Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0C044803.492ON80277432010.0
Kpol_480.143.492ON6991232513e-21
Suva_7.4183.492ON8311172414e-20
Smik_6.2263.492ON8391022254e-18
YGR130C3.492ON8161172237e-18
Skud_7.4413.492ON8071082237e-18
CAGL0I10516g3.492ON8131342112e-16
TDEL0D056003.492ON700932022e-15
TPHA0D042503.492ON6291102012e-15
ZYRO0D09988g3.492ON994921987e-15
NCAS0E008103.492ON692941664e-11
NDAI0G009403.492ON656961664e-11
KNAG0B008103.492ON757971656e-11
KNAG0A079403.492ON275931533e-10
SAKL0F02772g3.492ON773961485e-09
KAFR0G036903.492ON3631011403e-08
Kwal_55.212293.492ON787961423e-08
KAFR0C019603.492ON5631011413e-08
KLTH0F14828g3.492ON836961388e-08
KLLA0D16236g3.492ON871961211e-05
AFR310C3.492ON6231441065e-04
Ecym_12373.492ON727991065e-04
NCAS0F035503.492ON44172930.017
NDAI0B058603.492ON68198840.19
Suva_15.3575.88ON1172174744.0
NDAI0B050501.278ON33577715.6
YHR155W (YSP1)1.100ON1228131717.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0C04480
         (802 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa] ...  1237   0.0  
Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON} (29882..3...   101   3e-21
Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON...    97   4e-20
Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON...    91   4e-18
YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON} C...    91   7e-18
Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON...    91   7e-18
CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} simi...    86   2e-16
TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa] ...    82   2e-15
TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {O...    82   2e-15
ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly...    81   7e-15
NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.4...    69   4e-11
NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.4...    69   4e-11
KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.4...    68   6e-11
KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {...    64   3e-10
SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} simila...    62   5e-09
KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {O...    59   3e-08
Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {...    59   3e-08
KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {O...    59   3e-08
KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]...    58   8e-08
KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]...    51   1e-05
AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}...    45   5e-04
Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar t...    45   5e-04
NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {O...    40   0.017
NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa] ...    37   0.19 
Suva_15.357 Chr15 complement(617637..618952,619001..621203) [351...    33   4.0  
NDAI0B05050 Chr2 complement(1235335..1236342) [1008 bp, 335 aa] ...    32   5.6  
YHR155W Chr8 (407103..410789) [3687 bp, 1228 aa] {ON}  YSP1Mitoc...    32   7.3  

>TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa]
           {ON} Anc_3.492 YGR130C
          Length = 802

 Score = 1237 bits (3201), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 642/774 (82%), Positives = 642/774 (82%)

Query: 29  GNTDSVEPSDVLQTAINSHTLHGKGKQYKSPFRDTQTPSNMNVALKKKNHRYPTISATSP 88
           GNTDSVEPSDVLQTAINSHTLHGKGKQYKSPFRDTQTPSNMNVALKKKNHRYPTISATSP
Sbjct: 29  GNTDSVEPSDVLQTAINSHTLHGKGKQYKSPFRDTQTPSNMNVALKKKNHRYPTISATSP 88

Query: 89  YSNMTPQDLGYKNIHPSTKRAKDIPFPVLLIENEIRQDKLFAQLTEKESQLDYLQKSQKL 148
           YSNMTPQDLGYKNIHPSTKRAKDIPFPVLLIENEIRQDKLFAQLTEKESQLDYLQKSQKL
Sbjct: 89  YSNMTPQDLGYKNIHPSTKRAKDIPFPVLLIENEIRQDKLFAQLTEKESQLDYLQKSQKL 148

Query: 149 IKVEPIGQRPVSKSKQKDSKLKTNTDKPKATKKTQSSISDKTSIAKLDAPKGKLKKEANT 208
           IKVEPIGQRPVSKSKQKDSKLKTNTDKPKATKKTQSSISDKTSIAKLDAPKGKLKKEANT
Sbjct: 149 IKVEPIGQRPVSKSKQKDSKLKTNTDKPKATKKTQSSISDKTSIAKLDAPKGKLKKEANT 208

Query: 209 EEKPDIGSESEPESSFVDAVSDQDITENLTRKSDGLAQSNVXXXXXXXXXXXXXXXXAQS 268
           EEKPDIGSESEPESSFVDAVSDQDITENLTRKSDGLAQSNV                AQS
Sbjct: 209 EEKPDIGSESEPESSFVDAVSDQDITENLTRKSDGLAQSNVQEDDQIDTEIEDDSQDAQS 268

Query: 269 WVPXXXXXXXXXXXXXXIGEKPMALDLAPKIHTEVVQVYGAXXXXXXXXXXXXXXXXXXX 328
           WVP              IGEKPMALDLAPKIHTEVVQVYGA                   
Sbjct: 269 WVPSDNVSVASSTSSSSIGEKPMALDLAPKIHTEVVQVYGATTSTNSKSNSNTREPTPSR 328

Query: 329 XXXXXXXVFKRNSNRDQYSNSPSNQRNVNSNLTNIKTSTLREMNNVINPKATPKNPELLV 388
                  VFKRNSNRDQYSNSPSNQRNVNSNLTNIKTSTLREMNNVINPKATPKNPELLV
Sbjct: 329 STSSFFTVFKRNSNRDQYSNSPSNQRNVNSNLTNIKTSTLREMNNVINPKATPKNPELLV 388

Query: 389 KTRYNNNSIILSKSVYDLVNYNIKVHNKRVKDYINDSNIKYKEKNEEFNNSINELDLKIK 448
           KTRYNNNSIILSKSVYDLVNYNIKVHNKRVKDYINDSNIKYKEKNEEFNNSINELDLKIK
Sbjct: 389 KTRYNNNSIILSKSVYDLVNYNIKVHNKRVKDYINDSNIKYKEKNEEFNNSINELDLKIK 448

Query: 449 SIEKDIIDYKAKIDSLMNDNVEKNDIDIENYHEKMLIKKNQIIKKNDEITYILQSSPPTA 508
           SIEKDIIDYKAKIDSLMNDNVEKNDIDIENYHEKMLIKKNQIIKKNDEITYILQSSPPTA
Sbjct: 449 SIEKDIIDYKAKIDSLMNDNVEKNDIDIENYHEKMLIKKNQIIKKNDEITYILQSSPPTA 508

Query: 509 AISLDTKDAVTKQSDCTPLIKDWKSEQSKLNEQIDSKVNVIKQLNKNLADVKQKITELSE 568
           AISLDTKDAVTKQSDCTPLIKDWKSEQSKLNEQIDSKVNVIKQLNKNLADVKQKITELSE
Sbjct: 509 AISLDTKDAVTKQSDCTPLIKDWKSEQSKLNEQIDSKVNVIKQLNKNLADVKQKITELSE 568

Query: 569 SAKPAPPLSPVKKLVXXXXXXXXXXXXXXXXXXXXXXXXXXXXIHSGSSRSTITINSNDE 628
           SAKPAPPLSPVKKLV                            IHSGSSRSTITINSNDE
Sbjct: 569 SAKPAPPLSPVKKLVSSPTTNTNTNVSSNAKATANTNTASNASIHSGSSRSTITINSNDE 628

