + TDS Y + A
Sbjct: 1   MLAPADNILRIINFLFLVIVIGLISSLLNTQDR-NSSRVNFCMFAAAYGIFTDSLYGVFA 59

Query: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120
           NF+  P AWP++L++ DFLNF FTFTAGTVL+VGIR HSC N+ Y+ SN ITQGS  RCR
Sbjct: 60  NFFE-PLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNRSYVDSNGITQGSGTRCR 118

Query: 121 LAQXXXXXXXXXXXXXLVQLVKSSLLMWENGLFKPEERGGASFRNSRR 168
            AQ             L + + S   M  NG F     G  SF   RR
Sbjct: 119 QAQAAVAFLYFSCAIFLAKTLMSVFNMISNGAF-----GSGSFSKRRR 161

>Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  156 bits (395), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 102/168 (60%), Gaps = 7/168 (4%)

Query: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60
           ML+   N+LRIINF FLVI   +I  L+ ++ + HS RVNYCMFA  + + TDS Y + A
Sbjct: 1   MLALADNILRIINFLFLVISIALISSLLNTQDK-HSSRVNYCMFACAYGIFTDSLYGVFA 59

Query: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120
           NF   P AWP++L++ DFLNF FTFTAGTVL+VGIR HSC N  Y+ SNKITQGS  RCR
Sbjct: 60  NFIE-PLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCR 118

Query: 121 LAQXXXXXXXXXXXXXLVQLVKSSLLMWENGLFKPEERGGASFRNSRR 168
            AQ             L + + S   M  NG F     G  SF   RR
Sbjct: 119 QAQAAVAFLYFSCAIFLAKTLMSIFNMISNGAF-----GSGSFSKRRR 161

>NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3.493
           YGR131W
          Length = 182

 Score =  156 bits (394), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 107/168 (63%), Gaps = 3/168 (1%)

Query: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60
           MLS+  N+LR+IN  FLV+    I  L+ ++ R +S R+N+CMFAA F L+TDSF+ +  
Sbjct: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQ-RNNSSRINFCMFAAAFGLLTDSFFGVAF 59

Query: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120
           N + +  +WPILL+ FDFLNF FTFTAGTVL+V IR HSC N+ Y+ SN ITQGS  RCR
Sbjct: 60  NMFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCR 119

Query: 121 LAQXXXXXXXXXXXXXLVQLVKSSLLMWENGLFKPEERGGASFRNSRR 168
           ++Q             L +++ S + M  NGLF      G+  R+ RR
Sbjct: 120 MSQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGS--RSKRR 165

>CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {ON}
           highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 173

 Score =  152 bits (384), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 76/156 (48%), Positives = 99/156 (63%), Gaps = 2/156 (1%)

Query: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60
           ML+ T N+LRI+NF F+VI  G+I  LI +  R HS RVNYCMFAA + + TDS Y + A
Sbjct: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDR-HSSRVNYCMFAAAYGIATDSLYGVFA 59

Query: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120
           NF+    AWP++L++ DFLNF F  TAG VL+VGIR HSC N HY  +NKI QGS  RCR
Sbjct: 60  NFFE-ILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCR 118

Query: 121 LAQXXXXXXXXXXXXXLVQLVKSSLLMWENGLFKPE 156
            +Q             L +++ S L ++ NG F  +
Sbjct: 119 ESQAAVAFFFFSMAIFLAKMIMSLLNIFSNGAFGTK 154

>NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.493
           YGR131W
          Length = 183

 Score =  152 bits (383), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 81/169 (47%), Positives = 103/169 (60%), Gaps = 6/169 (3%)

Query: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60
           MLS+  N LR  N  FLV+    I  L+ ++    S RVNYCMFAA F L+TDSF+ + A
Sbjct: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHG-SSRVNYCMFAAAFGLLTDSFFGMAA 59

Query: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120
           N      +WPI+L+ FDFLNF FTFTAGTVL+VGIR HSC N+ YL SNKI QGS  RCR
Sbjct: 60  NLIDFLSSWPIILFVFDFLNFVFTFTAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRCR 119

Query: 121 LAQXXXXXXXXXXXXXLVQLVKSSLLMWENGLFKPEERGGASFRNSRRR 169
           ++Q             L +++ S++ M  NG F     G  SF + R+R
Sbjct: 120 VSQAAVAFFYFAAFVFLAKMIMSAISMASNGAF-----GSGSFMSRRKR 163

>CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa]
           {ON} highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w NCE2 or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 172

 Score =  149 bits (376), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 79/159 (49%), Positives = 99/159 (62%), Gaps = 3/159 (1%)

Query: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60
           MLS   N+LRI+N  FL+I  G+   LI + KR HS RVN+C+FAA + + TDS Y I A
Sbjct: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKR-HSSRVNFCLFAAAYGIATDSLYGIFA 59

Query: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLF-SNKITQGSTERC 119
           NF+  P AWP++L+  DFLNF FTFTAGTVL+VGIR HSC NK YL    KI QGS  RC
Sbjct: 60  NFFE-PLAWPLVLFVLDFLNFVFTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRC 118

Query: 120 RLAQXXXXXXXXXXXXXLVQLVKSSLLMWENGLFKPEER 158
           R AQ             L +++ S + +  NG F  + R
Sbjct: 119 RQAQALVAFFYFSMAIFLAKMIMSIVSVVSNGAFGAKLR 157

>KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.493
           YPR149W
          Length = 179

 Score =  149 bits (376), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 76/173 (43%), Positives = 104/173 (60%), Gaps = 4/173 (2%)

Query: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60
           ML    N+LR+IN  FL+I   +   LI ++   H+ RVNYCMFA  F L  DS Y I A
Sbjct: 1   MLGVADNILRLINAVFLIIAIALTSALINTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60

Query: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120
           NF+    AWP+LL++ DFLNF FTF+A T L+VGIR HSC N+ YL SNKI +GS +RCR
Sbjct: 61  NFFQ-VLAWPLLLFTLDFLNFAFTFSAATALAVGIRAHSCGNQSYLDSNKIVRGSGQRCR 119

Query: 121 LAQXXXXXXXXXXXXXLVQLVKSSLLMWENGLFKPEERGGASFRNSRRRLATQ 173
            AQ             + +++ S + +++NG F     G + F + R++ AT 
Sbjct: 120 EAQALVAFLYFSTAIFIAKMIMSCINLFQNGAFSS---GSSRFISRRKKHATD 169

>YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein of
           unknown function; induced by ketoconazole; promoter
           region contains sterol regulatory element motif, which
           has been identified as a Upc2p-binding site;
           overexpression complements function of Nce102p in NCE102
           deletion strain
          Length = 174

 Score =  147 bits (371), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 103/171 (60%), Gaps = 4/171 (2%)

Query: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60
           MLS   N++RIIN  FL+I  G+I  LI ++ + HS RVN+CMFAA + LVTDS Y   A
Sbjct: 1   MLSAADNLVRIINAVFLIISIGLISGLIGTQTK-HSSRVNFCMFAAVYGLVTDSLYGFLA 59

Query: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120
           NFW S   +P +L   DFLNF FTF A T L+VGIR HSC NK YL  NKI QGS+ RC 
Sbjct: 60  NFWTS-LTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCH 118

Query: 121 LAQXXXXXXXXXXXXXLVQLVKSSLLMWENGLFKPEERGGASFRNSRRRLA 171
            +Q             L+++  +++ M +NG F      G S R +RR++ 
Sbjct: 119 QSQAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNT--GFSRRRARRQMG 167

>KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON}
           Anc_3.493 YPR149W
          Length = 182

 Score =  146 bits (368), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 73/153 (47%), Positives = 93/153 (60%), Gaps = 2/153 (1%)

Query: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60
           ML    N+LR++NFCFLVI    I  LI ++K  H  RVNYCMFAA + + TD  Y + A
Sbjct: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKF-HISRVNYCMFAAAYGIATDGLYGLLA 59

Query: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120
           NFW  P AWP++L++ DFLNF FT TAG VL+VGIR HSC N  Y   N I QGS  RCR
Sbjct: 60  NFW-EPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCR 118

Query: 121 LAQXXXXXXXXXXXXXLVQLVKSSLLMWENGLF 153
           ++Q             + ++V S + +  NG F
Sbjct: 119 ISQAATAFFFFSMGIFIAKMVMSGINLASNGAF 151

>Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  143 bits (360), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 73/149 (48%), Positives = 95/149 (63%), Gaps = 2/149 (1%)

