Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0C044703.490ON22222211421e-160
SAKL0F02816g3.490ON1922172281e-22
KLTH0F14784g3.490ON1952142081e-19
Skud_7.4403.490ON2132212003e-18
Kwal_55.212263.490ON1962181932e-17
ZYRO0D10032g3.490ON2092141914e-17
NCAS0E008203.490ON2022151862e-16
TDEL0D055803.490ON1932141801e-15
YGR129W (SYF2)3.490ON2152271741e-14
Ecym_12393.490ON1932221731e-14
KLLA0E04643g3.490ON2212151696e-14
Kpol_480.153.490ON2072291626e-13
Suva_7.4173.490ON2122191592e-12
CAGL0I10538g3.490ON2002041476e-11
Smik_6.2253.490ON2132201442e-10
AFR308W3.490ON1922151422e-10
NDAI0G009503.490ON2131871161e-06
TPHA0D042403.490ON2092181099e-06
KNAG0B008203.490ON207216992e-04
KLLA0A06952g5.390ON71688900.005
KAFR0C019503.490ON157209850.009
SAKL0D04070g3.245ON66799820.061
CAGL0M10527g3.211ON2497169711.3
Suva_13.2162.610ON1116172692.3
NDAI0G009803.486ON234106663.7
TDEL0D013401.265ON67073665.6
Skud_16.576.241ON799165657.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0C04470
         (222 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3....   444   e-160
SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {O...    92   1e-22
KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakl...    85   1e-19
Skud_7.440 Chr7 (729641..730282) [642 bp, 213 aa] {ON} YGR129W (...    82   3e-18
Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W...    79   2e-17
ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {O...    78   4e-17
NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON...    76   2e-16
TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3....    74   1e-15
YGR129W Chr7 (750400..751047) [648 bp, 215 aa] {ON}  SYF2Member ...    72   1e-14
Ecym_1239 Chr1 complement(491113..491694) [582 bp, 193 aa] {ON} ...    71   1e-14
KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {O...    70   6e-14
Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON} ...    67   6e-13
Suva_7.417 Chr7 (720529..721167) [639 bp, 212 aa] {ON} YGR129W (...    66   2e-12
CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa] ...    61   6e-11
Smik_6.225 Chr6 (368227..368868) [642 bp, 213 aa] {ON} YGR129W (...    60   2e-10
AFR308W Chr6 (999495..1000073) [579 bp, 192 aa] {ON} Syntenic ho...    59   2e-10
NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON...    49   1e-06
TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.49...    47   9e-06
KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON...    43   2e-04
KLLA0A06952g Chr1 complement(628173..630323) [2151 bp, 716 aa] {...    39   0.005
KAFR0C01950 Chr3 (390143..390616) [474 bp, 157 aa] {ON} Anc_3.49...    37   0.009
SAKL0D04070g Chr4 (331254..333257) [2004 bp, 667 aa] {ON} simila...    36   0.061
CAGL0M10527g Chr13 complement(1052421..1059914) [7494 bp, 2497 a...    32   1.3  
Suva_13.216 Chr13 complement(347922..351272) [3351 bp, 1116 aa] ...    31   2.3  
NDAI0G00980 Chr7 complement(203951..204655) [705 bp, 234 aa] {ON...    30   3.7  
TDEL0D01340 Chr4 complement(257445..259457) [2013 bp, 670 aa] {O...    30   5.6  
Skud_16.57 Chr16 (106443..108842) [2400 bp, 799 aa] {ON} YGL139W...    30   7.6  

>TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3.490
           YGR129W
          Length = 222

 Score =  444 bits (1142), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 222/222 (100%), Positives = 222/222 (100%)

Query: 1   MYDINELETSWKTLKEKAENTRINNQHFLTSLRDKSATNNKPKVYSMTDEFDKDELPIND 60
           MYDINELETSWKTLKEKAENTRINNQHFLTSLRDKSATNNKPKVYSMTDEFDKDELPIND
Sbjct: 1   MYDINELETSWKTLKEKAENTRINNQHFLTSLRDKSATNNKPKVYSMTDEFDKDELPIND 60

Query: 61  ENARKNHSEEERISKLMNYTLREYKDWELKQNEYTTESQTNSKDDQIESLDSLAKRTYDK 120
           ENARKNHSEEERISKLMNYTLREYKDWELKQNEYTTESQTNSKDDQIESLDSLAKRTYDK
Sbjct: 61  ENARKNHSEEERISKLMNYTLREYKDWELKQNEYTTESQTNSKDDQIESLDSLAKRTYDK 120