Query: 629 LGGDLETAISTMDQPVVNSRQLNPSSSTPAPIPKTPINTELEKSIKLQVSNKLKIKESLK 688
           LGGDLETAISTMDQPVVNSRQLNPSSSTPAPIPKTPINTELEKSIKLQVSNKLKIKESLK
Sbjct: 629 LGGDLETAISTMDQPVVNSRQLNPSSSTPAPIPKTPINTELEKSIKLQVSNKLKIKESLK 688

Query: 689 NERLNLNTLISRLKDLTKNYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDDTNIRRG 748
           NERLNLNTLISRLKDLTKNY                                DDTNIRRG
Sbjct: 689 NERLNLNTLISRLKDLTKNYSVKLSSTLSSASSINSMPINSSSETSSLTELNDDTNIRRG 748

Query: 749 TAHSIAVKQLHRSTIPGKYQQLIKIXXXXXXXXXXXXXXXXNILLCTIGSQKKS 802
           TAHSIAVKQLHRSTIPGKYQQLIKI                NILLCTIGSQKKS
Sbjct: 749 TAHSIAVKQLHRSTIPGKYQQLIKIMVLPQLVYMLLQMMVMNILLCTIGSQKKS 802

>Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON}
           (29882..31981) [2100 nt, 700 aa]
          Length = 699

 Score =  101 bits (251), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 75/123 (60%), Gaps = 6/123 (4%)

Query: 55  QYKSPFRDTQTPSNM---NVALKKKNHRYPTISATSPYSNMTPQDLGYKNIHPSTKRAKD 111
           +Y SPFRD   PSN+   N A  KK  R+PT+SA+S +S M+P +LGYKNI  STKRAKD
Sbjct: 37  EYVSPFRD---PSNVQAANYAKAKKMERFPTVSASSHFSRMSPNELGYKNISKSTKRAKD 93

Query: 112 IPFPVLLIENEIRQDKLFAQLTEKESQLDYLQKSQKLIKVEPIGQRPVSKSKQKDSKLKT 171
           I FP  LI NE RQ  +   L  KE+ L YL+ SQ L+       +    S ++ S  +T
Sbjct: 94  ISFPSFLIANERRQGGIITDLELKEANLKYLRNSQILLNENGTSTQTKESSDEESSGDET 153

Query: 172 NTD 174
           +TD
Sbjct: 154 STD 156

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 102/203 (50%), Gaps = 22/203 (10%)

Query: 376 NPKATPKNPELLVKTRYNNNSIILSKSVYDLVNYNIKVHNKRVKDYINDSNIKYKEKNEE 435
           NP ++P+NPE ++KT+ +     LSK+VYD V Y+  VH + + +       KY+ K  E
Sbjct: 355 NPMSSPENPEYVIKTKQHG---YLSKAVYDKVQYDQSVHQRWLDNLETTEEEKYQNKKTE 411

Query: 436 FNNSINELDLKIKSIEKDIIDYKAKID---SLMNDNVEKNDIDIENYH---------EKM 483
           + +++ ++  KI +I   + + K K      +M   + KN +D+   H         E  
Sbjct: 412 YEDNLADIQSKIDNIHDLMDELKLKTSQKIEVMEYQLVKNILDMTQTHNDSKNKIFKETE 471

Query: 484 LIKKNQIIKKNDEITYILQSSPPTAAISLDTKDAVTKQSDCTPLIKDWKSEQSKLNEQID 543
           L+K  ++  K D I+         A I  + ++   +Q+  T    +W S+ +++  Q+D
Sbjct: 472 LMKLEKLNAKQDFIS-------KQAEIRKEIENLSEEQTGVTDDFNEWNSKLNEITAQLD 524

Query: 544 SKVNVIKQLNKNLADVKQKITEL 566
           +K+  I+  N+   D++Q++ +L
Sbjct: 525 AKIEDIRAKNQQKLDIEQEMAKL 547

>Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON}
           YGR130C (REAL)
          Length = 831

 Score = 97.4 bits (241), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 56/117 (47%), Positives = 69/117 (58%), Gaps = 7/117 (5%)

Query: 36  PSDVLQTAINSHTLHGKGKQ-YKSPFRDTQTPSNMNVAL---KKKNHRYPTISATSPYSN 91
           P   LQ  +++     KGK+ + SPFR      N N  L     KN ++PT+SATSPYS 
Sbjct: 33  PYQFLQKVVSNE---PKGKEDWVSPFRQDALSGNQNNRLYVHDAKNRKFPTVSATSPYSK 89

Query: 92  MTPQDLGYKNIHPSTKRAKDIPFPVLLIENEIRQDKLFAQLTEKESQLDYLQKSQKL 148
             PQDLGYKNI    KRAKDI FP  L +NE RQ +L  +L  KE  L YL+K QK+
Sbjct: 90  QQPQDLGYKNIPKDVKRAKDIKFPTYLTKNEERQYQLLTELELKEKHLKYLKKCQKI 146

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/197 (26%), Positives = 101/197 (51%), Gaps = 34/197 (17%)

Query: 375 INPKATPKNPELLVKTRYNNNSIILSKSVYDLVNYNIKVHN-------KRVKDYINDSNI 427
           +NP ATP+NPEL+VKT+ +     LSK+VYD +NY+ K+H         R K   +  N 
Sbjct: 410 LNPVATPENPELIVKTKEHG---YLSKAVYDKINYDEKIHQAWLVDLRAREKAKYDAKNT 466

Query: 428 KYKEKNEEFNNSINELDLKIKSIEKDI-----IDYKAKIDSLMNDNVEKND------IDI 476
           +YKEK ++  N I+E++  +K + ++      ++    +  +++ N E N+       D 
Sbjct: 467 EYKEKLQDLQNQIDEIENSMKQLREETSQKIEVNKNRLVKQIIDINTEHNNKKLMIFKDT 526

Query: 477 ENYHEKMLIKKNQIIKKNDEITYILQSSPPTAAISLDTKDAVTKQSDCTPLIKDWKSEQS 536
           EN  ++ L +KN+++ K                +  +  +  +++S+      DW +  S
Sbjct: 527 ENMKKQKLEEKNEVLNKQ-------------TNVKSEIDELNSEKSNVQKEFNDWTTNLS 573

Query: 537 KLNEQIDSKVNVIKQLN 553
            L++Q+D+++  I Q+N
Sbjct: 574 SLSQQLDAQIFKINQIN 590

>Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON}
           YGR130C (REAL)
          Length = 839

 Score = 91.3 bits (225), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 62/102 (60%), Gaps = 5/102 (4%)

Query: 52  KGKQ-YKSPFRDTQTPSNMN----VALKKKNHRYPTISATSPYSNMTPQDLGYKNIHPST 106
           KGK+ + SPFR     S  N         KN ++PT+SATS YS   P+DLGYKNI  + 
Sbjct: 48  KGKEEWISPFRQDALASKQNNNRLYVEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNA 107

Query: 107 KRAKDIPFPVLLIENEIRQDKLFAQLTEKESQLDYLQKSQKL 148
           KRAKDI FP  L +NE RQ +L  +L  KE  L YL+K QK+
Sbjct: 108 KRAKDIRFPTYLTQNEERQYQLLTELELKEKHLQYLKKCQKI 149

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 62/207 (29%), Positives = 109/207 (52%), Gaps = 26/207 (12%)