Query: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60
           MLS   N++RIIN  FL+I  G++  LI S+ + HS RVN+CMFAA + L+TDSFY   A
Sbjct: 1   MLSVADNIVRIINAIFLIISIGLVSGLISSQTK-HSSRVNFCMFAAAYGLLTDSFYGCLA 59

Query: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120
           N W S   +P++++  DFLNF FTF AGT L+VGIR HSC NK YL +NKITQGS  RC 
Sbjct: 60  NLWSS-LTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCH 118

Query: 121 LAQXXXXXXXXXXXXXLVQLVKSSLLMWE 149
            A+             L+++V S   M +
Sbjct: 119 QAKAAVVFFYFSCILFLIKVVVSIAAMVQ 147

>KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3.493
           YPR149W
          Length = 182

 Score =  142 bits (358), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 76/169 (44%), Positives = 98/169 (57%), Gaps = 2/169 (1%)

Query: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60
           ML+     LR++NF FLVI  G+I  L+ ++   HS R+NYCMF A + + TDSFY + A
Sbjct: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQ-HGHSSRINYCMFTAAYGITTDSFYGVVA 59

Query: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120
           NFW  P +WP+LL + DFLNF FT TAG VL+VGIR HSC N  Y   NKI QGS  RCR
Sbjct: 60  NFW-EPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCR 118

Query: 121 LAQXXXXXXXXXXXXXLVQLVKSSLLMWENGLFKPEERGGASFRNSRRR 169
            AQ             L + + S + ++ NG F          R S+R+
Sbjct: 119 QAQAAVAFFFFSMAIFLAKFIMSLVNIFTNGPFGSAGSSPMGSRFSKRK 167

>NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON}
           Anc_3.493 YGR131W
          Length = 176

 Score =  142 bits (357), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 106/169 (62%), Gaps = 8/169 (4%)

Query: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60
           MLS   N+LR++N  FLVI  G+   L+ +++  H+ R+NYCMF   + L+TDSF+ I A
Sbjct: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQ-GHNSRINYCMFTCVYCLLTDSFFGILA 59

Query: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120
           NF+    ++P +L++ DFLNF+FTF AGTVL+ GIR+HSC N+ YL  NKITQGS  RCR
Sbjct: 60  NFFE-FLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCR 118

Query: 121 LAQXXXXXXXXXXXXXLVQLVKSSLLMWENGLFKPEERGGASFRNSRRR 169
            +Q             L++L  S++ M +NG F        +F + RRR
Sbjct: 119 ESQALVAFFYFSMFIFLIKLAMSTISMIQNGAFSN------TFTSRRRR 161

>Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W
           (REAL)
          Length = 166

 Score =  141 bits (356), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 80/168 (47%), Positives = 98/168 (58%), Gaps = 14/168 (8%)

Query: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60
           ML+   N+LRIINF FLVI  G+I  L+ ++   +S R+NYCMFA  +A+VTDS Y + A
Sbjct: 1   MLAPVDNILRIINFLFLVISIGLISSLLNTQS-GNSSRINYCMFAVAYAIVTDSLYGVFA 59

Query: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120
           NF+  P AWP++L+S DFLNF FTFTA       IR HSC N+ YL SN ITQGS  RCR
Sbjct: 60  NFFE-PLAWPLILFSLDFLNFVFTFTA-------IRAHSCRNQTYLASNSITQGSGNRCR 111

Query: 121 LAQXXXXXXXXXXXXXLVQLVKSSLLMWENGLFKPEERGGASFRNSRR 168
            AQ             L + + S   M  NG F     G  SF   RR
Sbjct: 112 EAQAAVAFLYFSCAIFLAKTLMSVFNMISNGAF-----GSGSFSKRRR 154

>Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  136 bits (343), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 82/123 (66%), Gaps = 2/123 (1%)

Query: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60
           MLS   N++RIIN  FL+I  G+I  LI ++ + HS RVN+CMF A + LVTDS Y   A
Sbjct: 1   MLSAADNLIRIINAVFLIISIGLISGLISTQAK-HSSRVNFCMFTAAYGLVTDSLYGFLA 59

Query: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120
           NFW S   +P +L + D LNF FTF A T L+VGIR HSC NK YL  NKITQ S+ RC 
Sbjct: 60  NFWSS-LTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCH 118