Query: 121 DIRKLNKALRATNSGNKSNKPGKIIKNHRNESNKIVIKDDKFLVEELVNNLKTKSDRLYK 180
           DIRKLNKALRATNSGNKSNKPGKIIKNHRNESNKIVIKDDKFLVEELVNNLKTKSDRLYK
Sbjct: 121 DIRKLNKALRATNSGNKSNKPGKIIKNHRNESNKIVIKDDKFLVEELVNNLKTKSDRLYK 180

Query: 181 HLGERRKNYSTTLSGHVNTKNQEFNEKLTREWKKLSNSIDHI 222
           HLGERRKNYSTTLSGHVNTKNQEFNEKLTREWKKLSNSIDHI
Sbjct: 181 HLGERRKNYSTTLSGHVNTKNQEFNEKLTREWKKLSNSIDHI 222

>SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {ON}
           weakly similar to uniprot|P53277 Saccharomyces
           cerevisiae YGR129W SYF2 SYnthetic lethal with cdcForty
           (putative) involved in pre-mRNA splicing
          Length = 192

 Score = 92.4 bits (228), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 71/217 (32%), Positives = 112/217 (51%), Gaps = 33/217 (15%)

Query: 3   DINELETSWKTLKEKAENTRINNQHFLTSLRDKSATNNKPKVYSMTDEFDKDELPINDEN 62
           D+ +L    K LK K  +  + N+        ++  + KPKVYSM           N++ 
Sbjct: 2   DLTDLLGKLKYLKRKGVDVSVKNRKEAEKEEKQAKQSGKPKVYSM-----------NEDE 50

Query: 63  ARKNHSEEERISKLMNYTLREYKDWELKQNEYTTESQTNSKDDQIESLDSLAKRTYDKDI 122
             K+  EE+   KL+NY++++Y+ W+LK+      S  +S+ D       LAK TYDK+I
Sbjct: 51  TFKDQKEEDTRGKLLNYSIKDYEKWQLKRTAKLKNSDGSSQQD-------LAKYTYDKEI 103

Query: 123 RKLNKALRATNSGNKSNKPGKIIKNHRNESNKIVIKDDKFLVEELVNNLKTKSDRLYKHL 182
           R++ K        + S   GK+ K   N   +I I DDK  +E+L +NL   + R Y   
Sbjct: 104 REMEK--------DGSLNRGKVTKARLNGKGRIQINDDKKSLEQLADNLNKSTKRRYI-- 153

Query: 183 GERRKNY----STTLSGHVNTKNQEFNEKLTREWKKL 215
            ER+K      S+T  G +N KN++FNEKL+R++K+ 
Sbjct: 154 -ERKKQAEKLDSSTTGGFINDKNKQFNEKLSRQFKQF 189

>KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakly
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 195

 Score = 84.7 bits (208), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 65/214 (30%), Positives = 111/214 (51%), Gaps = 26/214 (12%)

Query: 3   DINELETSWKTLKEKAENTRINNQHFLTSLRDKSATNNKPKVYSMTDEFDKDELPINDEN 62
           D+N+     K LK K  +  + N+  +     +++   KP VYSM  E    E P ++  
Sbjct: 2   DLNKYADRLKNLKRKGVSLSVKNKQQILQEEKQTSARAKPAVYSMKTE----EAPSSE-- 55

Query: 63  ARKNHSEEERISKLMNYTLREYKDWELKQNEYTTESQTNSKDDQIESLDSLAKRTYDKDI 122
                +EE + +KL+ Y++++++ W+ K      E + + K   +     LAK TYDK++
Sbjct: 56  ----TTEESKEAKLLQYSMKDFEQWQDK------ERRKSQKSSDVAKYQDLAKFTYDKEV 105

Query: 123 RKLNKALRATNSGNKSNKPGKIIKNHRNESNKIVIKDDKFLVEELVNNLKTKSDRLYKHL 182
           ++L K     N  NK  KP K+     N+  KIV+KDD  LV  L ++L   ++  Y  +
Sbjct: 106 QQLRK-----NYTNKVEKPKKV---SINKKGKIVVKDDPHLVGSLADSLNKTANERYARI 157

Query: 183 GER--RKNYSTTLSGHVNTKNQEFNEKLTREWKK 214
            ++  R+  S T  G +N KN++FN+K+ R+ KK
Sbjct: 158 EKKIHRQMVSDTPGGFINEKNKQFNDKIERQTKK 191

>Skud_7.440 Chr7 (729641..730282) [642 bp, 213 aa] {ON} YGR129W
           (REAL)
          Length = 213