Query: 376 NPKATPKNPELLVKTRYNNNSIILSKSVYDLVNYNIKVHNKRVKDYINDSNIKYKEKNEE 435
           NP ATP+ PEL+VKT+ +     LSK+VYD +NY+ KVH   + D       KY  KN+E
Sbjct: 420 NPVATPEKPELIVKTKEHG---YLSKAVYDKINYDEKVHQAWLTDLRAREKAKYDAKNKE 476

Query: 436 F-------NNSINELDLKIKSIEKDIIDYKAKIDSLMNDNVEKNDIDIENYH--EKMLIK 486
           +        N I+E++  +K++ K+  +   KI+   N  V K  ID+   H  +K++I 
Sbjct: 477 YEEKLQDLQNQIDEVEDSMKAMRKETSE---KIEVSKNRLV-KQIIDVNAAHNNKKLMIF 532

Query: 487 KNQIIKKN---DEITYIL--QSSPPTAAISLDTKDAVTKQSDCTPLIKDWKSEQSKLNEQ 541
           K+    KN   +E   +L  Q++  +    L+     +++++      DW +  S L++Q
Sbjct: 533 KDTENMKNQKLEEKNVVLNKQTNVKSQIDELN-----SEKTNVQKDFNDWTTNLSNLSQQ 587

Query: 542 IDSKVNVIKQLNKNLADVKQKITELSE 568
           +D+++  I Q+N   + V+ +I  L +
Sbjct: 588 LDAQIFKINQINLKQSKVQDEIDSLEQ 614

>YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON}
           Component of the eisosome with unknown function;
           GFP-fusion protein localizes to the cytoplasm;
           specifically phosphorylated in vitro by mammalian
           diphosphoinositol pentakisphosphate (IP7)
          Length = 816

 Score = 90.5 bits (223), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 68/117 (58%), Gaps = 7/117 (5%)

Query: 36  PSDVLQTAINSHTLHGKGKQ-YKSPFRDTQTPSNMN---VALKKKNHRYPTISATSPYSN 91
           P   LQ  +++     KGK+ + SPFR     +  N        KN ++PT+SATS YS 
Sbjct: 35  PYQFLQKVVSNEP---KGKEEWVSPFRQDALANRQNNRAYGEDAKNRKFPTVSATSAYSK 91

Query: 92  MTPQDLGYKNIHPSTKRAKDIPFPVLLIENEIRQDKLFAQLTEKESQLDYLQKSQKL 148
             P+DLGYKNI  + KRAKDI FP  L +NE RQ +L  +L  KE  L YL+K QK+
Sbjct: 92  QQPKDLGYKNIPKNAKRAKDIRFPTYLTQNEERQYQLLTELELKEKHLKYLKKCQKI 148

 Score = 68.2 bits (165), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 109/199 (54%), Gaps = 14/199 (7%)

Query: 376 NPKATPKNPELLVKTRYNNNSIILSKSVYDLVNYNIKVHN-------KRVKDYINDSNIK 428
           NP ATP+NPEL+VKT+ +     LSK+VYD +NY+ K+H         + KD  +  N +
Sbjct: 397 NPVATPENPELIVKTKEHG---YLSKAVYDKINYDEKIHQAWLADLRAKEKDKYDAKNKE 453

Query: 429 YKEKNEEFNNSINELDLKIKSIEKDIIDYKAKIDSLMNDNVEK-NDIDIENYHEKMLIKK 487
           YKEK ++  N I+E++  +K++ ++  +   KI+   N  V+K  D++ E+ ++K++I K
Sbjct: 454 YKEKLQDLQNQIDEIENSMKAMREETSE---KIEVSKNRLVKKIIDVNAEHNNKKLMILK 510

Query: 488 NQIIKKNDEITYILQSSPPTAAISLDTKDAVTKQSDCTPLIKDWKSEQSKLNEQIDSKVN 547
           +    KN ++    +       +  +  D   ++++      DW +  S L++Q+D+++ 
Sbjct: 511 DTENMKNQKLQEKNEVLDKQTNVKSEIDDLNNEKTNVQKEFNDWTTNLSNLSQQLDAQIF 570

Query: 548 VIKQLNKNLADVKQKITEL 566
            I Q+N     V+ +I  L
Sbjct: 571 KINQINLKQGKVQNEIDNL 589

>Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON}
           YGR130C (REAL)
          Length = 807

 Score = 90.5 bits (223), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 65/108 (60%), Gaps = 4/108 (3%)

Query: 52  KGKQ-YKSPFRDTQTPSNMNVAL---KKKNHRYPTISATSPYSNMTPQDLGYKNIHPSTK 107
           KGK+ + SPFR      N N  L     KN ++PT+SATS YS   P+DLGYKNI  + K
Sbjct: 48  KGKEEWVSPFRQDALSRNQNNRLYVADAKNKKFPTVSATSAYSKQQPKDLGYKNIPKNAK 107

Query: 108 RAKDIPFPVLLIENEIRQDKLFAQLTEKESQLDYLQKSQKLIKVEPIG 155
           RAKDI FP  L +NE RQ +L  +L  KE  L YL++ QK+  +   G
Sbjct: 108 RAKDIRFPTYLTKNEERQYQLLTELELKEKHLKYLKECQKITDLTSDG 155

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 59/206 (28%), Positives = 108/206 (52%), Gaps = 28/206 (13%)

Query: 376 NPKATPKNPELLVKTRYNNNSIILSKSVYDLVNYNIKVHNKRVKDY-------INDSNIK 428
           NP ATP+NPEL+VKT+ +     LSK+VYD +NY+ KVH   + D         + ++  
Sbjct: 388 NPVATPENPELIVKTKEHG---YLSKAVYDKINYDEKVHQAWLADLKAKEKAKYDATSTG 444

Query: 429 YKEKNEEFNNSINELDLKIKSIEKDIIDYKAKIDSLMNDNVEKNDIDIENYH--EKMLI- 485
           Y E+ ++  N I+E++  +K++ K+  +   KI+   N  V K  ID+   H  +K++I 
Sbjct: 445 YSERLQDLQNQIDEIENSMKAMRKETSE---KIEVSKNRLV-KQIIDVNTAHNNKKLMIF 500

Query: 486 -----KKNQIIKKNDEITYILQSSPPTAAISLDTKDAVTKQSDCTPLIKDWKSEQSKLNE 540
                 KNQ +++ DE+           A+  +  +  + +++      DW +  S L++
Sbjct: 501 KDTENMKNQKLQEKDEVL------GKQTAVKSEIDELNSAKTNVQKEFNDWTTNLSNLSQ 554

Query: 541 QIDSKVNVIKQLNKNLADVKQKITEL 566
           Q+D+++  I Q+N   + V+ +I  L
Sbjct: 555 QLDAQIFKINQINLKQSKVQNEIDAL 580

>CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130c
          Length = 813

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/134 (38%), Positives = 82/134 (61%), Gaps = 7/134 (5%)

Query: 76  KNHRYPTISATSPYSNMTPQDLGYKNIHPSTKRAKDIPFPVLLIENEIRQDKLFAQLTEK 135
           K  ++PT+SATS  +N  P++LG+K +  STKRAKDI FPV L ENE RQ  +  +L  K
Sbjct: 119 KQMKFPTVSATSALANQDPKELGFKTLDKSTKRAKDIKFPVYLTENEFRQQTILKELELK 178