Query: 121 LAQ 123
            +Q
Sbjct: 119 QSQ 121

>NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON}
           Anc_3.493 YGR131W
          Length = 174

 Score =  134 bits (337), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 71/156 (45%), Positives = 92/156 (58%), Gaps = 2/156 (1%)

Query: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60
           ML    N+LRI+N  FLVI  G+   L+ ++   +S R+NYCMF   + L TDS Y I A
Sbjct: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTHNNS-RINYCMFTCAYCLTTDSIYGIFA 59

Query: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120
           NF+    A P L +  DFLNF FTF AGTVL+ GIR HSC ++HY+ SNKITQG   RCR
Sbjct: 60  NFFD-ILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCR 118

Query: 121 LAQXXXXXXXXXXXXXLVQLVKSSLLMWENGLFKPE 156
            +Q             L +L+ S++ M +NG F   
Sbjct: 119 ESQALVAFFYFSMAIFLAKLIMSTINMIQNGAFTQH 154

>KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 169

 Score =  129 bits (324), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 92/158 (58%), Gaps = 2/158 (1%)

Query: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60
           MLS   N LR +NF FL+I+ G++G LI ++    S RVN+ +FAA F +V DS YA+ A
Sbjct: 1   MLSILDNSLRGVNFVFLIIVLGLVGNLIATQDHS-SSRVNFAIFAAVFGIVFDSLYALIA 59

Query: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120
           NF  S  AWPI+L S DFLN+ FTF+A T L+VGIR  SC N  +   NKI +GS +RCR
Sbjct: 60  NF-ISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCR 118

Query: 121 LAQXXXXXXXXXXXXXLVQLVKSSLLMWENGLFKPEER 158
            AQ             LV+ + S +    +G F     
Sbjct: 119 KAQASTVFLYFSFAIFLVKFILSIVNAITSGAFGTSSN 156

>KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 171

 Score =  128 bits (322), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 72/123 (58%), Positives = 87/123 (70%), Gaps = 1/123 (0%)

Query: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60
           MLS   N LR +NF FLVII G+ G L  + K  ++P+VN+ +F A F L+ DS YAIPA
Sbjct: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60

Query: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120
           NF  S  AWP+L+  FDFLNF FTF A T L+V IRTHSC N+ YL SN +TQGST+RCR
Sbjct: 61  NF-VSALAWPLLIAVFDFLNFVFTFAAATALAVAIRTHSCTNQDYLDSNTVTQGSTDRCR 119

Query: 121 LAQ 123
            AQ
Sbjct: 120 KAQ 122

>AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR149W (NCE102) and
           YGR131W
          Length = 168

 Score =  125 bits (314), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 80/123 (65%), Gaps = 2/123 (1%)

Query: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60
           MLS   N LR +NF FL+I+ G+ G LI  ++  HS RVN+ +F A FALVTDSFY+I A
Sbjct: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSHS-RVNFGLFTAVFALVTDSFYSIVA 59

Query: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120
           NF  S FAWPI+  + D LN  FTF A T L   I  HSC N+ +L  N I++ ST+RCR
Sbjct: 60  NFI-SAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCR 118

Query: 121 LAQ 123
             Q
Sbjct: 119 KVQ 121

>Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  122 bits (306), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 100/172 (58%), Gaps = 4/172 (2%)

Query: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60
           MLS   N++RI++  FL+I  G+IG L+ ++    S RVN+CMFAA + L+TDSFY   A
Sbjct: 1   MLSAADNLIRIVSAVFLIISIGLIGGLMGTQTNG-SSRVNFCMFAAAYGLITDSFYGFLA 59

Query: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120
           NFW S   +P +L   DFLNF FTF A T L+VGIR HSC NK YL  N ITQGS+ RC 
Sbjct: 60  NFWSS-LTYPAILLVLDFLNFLFTFAAATALAVGIRCHSCKNKTYLEQNNITQGSSSRCH 118

Query: 121 LAQXXXXXXXXXXXXXLVQLVKSSLLMWENGLFKPEERGGASFRNSRRRLAT 172
            +Q             L+++  S   M +NG F      G   R +RR++  
Sbjct: 119 QSQAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNT--GYGRRRARRQMGV 168

>KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  121 bits (304), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 88/123 (71%), Gaps = 1/123 (0%)