 Score = 81.6 bits (200), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 74/221 (33%), Positives = 112/221 (50%), Gaps = 22/221 (9%)

Query: 3   DINELETSWKTLKEKAENTRINNQHFLTSLRDKSATNNKPKVYSMTDEFDKDELPINDEN 62
           ++++L+   K LK K  N  I N+        ++  N KPKVYSM D  D  E P+ D  
Sbjct: 2   ELDKLDQKLKVLKRKGVNVSIKNRKLADREIQEAGLNRKPKVYSMEDVNDGAE-PVED-- 58

Query: 63  ARKNHSEEERISKLMNYTLREYKDWELKQNEYTTESQTNSKDDQIESLDSLAKRTYDKDI 122
                +E     K  +YT++EY  W+ KQN+        S +    S D +AK +Y+K +
Sbjct: 59  -----AETSDKDKAFHYTVQEYNAWKQKQNQRKNGQGQRSGN----SYDQVAKLSYEKTL 109

Query: 123 RKL-------NKALRATNSGNKSNKPGKIIKNHRN-ESNKIVIKDDKFLVEELVNNLKTK 174
           R L       N+     N  N S K G I K  RN ++ KI I DD  LV +L   L+++
Sbjct: 110 RNLVTQNSNKNENSVNKNDSNSSPKNGAIHKIQRNIKTGKIEIVDDDKLVNKLAFTLESE 169

Query: 175 SDRLYKHLGERRKNYST--TLSGHVNTKNQEFNEKLTREWK 213
           S + Y+   ++ +N  T  ++   +N KN++FNEKL+RE K
Sbjct: 170 SKKRYEARRKQMENAKTPSSVESFINDKNKQFNEKLSREPK 210

>Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W
           (SYF2) - (putative) involved in pre-mRNA splicing
           [contig 130] FULL
          Length = 196

 Score = 79.0 bits (193), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 69/218 (31%), Positives = 116/218 (53%), Gaps = 34/218 (15%)

Query: 3   DINELETSWKTLKEKAENTRINNQHFLTSLRDKSATNNKPKVYSMTDEFDKDELPINDEN 62
           D+++     K LK K  +  + N++ +       + + KP VYSM  E  ++E+      
Sbjct: 2   DLSKYADRLKNLKRKRIDLSVKNKNEVIREEKMVSASRKPAVYSMNAEGAEEEIA----- 56

Query: 63  ARKNHSEEERISKLMNYTLREYKDWE--LKQNEYTTESQTNSKDDQIESLDSLAKRTYDK 120
             K+ +E    +KL+ Y++ EY+ W+  +K+N +  E   + +D        LAK TYDK
Sbjct: 57  --KDVTE---ANKLLKYSMLEYEQWQDKVKKNSHRLEGGASFQD--------LAKSTYDK 103

Query: 121 DIRKLNKALRATNSGNKSNKPGKIIKNHRNESNKIVIKDDKFLVEELVNNLKTKSD---- 176
           ++++L+K       GN+ NK  K   N++    KIV++DD+ LV  LV  L   +D    
Sbjct: 104 EVQQLSKI-----DGNRVNKNTKYRVNNKG---KIVVEDDQQLVTGLVETLNKTADERYA 155

Query: 177 RLYKHLGERRKNYSTTLSGHVNTKNQEFNEKLTREWKK 214
           R+ K +G +  N  TT  G++N KN++FN+KL R+ KK
Sbjct: 156 RIQKKIGRQMNN--TTSGGYINEKNKQFNDKLERQTKK 191

>ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 209

 Score = 78.2 bits (191), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 68/214 (31%), Positives = 117/214 (54%), Gaps = 26/214 (12%)

Query: 3   DINELETSWKTLKEKAENTRINNQHFLTSLRDKSATNNKPKVYSMTDEFDKDELPINDEN 62
           D+++    +  LK+K+    + N+  + +   + A   KP+VY +  E  +  LP  D+ 
Sbjct: 12  DLDQFIKDFNALKKKSWEISVENRKLVNAESKELAAGRKPRVYQL--EAPEPSLPTQDDK 69

Query: 63  ARKNHSEEERISKLMNYTLREYKDWELKQNEYTTESQTNSKDDQIESLDSLAKRTYDKDI 122
               H      ++LMNYT+++Y++W  +Q +     QTN +D    +L  +AK TYDK++
Sbjct: 70  ----HG-----NQLMNYTIQQYEEWNSRQRD-----QTNKRDS--GNLQDMAKYTYDKEL 113