Query: 136 ESQLDYLQKSQKLIKV-----EPIGQRPVSKSKQKDSKLKTNTDKP--KATKKTQSSISD 188
           E +L YL+ SQK+I +     +   ++   + +Q D++++ N D    +A  K   +I+D
Sbjct: 179 EGKLQYLKDSQKIIDLTIRQPDSDEEQQDEQDEQDDTEVEDNVDAENQQAHTKDNDTITD 238

Query: 189 KTSIAKLDAPKGKL 202
           K  +A  DAP+ ++
Sbjct: 239 KEDMASQDAPEKEM 252

 Score = 36.6 bits (83), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 91/212 (42%), Gaps = 42/212 (19%)

Query: 377 PKATPKNPELLVKTRYNNNSIILSKSVYDLVNYNIKVHNKRVKDYINDSNIKYKEKN--- 433
           P ATP+NPEL+ KT        +SK +YD V Y+   H + +K +      KY +K    
Sbjct: 418 PIATPENPELIAKTEEYG---YMSKPIYDKVVYDETNHRRWLKGFKKSEKAKYDDKMEEY 474

Query: 434 ---------------EEFNNSINELDLKIKSIEKDIIDYKAKIDSLMNDNVEKNDIDIEN 478
                          E   N   E   KI+  E +++    + ++L N+   K   + EN
Sbjct: 475 NNELEELQKEIDMINESMENLKKETADKIEVSENNLVKKIFERNTLHNEQKNKIFKETEN 534

Query: 479 YHEKMLIKKNQIIKKN----DEITYILQSSPPTAAISLDTKDAVTKQSDCTPLIKDWKSE 534
              + + +K +I+ K+    DEIT +            D K  V ++ D       W + 
Sbjct: 535 IKNQKIQQKKEILDKHAVVQDEITQL-----------NDRKKEVREEFDK------WTTN 577

Query: 535 QSKLNEQIDSKVNVIKQLNKNLADVKQKITEL 566
            + L +Q+D+K+  + Q+     + +++I +L
Sbjct: 578 MTTLGQQLDAKIMKVTQITMKQDETQKEIEKL 609

>TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa]
           {ON} Anc_3.492 YGR130C
          Length = 700

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 56/93 (60%), Gaps = 3/93 (3%)

Query: 54  KQYKSPFRDTQTPSNMNVALKKKNHRYPTISATSPYSNMTPQDLGYKNIHPSTKRAKDIP 113
           + Y SPFRD Q    +  A +++  R+PT SA S Y N  P++LGYK I    KRAKDI 
Sbjct: 38  RDYVSPFRDEQ---EVLSAQRRRTQRFPTTSAASAYVNARPEELGYKKIGAGEKRAKDIS 94

Query: 114 FPVLLIENEIRQDKLFAQLTEKESQLDYLQKSQ 146
           FPV L E E +Q +L  +L  KE+ L YL+  Q
Sbjct: 95  FPVYLEEIEKKQLELLRELEVKEAHLRYLKDCQ 127

 Score = 48.9 bits (115), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 96/196 (48%), Gaps = 28/196 (14%)

Query: 382 KNPELLVKTRYNNNSIILSKSVYDLVNYNIKVHNKRVKDYINDSNIKYKEKNEEFNNSIN 441
           +NPE +VKT+       L+K +YD +    + HN+ +  Y  D   K+ +K  E N  IN
Sbjct: 346 ENPEHVVKTKDG----YLTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKIN 401

Query: 442 ELDLKIKSIEKDIIDYKAKIDS---LMNDNVEKNDIDIENYHEKMLIKKNQIIKKNDEIT 498
            L  +IK I+ ++   ++  D+   +  + + +   ++   H   + KKNQ+ K     T
Sbjct: 402 SLRAQIKEIKNEMAQLRSDTDAKIEVSENELTRKFFEMTQVH---IQKKNQVFKD----T 454

Query: 499 YILQSSPPTAAIS-LDTKDAVTKQSDCTPLIKD--------WKSEQSKLNEQIDSKVNVI 549
            +++S   +   S LD +  V K+ D   + K+        W  +  +L+ +ID+KV  +
Sbjct: 455 EVIKSQKLSEKDSVLDKQGEVQKEIDELNIEKEKVEEECQKWTKDIEELSARIDAKVADL 514

Query: 550 KQLNKNLADVKQKITE 565
           +++N     VKQK T+
Sbjct: 515 EEVN-----VKQKNTQ 525

>TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {ON}
           Anc_3.492 YGR130C
          Length = 629

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 66/110 (60%), Gaps = 1/110 (0%)

Query: 41  QTAINSH-TLHGKGKQYKSPFRDTQTPSNMNVALKKKNHRYPTISATSPYSNMTPQDLGY 99
           QT +  H +   +  +Y SPFR+ Q     N A   K  ++PT SATS ++ M P ++GY
Sbjct: 21  QTFLTRHISRKSENTEYISPFRNPQDTVRSNYAKSLKEKKFPTTSATSNFNKMVPGEMGY 80

Query: 100 KNIHPSTKRAKDIPFPVLLIENEIRQDKLFAQLTEKESQLDYLQKSQKLI 149
            ++  + KRAKDI FP  L++NE RQ +L  +L  KE +L  LQKS +++
Sbjct: 81  SSLAKNDKRAKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKSSRVL 130

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 100/187 (53%), Gaps = 18/187 (9%)

Query: 379 ATPKNPELLVKT-RYNNNSIILSKSVYDLVNYNIKVHNKRVKDYINDSNIKYKEKNEEFN 437
           A+P+NPE LV+T  YN    I+SK+VYD +NY  K+H++ +K++    + KY  K +E+ 
Sbjct: 316 ASPENPEYLVRTNEYN----IVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYE 371

Query: 438 NSINELDLKIKSIE--KDIIDYK--AKIDSLMNDNVEKNDIDIENYHEKMLIKKNQIIKK 493
           + + EL  ++  IE  K I + K   KI+ +M   + KN +D+++   K  + K ++IK+
Sbjct: 372 DKLVELQKQLDDIEEKKKISNMKKQQKIE-IMEYQLVKNVLDVQS---KYNVDKGKVIKE 427

Query: 494 NDEITYI-LQSSPPTAAISLDTKDAVTKQSDCTPLIKD----WKSEQSKLNEQIDSKVNV 548
            + +    + +     A  LD K+ + K ++    I +    W      L   +D K+  
Sbjct: 428 TELMKLQKINAKEDLLAKQLDVKNEIEKLNNEKEAITNEYNIWNGNLENLTTLLDEKIAK 487

Query: 549 IKQLNKN 555
           I+ +N+N
Sbjct: 488 IEAINEN 494

>ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly
           similar to uniprot|P53278 Saccharomyces cerevisiae
           YGR130C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 994

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 60/92 (65%), Gaps = 3/92 (3%)

Query: 55  QYKSPFRDTQTPSNMNVALKKKNHRYPTISATSPYSNMTPQDLGYKNIHPSTKRAKDIPF 114
           ++ SPFR     SN   A K++  R+PT+S  S +S + P++LGY+ +   ++RAKDI F
Sbjct: 68  EFASPFR---LESNEKDAEKRRLQRFPTVSPNSVFSKVHPKELGYRTMGRGSRRAKDIQF 124

Query: 115 PVLLIENEIRQDKLFAQLTEKESQLDYLQKSQ 146
           P+ L ENE RQD+L  ++  +E +L Y++ SQ
Sbjct: 125 PIYLRENEARQDQLLTEVEIREQKLAYIKNSQ 156