Query: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60
           ML+   N LR++NFCF+VI    I +L+ + +  +S RVNYCMFA  F ++TDS Y + A
Sbjct: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNTRQGHNSARVNYCMFAVAFGILTDSIYGLFA 60

Query: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120
           NF+    AWPI+L+ FDFLNF F FTAGTVL+VGIR H+C N+ Y  SNKI +GS  RCR
Sbjct: 61  NFFEQ-LAWPIILFVFDFLNFVFFFTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCR 119

Query: 121 LAQ 123
           +AQ
Sbjct: 120 VAQ 122

>Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W
           (NCE102) - Involved in secretion of proteins that lack
           classical secretory signal sequences [contig 130] FULL
          Length = 170

 Score =  119 bits (299), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 72/157 (45%), Positives = 96/157 (61%), Gaps = 2/157 (1%)

Query: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60
           MLS   N LR  NF FL+I+ G+ G L  + +  ++P+VN+ +FAA F L+ D+ YAIPA
Sbjct: 1   MLSILDNSLRAANFVFLLIVLGLTGSL-AATRDNNNPQVNFAVFAAAFGLLFDTLYAIPA 59

Query: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120
           NF  S  AWP+L+  FDFLNF FTF A T L+V IR HSC N  Y+ +NK+TQGS++RCR
Sbjct: 60  NFI-SALAWPLLIAVFDFLNFVFTFAAATALAVAIRVHSCTNSDYVDNNKVTQGSSDRCR 118

Query: 121 LAQXXXXXXXXXXXXXLVQLVKSSLLMWENGLFKPEE 157
            AQ             LV+L  S + ++  G F    
Sbjct: 119 KAQASVAFLYFAFFVFLVKLALSLVNVFSVGAFSTSS 155

>Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON}
           similar to Ashbya gossypii AFR312W
          Length = 169

 Score =  104 bits (259), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 66/154 (42%), Positives = 81/154 (52%), Gaps = 2/154 (1%)

Query: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60
           MLS   N LR  NF FL+I+  + G LI  + R HS RVN+ +F A FAL+ DS Y++ A
Sbjct: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSHS-RVNFGLFTAIFALLFDSLYSVLA 59

Query: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120
           NF  S  AWPILL + D LN  FTF A T L   I  HSC N  +L  N I++G   RCR
Sbjct: 60  NFI-SALAWPILLITTDVLNLIFTFAAATALGAAIGPHSCSNSGFLRGNDISEGREGRCR 118

Query: 121 LAQXXXXXXXXXXXXXLVQLVKSSLLMWENGLFK 154
             Q             L + V S L +   G F 
Sbjct: 119 KVQASSVFLFFSFFIFLAKAVLSGLNIVSTGAFS 152

>ACL138C Chr3 complement(109749..111116) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR212W
          Length = 455

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 27/66 (40%), Gaps = 7/66 (10%)

Query: 14  FCF-LVIITGMIGKLI------ESEKRPHSPRVNYCMFAAPFALVTDSFYAIPANFWPSP 66
           FCF  +I+ GM G L       E     HSP          F    D+  A P + WPS 
Sbjct: 124 FCFDHLILDGMSGALFWEDVLRELNSDDHSPAQADQDGVLYFGDGIDAMPAHPYSMWPSS 183

Query: 67  FAWPIL 72
            AW IL
Sbjct: 184 LAWKIL 189

>Kwal_34.15931 s34 complement(120919..125115) [4197 bp, 1398 aa] {ON}
            [contig 272] FULL
          Length = 1398

 Score = 29.6 bits (65), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 30/49 (61%), Gaps = 3/49 (6%)

Query: 137  LVQLVKSSLLMWENGLFKPEERGGASFRN---SRRRLATQQNSAMRRRA 182
            L+QL +S+L  +  G   PE++   +F +   S+++ A+++NS  R+ +
Sbjct: 1040 LIQLFQSNLTKFNEGFMDPEKKFDVNFESRPQSKKQAASKKNSERRKSS 1088

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.329    0.137    0.434 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 16,388,985
Number of extensions: 578658
Number of successful extensions: 1464
Number of sequences better than 10.0: 35
Number of HSP's gapped: 1427
Number of HSP's successfully gapped: 35
Length of query: 186
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 83
Effective length of database: 41,670,801
Effective search space: 3458676483
Effective search space used: 3458676483
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 62 (28.5 bits)