Query: 123 RKLNKALRATNSGNKSNKPGKIIKNHRN-ESNKIVIKDDKFLVEELVNNL-KTKSDRLYK 180
            KL+K    T   N+    G I K +RN ++ K+ IKDD  LV++L  ++ KT ++R   
Sbjct: 114 NKLHK---DTMLQNRYTNGGSIQKMNRNPKTGKLTIKDDDQLVKKLAKDMDKTATERYEA 170

Query: 181 HLGE-RRKNY--STTLSGHVNTKNQEFNEKLTRE 211
              E  R N   +++  G++N KN++FNEKL R+
Sbjct: 171 RRREMERSNVQNASSGGGYINEKNKQFNEKLDRQ 204

>NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON}
           Anc_3.490 YGR129W
          Length = 202

 Score = 76.3 bits (186), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 67/215 (31%), Positives = 113/215 (52%), Gaps = 25/215 (11%)

Query: 1   MYDINELETSWKTLKEKAENTRINNQHFLTSLRDKSATNNKPKVYSMTDEFDKDELPIND 60
           M D+       K LK KA++  I N+  +        ++ KP+VY+M D+ D ++L   +
Sbjct: 1   MIDLEGYSRKLKELKRKAQDATIENRLLVDRESKDIESSGKPRVYNMQDDQD-NQLETQE 59

Query: 61  ENARKNHSEEERISKLMNYTLREYKDWELKQNEYTTESQTNSKDDQIESLDSLAKRTYDK 120
           E+A      +++++KLMNYTLR+Y++WE KQ +   +  ++        +  LA  +YDK
Sbjct: 60  EDA------DDKVAKLMNYTLRQYEEWEKKQKDKKIKDDSS-------DMKQLAMFSYDK 106

Query: 121 DIRKLNKALRATNSGNKSNKPGKIIKNHRNESNKIVIKDDKFLVEELVNNLKTKSDRLY- 179
            +  LN   R       + +  +I  N +  + K+ I+D+K LV +L  NL   +++ Y 
Sbjct: 107 GVSNLN---RFRTDKTTTEREVQIQVNSK--TGKVNIQDEKKLVNDLAKNLTKTANKRYM 161

Query: 180 ---KHLGERRKNYSTTLSGHVNTKNQEFNEKLTRE 211
              K L  R K+ S    G++N +N+ FNEKL RE
Sbjct: 162 VTKKKLDARSKDSSA--EGYINERNKHFNEKLDRE 194

>TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3.490
           YGR129W
          Length = 193

 Score = 73.9 bits (180), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 64/214 (29%), Positives = 107/214 (50%), Gaps = 29/214 (13%)

Query: 3   DINELETSWKTLKEKAENTRINNQHFLTSLRDKSATNNKPKVYSMTDEFDKDELPINDEN 62
           D+  +E  +K LK+++ +  I  +          +   KPK+YSM D         N+  
Sbjct: 2   DLESIENRFKDLKKRSVDVAIQIRKIAEREAKDESLVGKPKIYSMED--------TNEMG 53

Query: 63  ARKNHSEEERISKLMNYTLREYKDWELKQNEYTTESQTNSKDDQIESLDSLAKRTYDKDI 122
            R   S E R  KLMNY++REY++W+ KQ     E +    + Q      LAK +Y+KD+
Sbjct: 54  TRPVDSSERRRLKLMNYSMREYEEWDKKQK--GKEVKRGGANVQ-----ELAKYSYEKDL 106

Query: 123 RKLNKALRATNSGNKSNKPGKIIKNHRN-ESNKIVIKDDKFLVEELVNNLK--TKSDRLY 179
                      S +K N   +++K   + ++N++ +KDD+ LV +L N+LK  T+   L 
Sbjct: 107 -----------SRSKQNNGNRVVKISTDAKTNRLQVKDDEKLVNKLANDLKKTTRERFLA 155

Query: 180 KHLGERRKNYSTTLSGHVNTKNQEFNEKLTREWK 213
           +     + +   T  G++N KN++FN KL R+ K
Sbjct: 156 RKKDMEKADARATPGGYINEKNKQFNLKLDRQMK 189

>YGR129W Chr7 (750400..751047) [648 bp, 215 aa] {ON}  SYF2Member of
           the NineTeen Complex (NTC) that contains Prp19p and
           stabilizes U6 snRNA in catalytic forms of the
           spliceosome containing U2, U5, and U6 snRNAs; isy1 syf2
           cells have defective spindles activiating cell cycle
           arrest
          Length = 215

 Score = 71.6 bits (174), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 72/227 (31%), Positives = 113/227 (49%), Gaps = 32/227 (14%)