 Score = 61.6 bits (148), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 54/209 (25%), Positives = 99/209 (47%), Gaps = 22/209 (10%)

Query: 371 MNNVINPKATPKNPELLVKTRYNNNSIILSKSVYDLVNYNIKVHNKRVKDYINDSNIKYK 430
            N   NP ATP+NPE+LVKT   +    LSK+VYD V Y    H++ + ++I+    +Y+
Sbjct: 482 QNRAPNPLATPENPEILVKT---DREGFLSKAVYDKVKYENHKHSEWLTEFISSEKKRYE 538

Query: 431 EKNEEFNNSINELDLKIKSIEKDIIDYKAKIDSLMN--------DNVEKNDIDIEN---- 478
           EK  +++N + EL  +++ +E+ + + K   + L+           +E     IE     
Sbjct: 539 EKQVDYDNRLEELKKEVEKLEESMQEIKDDANELIEIRHGRLSKKFLESTQQYIEKKNAI 598

Query: 479 YHEKMLIKKNQIIKKNDEITYILQSSPPTAAISLDTKDAVTKQSDCTPLIKDWKSEQSKL 538
           +HE   I ++Q  K+ DEI +  +      A     KD + ++         W +  +  
Sbjct: 599 FHETKAI-QDQKDKETDEIKHRQEEVQKEIAALNAEKDNIHRE------FIGWTNRLADY 651

Query: 539 NEQIDSKVNVIKQLNKNLADVKQKITELS 567
           +  +D+K+  +  L +     + +I ELS
Sbjct: 652 SAHLDAKMYSLHTLQQKHTKTQAQIDELS 680

>NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.492
           YGR130C
          Length = 692

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 43/94 (45%), Positives = 52/94 (55%), Gaps = 3/94 (3%)

Query: 56  YKSPFRDTQTPSNMNVALKKKNHRYPTISATSPYSNMTPQDLGYKNIHPSTKRAKDIPFP 115
           Y SPFR     SN+NV   +K  R+PT+SATS Y+   P+  G+  I      AKDI FP
Sbjct: 73  YASPFR--AEYSNVNVQ-NEKTRRFPTVSATSNYTLKNPKQKGFTTIKKGQNFAKDIYFP 129

Query: 116 VLLIENEIRQDKLFAQLTEKESQLDYLQKSQKLI 149
             L ENE RQ      L +KE  L YLQ SQ +I
Sbjct: 130 NYLTENEQRQQAELLILEKKEKDLKYLQDSQNII 163

 Score = 52.8 bits (125), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 55/100 (55%), Gaps = 7/100 (7%)

Query: 376 NPKATPKNPELLVKTRYNNNSIILSKSVYDLVNYNIKVHNKRVKDYINDSNIKYKEKNEE 435
           NP A+P N E +VKT        LSK+VYD + Y+ + H K + DY    N KY+ K +E
Sbjct: 267 NPVASPTNQEEIVKTAQFG---YLSKAVYDKIQYDEQQHKKWLADYETKQNEKYEAKMQE 323

Query: 436 FNNSINELDLKIKS----IEKDIIDYKAKIDSLMNDNVEK 471
           +  S+ ++D ++      IEK  +D K KID +    V+K
Sbjct: 324 YKKSLQDMDNQMSELNDLIEKCELDTKEKIDVMHGQLVKK 363

>NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.492
           YGR130C
          Length = 656

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 54/96 (56%)

Query: 54  KQYKSPFRDTQTPSNMNVALKKKNHRYPTISATSPYSNMTPQDLGYKNIHPSTKRAKDIP 113
           ++Y SPFR     +N      +K  R+PT+SATS Y+N T +++G+K I      AKDI 
Sbjct: 66  EEYLSPFRSNLVTNNKAYIQNEKTKRFPTVSATSNYTNRTSKEMGFKKIPKDKNFAKDIF 125

Query: 114 FPVLLIENEIRQDKLFAQLTEKESQLDYLQKSQKLI 149
           FP  L +NE RQ     +L + E  L Y + SQ +I
Sbjct: 126 FPSYLTQNEQRQQIELTKLVKLEKDLQYKKDSQNII 161

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 99/205 (48%), Gaps = 26/205 (12%)

Query: 376 NPKATPKNPELLVKTRYNNNSIILSKSVYDLVNYNIKVHNKRVKDYINDSNIKYKEKNEE 435
           NPKATP + E +VKT+      ILSKS+YD + Y+ + H + +  Y  +   KY  K +E
Sbjct: 227 NPKATPNSKEEIVKTKKFG---ILSKSIYDQLQYDQQQHEQYLASYKAEMQEKYDVKMQE 283

Query: 436 FNNSINELDLKIKS----IEKDIIDYKAKIDSLMNDNVEKNDID---------IENYHEK 482
           + N +  LD KI +    IE+   D  AK+D +MN  + K   D         ++ + E 
Sbjct: 284 YENELKSLDEKIVASNELIEQCKKDTDAKLD-IMNAELVKRMFDERSVQTDDKMKIFSET 342

Query: 483 MLIKKNQIIKKNDEITYILQSSPPTAAISLDTKDAVTKQSD-CTPLIKDWKSEQSKLNEQ 541
            LIK+ +I   +++I            I     D + K+ +       +W    + + EQ
Sbjct: 343 KLIKREKI---DEKINVEELDDQVVGEI-----DQLNKEKEKVYDEFNEWTFNMTNIAEQ 394

Query: 542 IDSKVNVIKQLNKNLADVKQKITEL 566
           +D+K+  IKQ+N    +++ KI  L
Sbjct: 395 LDAKLFKIKQINITQMNLQNKIDGL 419

>KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.492
           YGR130C
          Length = 757

 Score = 68.2 bits (165), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 58/97 (59%), Gaps = 1/97 (1%)

Query: 54  KQYKSPFRDTQTPSNMNVALK-KKNHRYPTISATSPYSNMTPQDLGYKNIHPSTKRAKDI 112
           ++Y SPFR  Q        L+ ++  ++PT+SATS Y++   ++LG+  +    +RA+DI
Sbjct: 46  EEYVSPFRGGQLTKASKKQLQLQRTKKFPTVSATSLYNSYNTRELGFSKVTDDQRRARDI 105

Query: 113 PFPVLLIENEIRQDKLFAQLTEKESQLDYLQKSQKLI 149
            FP  L+ENE RQ  +   L ++E  L +LQ+ Q ++
Sbjct: 106 VFPEYLLENEDRQRLILKDLEKREQTLLHLQRCQSVL 142

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 51/213 (23%), Positives = 97/213 (45%), Gaps = 31/213 (14%)

Query: 374 VINPKATPKNPELLVKT-RYNNNSIILSKSVYDLVNYNIKVHNKRVKDYINDSNIKYKEK 432
           V NP+AT   PELL+K  +Y +    +S +V++ V Y+ KVH   + DY  +   K+ +K
Sbjct: 295 VTNPQATEDTPELLLKLPKYGH----VSAAVFNKVLYDDKVHKAEMADYQREQESKFAKK 350

Query: 433 NEEFNNSINEL------------DLKIKSIEKDIIDYKAKIDSLMNDNVEKNDIDIENYH 480
            +E+   + ++            D K+  I K  +    KI  L + N   ND  ++  H
Sbjct: 351 LQEYEQKLAQVDDRKLSVLAKMNDAKLDKIAKSEVIENQKIKQLFDSNATFNDSKVKVLH 410

Query: 481 EKMLIKKNQIIKKNDEITYILQSSPPTAAISLDTKDAVTKQSDCTPLIKDWKSEQSKLNE 540
           E  L+K    ++K  ++ +I   S     +  +      ++S        W +  + + E
Sbjct: 411 EAQLVK----LQKLQDLKFI---SQKKTLMQHEVNQLTLEKSHAEKDYHLWTTNLTNITE 463

Query: 541 QIDSKVNVIKQLN-------KNLADVKQKITEL 566
           ++D+++  + Q N       + + D+ Q+ TEL
Sbjct: 464 RLDAQLFKLSQFNHKQDKITRQIRDLTQRKTEL 496

>KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {ON}
           Anc_3.492 YGR130C
          Length = 275

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 36/93 (38%), Positives = 55/93 (59%), Gaps = 5/93 (5%)

Query: 69  MNVALKKKNHRYPTISATSPYSNMTPQDLGYKNIHPSTKRAKDIPFPVLLIENEIRQDKL 128
            ++ L KK    P  +  S Y+ + P++LGYK   P  K A++I FP  L ENE+RQ  +
Sbjct: 2   WSMLLGKKRKSSPISNPHSSYNTLKPEELGYKQKFPK-KYAREIHFPAELTENEMRQRAI 60

Query: 129 FAQLTEKESQLDYLQKSQKLIKVEPIGQRPVSK 161
              L EKE  LD+L+KSQ+++ ++    +PV K
Sbjct: 61  LQDLDEKEQHLDHLKKSQRVVYID----KPVEK 89

 Score = 35.4 bits (80), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 40/75 (53%), Gaps = 1/75 (1%)

Query: 376 NPKATPKNPELLVKTRY-NNNSIILSKSVYDLVNYNIKVHNKRVKDYINDSNIKYKEKNE 434
           NP ATP+ PE +V  ++ N  +   SK ++D +  +I  HN  +      +N +   K E
Sbjct: 120 NPVATPETPEEVVIYKHLNGTNKAYSKEIFDNIQRDICNHNAWLLSREGKANDQCATKME 179

Query: 435 EFNNSINELDLKIKS 449
           E+N  +  LD +IKS
Sbjct: 180 EYNKQLAVLDDQIKS 194

>SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 773

 Score = 61.6 bits (148), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 53/96 (55%), Gaps = 5/96 (5%)

Query: 56  YKSPFRDTQTPSNMNVALKKKNHRYPTISATSPYSNMTPQDLGYKNIHPSTKRAKDIPFP 115
           Y SPFR  Q    +  A   K  ++PT+SATS     +  DLGYK I  + +RAKDI  P
Sbjct: 45  YSSPFRSQQ---ELIAAKNVKAKKFPTVSATS--GTASAADLGYKVIDSAKRRAKDISVP 99

Query: 116 VLLIENEIRQDKLFAQLTEKESQLDYLQKSQKLIKV 151
             L   + +Q K   +L  KE+ L YL+ SQK++ V
Sbjct: 100 RYLKNTDEKQRKKLDKLEFKENHLQYLKDSQKIVDV 135

 Score = 51.6 bits (122), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 99/204 (48%), Gaps = 23/204 (11%)

Query: 377 PKATPKNPELLVKTRYNNNSIILSKSVYDLVNYNIKVHNKRVKDYINDSNIKYKEKNEEF 436
           P ATP++PE +V+T    +   +SK++YD + Y+ +VH   +  +  +   KY    +E+
Sbjct: 350 PLATPQDPEYIVRT----DKGYMSKAIYDKLEYDEQVHQNELATFNKEQADKYDATEKEY 405

Query: 437 NNSINELDLKIKSIEKDI----IDYKAKIDSLMNDNVEKNDIDIENYH---EKMLIK--- 486
           N+ +  L  +I  ++  +    +D K KI  +    + K  +D+   H   + ++ K   
Sbjct: 406 NDKLTLLQSQIDELQATMEQLRLDTKEKI-KVSESELSKKMLDLNATHISSKNVIFKETE 464

Query: 487 --KNQIIKKNDEITYILQSSPPTAAISLDTKDAVTKQSDCTPLIKDWKSEQSKLNEQIDS 544
             K Q I + DEIT    +        ++  + + KQ D      +++++   L  Q+DS
Sbjct: 465 NIKTQKIAERDEIT----AKHEEVKAEIEELNVLKKQVDAE--FNEYQAKLDDLTAQLDS 518

Query: 545 KVNVIKQLNKNLADVKQKITELSE 568
           KV  I++LN    ++   I EL++
Sbjct: 519 KVEKIQELNDKQMEITGLIAELNQ 542

>KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {ON}
           Anc_3.492 YGR130C
          Length = 363

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 36/101 (35%), Positives = 54/101 (53%), Gaps = 3/101 (2%)

Query: 55  QYKSPFRDTQTPSNMNVALKKKNHRYPTISATSPYSNMTPQDLGYKNI---HPSTKRAKD 111
           +Y+SPFR    P+ +N   + KN +Y   +  S ++ +    +GYK I     S K AKD
Sbjct: 38  KYQSPFRRNINPNYLNYIREHKNAKYTITNPNSDFNKLNLNTVGYKTIPTDRKSRKIAKD 97

Query: 112 IPFPVLLIENEIRQDKLFAQLTEKESQLDYLQKSQKLIKVE 152
           I FP  L ENE  Q     +L  KE+ L +L+ SQ L+ ++
Sbjct: 98  IDFPRSLRENEEAQTNFLNELKTKENNLKFLKDSQNLVYID 138

>Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {ON}
           YGR130C - 1:1 [contig 130] FULL
          Length = 787

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/96 (40%), Positives = 56/96 (58%), Gaps = 5/96 (5%)

Query: 56  YKSPFRDTQTPSNMNVALKKKNHRYPTISATSPYSNMTPQDLGYKNIHPSTKRAKDIPFP 115
           Y SPFR +Q+      A K+K  R+PT+SA+S     +  ++G+K I  + KRAKDI  P
Sbjct: 40  YSSPFRTSQSQVE---AQKRKVQRFPTVSASS--GGNSSAEMGFKVIDAARKRAKDIAVP 94

Query: 116 VLLIENEIRQDKLFAQLTEKESQLDYLQKSQKLIKV 151
             L  N+ RQ +   +L  KE  L Y + SQK++KV
Sbjct: 95  RYLQGNDERQRRRLDKLERKEDSLQYKKDSQKIVKV 130

 Score = 51.6 bits (122), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 50/207 (24%), Positives = 97/207 (46%), Gaps = 29/207 (14%)

Query: 377 PKATPKNPELLVKTRYNNNSIILSKSVYDLVNYNIKVHNKRVKDYINDSNIKYKEKNEEF 436
           P A+P +PE +VK     +   +SK++YD + Y   VH + +  Y  ++  KY  K +E+
Sbjct: 348 PVASPDDPEFIVKF----DKGYMSKALYDTLEYEEAVHKQEMDQYTKENTDKYDAKAQEY 403