Query: 3   DINELETSWKTLKEKAENTRINNQHFLTSLRDKSATNNKPKVYSMTDEFDKDELPINDEN 62
           D  +L+   K LK K  +  I ++        + + N KP+VYSM D  D DE   + E+
Sbjct: 2   DFYKLDEKLKELKRKRVDVSIKSRKLADREIQEVSANRKPRVYSMEDVNDADESVGDTES 61

Query: 63  ARKNHSEEERISKLMNYTLREYKDWELKQNEY-TTESQTNSKDDQIESLDSLAKRTYDKD 121
             K         K  +YT++EY  WE +  +  T +SQ         S D LAK +Y+K 
Sbjct: 62  PEKE--------KAFHYTVQEYDAWERRHPQGKTGQSQRGGI-----SYDQLAKLSYEKT 108

Query: 122 IRKLNKALRATNSGNKSN-----------KPGKIIKNHRN-ESNKIVIKDDKFLVEELVN 169
           +R L  A +  NS  + +           K G+I K  ++ ++ KI I DD  LV +L  
Sbjct: 109 LRNL--ATQTQNSSKQDSSADEEDNKNVPKKGRIGKVQKDTKTGKITIADDDKLVNKLAV 166

Query: 170 NLKTKSDRLYKHLGERRKNYSTTLSG---HVNTKNQEFNEKLTREWK 213
           +L+++S + Y+    + +N + TL G    +N KN++FNEKL+RE K
Sbjct: 167 SLQSESKKRYEARKRQMQN-AKTLYGVESFINDKNKQFNEKLSRESK 212

>Ecym_1239 Chr1 complement(491113..491694) [582 bp, 193 aa] {ON}
           similar to Ashbya gossypii AFR308W
          Length = 193

 Score = 71.2 bits (173), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 72/222 (32%), Positives = 108/222 (48%), Gaps = 39/222 (17%)

Query: 3   DINELETSWKTLKEKAENTRINNQHFLTSLRDKSATNNKPKVYSMTDEFDKDELPINDEN 62
           DI+++ +  + LK K  +  I N+  + S        +KP+VYS           INDE 
Sbjct: 2   DIDDISSRLRRLKSKRVDISIKNRKEIVSEEVLQVGRSKPEVYS-----------INDEG 50

Query: 63  ARKNH----SEEERISKLMNYTLREYKDWELKQNEYTTESQTNSKDDQIESLDSLAKRTY 118
           A  N     S  ER  KL+NY+L +Y+ W+ K+ +   +  T S D        +A  TY
Sbjct: 51  AAVNEVQSTSNTER-RKLLNYSLIDYEKWDEKEKQANFDG-TYSGD--------IAYSTY 100

Query: 119 DKDIRKLNKALRATNSGNKSNKPGKIIKNHRNESNKIVIKDDKFLVEELVNNL-KTKSDR 177
             +I++L K              GKI K   +ES K+ I+D+K LV +L   L KT  +R
Sbjct: 101 KNEIKQLRKG---------GLTKGKITKGRISESGKVAIEDEKELVNKLAQTLEKTSRER 151

Query: 178 LY---KHLGERRKNYSTTLSGHVNTKNQEFNEKLTREWKKLS 216
                K L   + N ++ L   VN KN+ FNEKL+R++K+L 
Sbjct: 152 FLREKKRLDGHKAN-TSELGNFVNEKNRHFNEKLSRQFKELG 192

>KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 221

 Score = 69.7 bits (169), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 63/215 (29%), Positives = 106/215 (49%), Gaps = 31/215 (14%)

Query: 1   MYDINELETSWKTLKEKAENTRINNQHFLTSLRDKSATNNKPKVYSMTDEFDKDELPIND 60
           M D+ E+E   K+L+++     I N+  + +   K   N++ +VYSM D+         +
Sbjct: 36  MNDLMEIEKKLKSLRKQKVEVSIRNKKAIIAEEKK---NSERRVYSMADD--------GE 84

Query: 61  ENARKNHSEEERISKLMNYTLREYKDWELKQNEYTTESQTNSKDDQIESLDSLAKRTYDK 120
           + AR N SE E   KL NY++REY+ WE K    T  S+ N     +    ++AK +Y K
Sbjct: 85  DKARSNKSEPEDPIKLANYSIREYEKWEAK----TQNSRHNK--SVMGDFQTIAKNSYKK 138

Query: 121 DIRKLNKALRATNSGNKSNKPGKIIKNHRNESNKIVIKDDKFLVEELVNNLKTKSDRLYK 180
           ++  L K +               +K    E  K+ ++D+  LVE++VN+L  +S + Y 
Sbjct: 139 EVDALPKDISHP------------LKGGITEDGKVQVEDNPELVEKMVNDLNERSKKRYM 186