Query: 437 NNSINELDLKIKSIEKDIIDYKAKIDSLMNDNVEKNDIDIENYHEKMLIKKNQIIKKNDE 496
            + +  L  +I  +E       A ++ L  D  +K +I       +M I+ N   K ++ 
Sbjct: 404 EDHLTSLKSQIAELE-------ATMEQLQLDTTDKINISAAELSARM-IESN--AKHSNT 453

Query: 497 ITYILQSSPPTAAISLDTKDA-VTKQSDCTPLIKDWKSEQS--------------KLNEQ 541
              I + +  + A  +D K A V KQ +     ++ +++++              +L  Q
Sbjct: 454 KNVIFKETENSKAAKIDEKAAVVAKQDEVKAENEELEAQRAEADATNQELLSRIDELTTQ 513

Query: 542 IDSKVNVIKQLNKNLADVKQKITELSE 568
           +DSK + I++LN   A+++  I  L +
Sbjct: 514 LDSKQSAIQELNDQQAEIQASIDALEQ 540

>KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {ON}
           Anc_3.492 YGR130C
          Length = 563

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 58/101 (57%), Gaps = 3/101 (2%)

Query: 55  QYKSPFRDTQTPSNMNVALKK-KNHRYPTISATSPYSNMTPQDLGYKNIHPSTKRAKDIP 113
           +Y SPFR+          L+  K  ++P +SATS Y N   +D+ YK++ P    A+DI 
Sbjct: 50  KYNSPFRNNAPSREQKKQLQDLKTAKFPLVSATSTY-NTDTKDV-YKDLDPKKNFARDIK 107

Query: 114 FPVLLIENEIRQDKLFAQLTEKESQLDYLQKSQKLIKVEPI 154
           FP  LI+NE RQ+++   L  K+  LD L+ S ++I VE +
Sbjct: 108 FPSRLIDNENRQNQILLDLKIKQDALDRLKDSLQVIDVEDL 148

>KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 836

 Score = 57.8 bits (138), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 56/96 (58%), Gaps = 5/96 (5%)

Query: 56  YKSPFRDTQTPSNMNVALKKKNHRYPTISATSPYSNMTPQDLGYKNIHPSTKRAKDIPFP 115
           Y SPFR +Q+   +  A K+K  ++PT+SA+   S  +  D+GYK I  + +RAKDI  P
Sbjct: 41  YNSPFRTSQS---LAAAQKRKMQKFPTVSASV--SAHSSSDMGYKVIDAARRRAKDIAVP 95

Query: 116 VLLIENEIRQDKLFAQLTEKESQLDYLQKSQKLIKV 151
             L  N+ RQ +   +L  KE  L Y + SQ+++ V
Sbjct: 96  RYLQGNDERQRRRLDKLERKEDALKYKKDSQRIVDV 131

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/207 (23%), Positives = 99/207 (47%), Gaps = 31/207 (14%)

Query: 376 NPKATPKNPELLVKTRYNNNSIILSKSVYDLVNYNIKVHNKRVKDYINDSNIKYKEKNEE 435
            P A+P +PE +VK  ++     +SK++YD + Y   +H + + DY  + + KY+ K   
Sbjct: 375 QPVASPNDPEFIVK--FDKG--YMSKALYDTLEYEEAIHKREMDDYTKEHDAKYEAK--- 427

Query: 436 FNNSINELDLKIKSIEKDIIDYKAKIDSLMNDNVEKNDIDIENYHEKML-IKKNQIIKKN 494
                NE + ++ S++  I + +A +++L  D  EK +I       +M+ +       KN
Sbjct: 428 ----ANEYEDRLTSLKSQIAELEATMETLQKDTTEKIEISEAKLSAQMIDLNAEHSSSKN 483

Query: 495 DEITYILQSSPPTAAISLDTKDAV-TKQSDCTPLIKDW-----------KSEQSKLNE-- 540
                I + +    A  ++ K+ V  KQ D    +++            +  Q +++E  
Sbjct: 484 ----VIFKETENMKAAKVEEKEGVEAKQEDVKTELEELEKLRAEIDAENREHQGRVDELT 539

Query: 541 -QIDSKVNVIKQLNKNLADVKQKITEL 566
            ++D+K+  I++LN   A+++  I +L
Sbjct: 540 AELDAKLAAIQELNTQQAELQASIDDL 566

>KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 871

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 50/96 (52%), Gaps = 6/96 (6%)

Query: 55  QYKSPFRDTQTPSNMNVALKKKNHRYPTISATSPYSNMTPQDLGYKNI-HPSTKRAKDIP 113
           +Y SPFR   T      A + +  ++PT+S  +    + P+ +GY  +   S K+AKDI 
Sbjct: 60  EYHSPFR---TAEETQRARQVRQEKFPTLSQGA--VQLDPEQMGYSVVTDKSVKKAKDII 114

Query: 114 FPVLLIENEIRQDKLFAQLTEKESQLDYLQKSQKLI 149
            P  L + E  Q      L +KE QL Y +KSQK++
Sbjct: 115 IPSGLKDTEAEQKVRLTALEKKEKQLRYWRKSQKIV 150

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 54/95 (56%), Gaps = 11/95 (11%)

Query: 377 PKATPKNPELLVKTRYNNNSIILSKSVYDLVNYNIKVHNKRVKDYINDSNIKYKEKNEEF 436
           P ATP++PEL+V+T+       +SKSVYD + Y+   H  ++  Y        KE++E +
Sbjct: 444 PVATPEDPELIVRTQEG----YVSKSVYDKLQYDEDQHQAKLALY-------SKEQDERY 492

Query: 437 NNSINELDLKIKSIEKDIIDYKAKIDSLMNDNVEK 471
                E + KI+SI+ +I +  A+++ +  ++ EK
Sbjct: 493 ETKAQEYEEKIQSIQAEIAELDAQMEQVRLEHEEK 527

>AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR130C
          Length = 623

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 70/144 (48%), Gaps = 26/144 (18%)

Query: 374 VINPKATPKNPELLVKTRYNNNSIILSKSVYDLVNYNIKVHNKRVKDYINDSNIKYKEKN 433
           ++ P  TP+ PE+++ T    N   +SK+VYD +N   K H  R+ +   D+   Y+  +
Sbjct: 276 LLVPNGTPEEPEVVLLT----NRGYMSKAVYDRLNDEEKAHLGRLVNSDEDAAQDYQLVS 331

Query: 434 EEFNNSINELDLKIKSIEKDIIDYKA----KIDSL---MNDNVEKNDIDIEN------YH 480
           + +   I +LD +I  +  DI   +A    +ID L   ++ N++  D+  EN       H
Sbjct: 332 QHYEKEIADLDAEISKLRADITALQAETEGQIDGLEASLSKNIQ--DMKAENADKQHVLH 389

Query: 481 EKM-------LIKKNQIIKKNDEI 497
           E+        L  K +I+ +N E+
Sbjct: 390 EQAEAQRAEQLADKEEIVHQNQEL 413

>Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar to
           Ashbya gossypii AFR310C
          Length = 727

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 55/99 (55%), Gaps = 13/99 (13%)

Query: 53  GKQYKSPFRDTQTPSNMNVALKKKNHRYPTISATSPYSNMTPQDLGYKNIHPSTKRAKDI 112
           G +Y SPFRD +  +    A + ++ ++PT   T  +S +  +D    N+    ++A+DI
Sbjct: 54  GGEYVSPFRDDKAVAE---AERIRDLKFPT---TGHHSTVRVKD----NVK---RKAQDI 100