Query: 181 HLGER--RKNYSTTLSGHVNTKNQEFNEKLTREWK 213
              ++  ++N      G +N KN+ FN KL  E+K
Sbjct: 187 VRKQKLDKQNKINLDDGFINDKNKRFNAKLNSEFK 221

>Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON}
           complement(32143..32766) [624 nt, 208 aa]
          Length = 207

 Score = 67.0 bits (162), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 70/229 (30%), Positives = 113/229 (49%), Gaps = 38/229 (16%)

Query: 3   DINELETSWKTLKEKAENTRINNQHFLTSLRDKSATNNKPKVYSMTDEFDKDELPINDEN 62
           +I E    +K LK KA +  I N+  L +   +   N+KPK YSM +  + D +      
Sbjct: 4   EIKEALEEFKRLKRKAVDILIENRKLLDANTRELKKNSKPKTYSMEELAEDDTV------ 57

Query: 63  ARKNHSEEERISKLMNYTLREYKDWELKQ-----NEYTTESQTNSKDDQIESLDSLAKRT 117
              N    +   +L+NY++REY++WE KQ     N + T+S  N       S   +AK T
Sbjct: 58  ---NTGTVDEADRLLNYSIREYEEWEKKQGRHKENVHVTKSSVN-------STAQIAKFT 107

Query: 118 YDKDIRKLNKALRATNSGNKSNKPGKIIKNHRNESNKIVIKDDKFLVEELVNNLKTKSDR 177
           YDK   ++ K  +  ++ +   K  KI K+ +  + KIV+ D K L+++L  +L   +  
Sbjct: 108 YDK---QIKKLQKQKSTNDNRGKISKIRKDPK--TGKIVVNDSKQLIKQLAEDLNQTTKE 162

Query: 178 LYKHLGERRK-------NYSTTLSGHVNTKNQEFNEKLTREWKKLSNSI 219
            Y    ++R+       NYS     ++N KN+EFN+KL R+  KL   I
Sbjct: 163 RYDRTNQKRQKNSDQNENYS-----YINEKNKEFNDKLERQETKLLKDI 206

>Suva_7.417 Chr7 (720529..721167) [639 bp, 212 aa] {ON} YGR129W
           (REAL)
          Length = 212

 Score = 65.9 bits (159), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 66/219 (30%), Positives = 106/219 (48%), Gaps = 23/219 (10%)

Query: 3   DINELETSWKTLKEKAENTRINNQHFLTSLRDKSATNNKPKVYSMTDEFDKDELPINDEN 62
           D+ EL    K LK +  +  +  +        ++++N KP+VYSM D  D       DE 
Sbjct: 2   DLEELGNKLKELKRRRVDASLKTRKLADREIQEASSNRKPRVYSMEDASD-------DEL 54

Query: 63  ARKNHSEEERISKLMNYTLREYKDWELKQNEYTTESQTNSKDDQIESLDSLAKRTYDKDI 122
            R+  S+++   +  +YT++EY  WE KQ +  +     + +    S D LAK +YDK +
Sbjct: 55  VRETKSDDK--DRAFHYTVQEYNAWEQKQKQRKSGKTQGTGN----SYDQLAKLSYDKTL 108

Query: 123 RKL-----NKALRATNSGNKSNKPGK--IIKNHRNE-SNKIVIKDDKFLVEELVNNLKTK 174
           R L      K   + N  +     GK  I K  +N  + KI I DD  LV +L + L++ 
Sbjct: 109 RNLTTQNYGKHESSVNEKDSKGSLGKSRIEKIQKNSITGKIRIVDDDELVNKLASTLESD 168

Query: 175 SDRLYKHLGERRKNYST--TLSGHVNTKNQEFNEKLTRE 211
           S + +     + +N  T   +   +N KN++FNEKL RE
Sbjct: 169 SKKRHDARKRQMENVKTPSGVESFINDKNKQFNEKLGRE 207

>CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa]
           {ON} similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129w
          Length = 200

 Score = 61.2 bits (147), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 60/204 (29%), Positives = 105/204 (51%), Gaps = 29/204 (14%)

Query: 12  KTLKEKAENTRINNQHFLTSLRDKSATNNKPKVYSM-TDEFDKDELPINDENARKNHSEE 70
           K LK+  ++ +I N++ L    ++     KP+VYSM  DE D DE   +DE +       
Sbjct: 11  KLLKKSVQDIKIRNRNLLKQEAEEKEKGLKPRVYSMHDDEDDSDEKRSSDEQS------- 63