Query: 113 PFPVLLIENEIRQDKLFAQLTEKESQLDYLQKSQKLIKV 151
             P      +++Q K   +L  KE+QL+YL+ SQK++ V
Sbjct: 101 AEPRSFGTTDLKQQKQLDELGMKENQLEYLRNSQKIVDV 139

 Score = 38.9 bits (89), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 41/203 (20%), Positives = 96/203 (47%), Gaps = 25/203 (12%)

Query: 379 ATPKNPELLVKTRYNNNSIILSKSVYDLVNYNIKVHNKRVKDYINDSNIKYKEKNEEFNN 438
           ATP++PE +V T        +SK++YD + Y  ++H +++     +S  KY++    +  
Sbjct: 323 ATPEDPEFIVLTEKG----YMSKNIYDRLEYEEELHQEKLASLDQNSAAKYEDTARAYEE 378

Query: 439 SINELDLKIKSIEKDIIDYKAKIDSLM---NDNVEKNDIDIENYHEKM---LIKKNQ--- 489
            +  L+ +I  +   +   K++ ++ M     ++ +N +DI+  H++    L+K+ +   
Sbjct: 379 KLASLNNEIAEVHAAMDQLKSQTENEMKAIEASLSQNLMDIQAKHDEQKETLLKEAENEK 438

Query: 490 ---IIKKNDEITYILQSSPPTAAI-SLDTKDAVTKQSDCTPLIKDWKSEQSKLNEQIDSK 545
              I +KN     + Q  P   A+  L+ +  V         ++ ++SE   L  ++D++
Sbjct: 439 NAKITEKNTINEKLTQVEPELEALKRLELERKVE--------LQQYQSEVQALTAELDAR 490

Query: 546 VNVIKQLNKNLADVKQKITELSE 568
           +  ++ ++    +V   +  L E
Sbjct: 491 LGELQNVSDEQTEVNLSMAALEE 513

>NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 40.4 bits (93), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 377 PKATPKNPELLVKTRYNNNSIILSKSVYDLVNYNIKVHNKRVKDYINDSNIKYKEKNEEF 436
           P ATP+NPE+LV+   N N I+ SK  YD +      H+  +K Y  ++   Y ++++ +
Sbjct: 180 PIATPQNPEILVQLTENQNKIV-SKETYDRLVQVQSEHDAWLKSYNAENMANYNQRHQWY 238

Query: 437 NNSINELDLKIK 448
              I+ LD KI+
Sbjct: 239 QKQIDVLDEKIR 250

>NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa]
           {ON} 
          Length = 681

 Score = 37.0 bits (84), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 51/98 (52%), Gaps = 9/98 (9%)

Query: 375 INPKATPKNPELLVKTRYNNNSIILSKSVYD-LVNYNIKVHNKRVKDYINDSNI------ 427
           +NP AT  NPE+L+K   N++  I++K  YD L+  N    N  + +    SN+      
Sbjct: 382 LNPIATTTNPEILIKL--NDDKTIITKQTYDKLLELNQDHANWMINNNGESSNLYNTKFK 439

Query: 428 KYKEKNEEFNNSINELDLKIKSIEKDIIDYKAKIDSLM 465
            Y+EK  + N  IN  +L I  I+KD +  K   D+++
Sbjct: 440 TYQEKLNKLNEQINHHNLIISMIKKDTLKNKELNDAIL 477

>Suva_15.357 Chr15 complement(617637..618952,619001..621203) [3519
           bp, 1172 aa] {ON} YHR158C (REAL)
          Length = 1172

 Score = 33.1 bits (74), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 80/174 (45%), Gaps = 15/174 (8%)

Query: 397 IILSKSVYDLVNYNIKVHNKRVKDYINDSNIKYKEKNEEFNNSINELDL-KIKSIEKDII 455
           I++ KS  D V+Y I      V   I  SN+K    NE+ N+ I  + + + K +  +++
Sbjct: 724 IMIKKS--DAVDYGITEKRDVVTSIIETSNVK----NEKPNDPIETIKIPESKDVAPEVV 777

Query: 456 DYKAKIDSLMNDNVEKNDIDIENYHEKMLIKKNQIIKKNDEITYILQSSPPTAAISLDTK 515
           D +A  + L ++    N+I     HEK L     I +   E+  +   S       +D  
Sbjct: 778 D-RALFEKLRSELQTLNNIT----HEKALEAGTHIKELETELWRLKSQSSTGMTKEMDEL 832

Query: 516 DAVTKQSDCTPLIKDWKSEQSKLNE---QIDSKVNVIKQLNKNLADVKQKITEL 566
           D+V  QS C  L  D  S + K+NE    I+SK   ++ LN+ L    ++I  L
Sbjct: 833 DSVRLQSKCELLEADNHSLEDKVNELEALINSKFLDMENLNEILQFQNERIKSL 886

>NDAI0B05050 Chr2 complement(1235335..1236342) [1008 bp, 335 aa]
           {ON} Anc_1.278 YKR022C
          Length = 335

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 39/77 (50%), Gaps = 6/77 (7%)

Query: 629 LGGDLETAISTMDQPVVNSRQLNPSSSTPAPIPKTPINTELEKSIKLQVSNKLKIKESLK 688
           +GGD+      M  P++         S  + + KT + T   K ++LQ++   K KESL 
Sbjct: 261 VGGDILKDTYAMQLPILLRDNEFEEDSLSSELFKTKLET---KKVRLQLTGMKKEKESLD 317

Query: 689 NERLNLNTLISRLKDLT 705
           N+R   + L+S+L DL 
Sbjct: 318 NKR---DILLSKLNDLV 331

>YHR155W Chr8 (407103..410789) [3687 bp, 1228 aa] {ON}
           YSP1Mitochondrial protein with a potential role in
           promoting mitochondrial fragmentation during programmed
           cell death in response to high levels of alpha-factor
           mating pheromone or the drug amiodarone
          Length = 1228

 Score = 32.0 bits (71), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 59/131 (45%), Gaps = 32/131 (24%)

Query: 437 NNSINELDLKIKSIEKDIIDYKAKIDSLMNDNVEKNDIDIENYHEKMLIKKNQIIKKNDE 496
           N +   +D+K K IE  + D    I SLM  N++K            LI+   I++KN+ 
Sbjct: 173 NETFKLVDIKHKYIEASL-DLTEAI-SLMKVNLDK-----------FLIETIDIVRKNNV 219

Query: 497 ITYILQSSPPTAAISLDTKDAVTKQSDCTPLIKDWKSEQSKLNEQIDSKVNVIKQLNKNL 556
           IT            + DTKD +    + T  +KDW        + I+S +  ++ L+  L
Sbjct: 220 IT------------TKDTKDVIDITPELTETLKDW-------TDWIESNLQTLQALSSKL 260

Query: 557 ADVKQKITELS 567
           ++ K  I +LS
Sbjct: 261 SEAKYAILKLS 271

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.125    0.336 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 72,627,286
Number of extensions: 3322490
Number of successful extensions: 27226
Number of sequences better than 10.0: 1207
Number of HSP's gapped: 27807
Number of HSP's successfully gapped: 1557
Length of query: 802
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 684
Effective length of database: 39,950,811
Effective search space: 27326354724
Effective search space used: 27326354724
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 70 (31.6 bits)