Query: 71  ERISKLMNYTLREYKDWELKQNEYTTESQTNSKDDQIESLDSLAKRTYDKDIRKLNKA-- 128
           +  + L  YT++++ DWE +Q         +    +++    LAK TYDK+++ L +   
Sbjct: 64  DMRTNLFQYTVQDFIDWEKRQQRKKKSKLESKSGMRLQ---HLAKNTYDKELQNLPRPEF 120

Query: 129 -LRATNSGNKSNKPGKIIKNHRNESNKIVIKDDKFLVEELVNNLKTKSDRLY---KHLGE 184
            ++A  +  + NK          +S K+ IKD+K LV+ L  NLK  + + Y   + +  
Sbjct: 121 KMKAKETQFRINK----------DSGKVNIKDNKELVQRLSQNLKETAKQRYDSNRKIAN 170

Query: 185 RRKNYSTTLSGHVNTKNQEFNEKL 208
            +++  T+LSG +N KN +FN+ L
Sbjct: 171 DKEH--TSLSGSINAKNLQFNKSL 192

>Smik_6.225 Chr6 (368227..368868) [642 bp, 213 aa] {ON} YGR129W
           (REAL)
          Length = 213

 Score = 60.1 bits (144), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 67/220 (30%), Positives = 110/220 (50%), Gaps = 26/220 (11%)

Query: 4   INELETSWKTLKEKAENTRINNQHFLTSLRDKSATNNKPKVYSMTDEFDKDELPINDENA 63
           +++LE   K LK+K  N  I N+        ++  N KP+VY+M D        IND + 
Sbjct: 3   LDQLEQRLKELKKKRVNVSIKNRKLADREIQEANVNRKPRVYNMED--------INDVDE 54

Query: 64  RKNHSEEERISKLMNYTLREYKDWELKQNEYTTESQTNSKDDQIESLDSLAKRTYDKDIR 123
              ++E     +  +YT +EY  WE + ++        SK   I S D LAK +Y+K +R
Sbjct: 55  SVGYTESSDKDRAFHYTAQEYIAWEQRHHQRKI---GQSKRSGI-SYDQLAKLSYEKTLR 110

Query: 124 KLNKALRA-----TNSGNKSN--KPGKIIKNHRN-ESNKIVIKDDKFLVEELVNNLKTKS 175
            L     +      N  +  N  K  +I +  ++ ++ KI I DD  LV +L  +L+++S
Sbjct: 111 NLATQDLSEYDNFVNEKDHKNISKISRIDRIQKDTKTGKIRIADDHKLVNKLAVSLESES 170

Query: 176 DRLYKHLGERRKNYSTTL-SG---HVNTKNQEFNEKLTRE 211
            + Y+    +R+  S  + SG    +N KN++FNEKL+RE
Sbjct: 171 KKRYE--ARKRQMESAVIPSGVESFINDKNKQFNEKLSRE 208

>AFR308W Chr6 (999495..1000073) [579 bp, 192 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR129W (SYF2)
          Length = 192

 Score = 59.3 bits (142), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/215 (27%), Positives = 104/215 (48%), Gaps = 32/215 (14%)

Query: 4   INELETSWKTLKEKAENTRINNQHFLTSLRDKSATNNKPKVYSMTDEFDKDELPINDENA 63
           I ++    + LK+K  +  I N+    S         KP+VYSM +E          + A
Sbjct: 3   IEDINRRLRQLKKKRVDASIRNRKEAASEERARLAEGKPRVYSMAEE--------PADEA 54

Query: 64  RKNHSEEERISKLMNYTLREYKDWELKQNEYTTESQTNSKDDQIESLDSLAKRTYDKDIR 123
             + ++ E++ KL+NY + +Y+ W+ KQ  +   S           L  LA  TY  ++ 
Sbjct: 55  EADDTQSEQL-KLLNYRIADYEKWDEKQKRHKQPSDG-------ADLGELANSTYRSELH 106

Query: 124 KLNKALRATNSGNKSNKPGKIIKNHRNESNKIVIKDDKFLVEELVNNLKTKSDRLYKHLG 183
           +L++  R    G  +N  G+I     + S K+V+ D+  LVE+L   ++  + R ++   
Sbjct: 107 QLHR--RGVVKGRATN--GRI-----SASGKVVLDDEPELVEKLAAAVQQTAKRRHE--- 154

Query: 184 ERRKNYS----TTLSGHVNTKNQEFNEKLTREWKK 214
           ER+K  +       +G +N KN+ FNEKL RE++K
Sbjct: 155 ERQKKAAKDGGRATAGSLNDKNRHFNEKLDREFRK 189

>NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON}
           Anc_3.490 YGR129W
          Length = 213

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 59/187 (31%), Positives = 94/187 (50%), Gaps = 15/187 (8%)

Query: 37  ATNNKPKVYSMTDEFDKDELPIN-DENARKNHSEEERISKLMNYTLREYKDWELKQNEYT 95
           + ++KPKVY +    D D    + D     ++ EE+R  KLMNYT+REY++W+ +Q +  
Sbjct: 39  SQSSKPKVYDIKAVEDDDNHHTDYDGLGDFSNEEEKRKFKLMNYTIREYEEWDKQQKDKQ 98

Query: 96  TESQTNSKDDQIESLDSLAKRTYDKDIRKLNKALRATNSGNKSNKPGKIIKNHRNESNKI 155
            +    S       L  LA  TY+K++ KLN  L   +   K     +I  N RN   K+
Sbjct: 99  RKRVDGS------DLTELATFTYEKELSKLNSKLENISHEQKH----QIGVNTRN--GKL 146

Query: 156 VIKD-DKFLVEELVNNLKTKSDRLYKHLGERRKNYSTTLSG-HVNTKNQEFNEKLTREWK 213
            +KD ++ L   + N  +T   R      + +   S+ ++G +   KN++FNEKL RE K
Sbjct: 147 NVKDEERLLNNLVNNLNETAKKRYMVRKKKLQSKASSDIAGNYFKDKNKQFNEKLERELK 206

Query: 214 KLSNSID 220
           +  N  D
Sbjct: 207 ERDNGGD 213

>TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.490
           YGR129W
          Length = 209

 Score = 46.6 bits (109), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 63/218 (28%), Positives = 110/218 (50%), Gaps = 24/218 (11%)

Query: 3   DINELETSWKTLKEKAENTRINNQHFLTSLRDKSATNNKPKVYSMTDEFDKDELPINDEN 62
           D+  L   +K LK++A ++ I ++ FL +   +  +  KPKVYS+    D D      ++
Sbjct: 2   DMVSLIDEFKVLKKQALDSLIEDRKFLEADEKERKSVLKPKVYSIN--MDDDGDGDAGDD 59

Query: 63  ARKNHSEEERISKLMNYTLREYKDWE--LKQNEYTTESQTNSKDDQIESLDSLAKRTYDK 120
              N+SE      L+ YT+R+Y++WE  LK+      + + S   Q ++    AK TYDK
Sbjct: 60  LLTNNSERA----LLTYTIRDYEEWEESLKRKHKNVTNTSTSSSSQQQT----AKFTYDK 111

Query: 121 DIRKLNKALRATNSGNKSNKPGKIIKNHRNESNKIVIKDDKFLVEELVNNL-KTKSDRLY 179
           +I ++ K  +   + ++    G  +K   ++  K++IKDDK LV   ++++ K  +DR  
Sbjct: 112 EIHRMKKR-QGKFATDEEITRGSAMKEVLDDG-KLLIKDDKHLVNGFISDINKVSNDRYI 169

Query: 180 KHLGERRKNYSTTLS---------GHVNTKNQEFNEKL 208
           K +     N   T S          + N KN++FN+KL
Sbjct: 170 KRMKLNAVNNDATGSKVSHDKGKTSYNNAKNKDFNDKL 207

>KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON}
           Anc_3.490 YGR129W
          Length = 207

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 56/216 (25%), Positives = 94/216 (43%), Gaps = 59/216 (27%)

Query: 4   INELETSWKTLKEKAENTRINNQHFLTSLRDKSATNNKPKVYSM------TDEFDKDELP 57
           + EL   +KTL ++++  R+        +R + A   KPKVYS+       D  D  E+ 
Sbjct: 37  LTELRDKFKTLSQESQRLRVR-------IRKQQAEVEKPKVYSLQAAEPSVDGIDGAEVV 89

Query: 58  INDENARKNHSEEERISKLMNYTLREYKDWELKQNEYTTESQTNSKDDQIESL--DSLAK 115
            N               KL+N  LR+ +  E ++ E        + DD +  +  D +AK
Sbjct: 90  DNV------------TVKLLNTPLRQLEAREARRGE--------NGDDAVARVEGDRVAK 129

Query: 116 RTYDKDIRKLN-KALRATNSGNKSNKPGKIIKNHRNESNKIVIKDDKFLVEELVNNLKTK 174
            TY K++  L  K+ R T   N        +  H N+ +K      ++LV +  N +K +
Sbjct: 130 DTYKKELALLGRKSTRGTYRDNVER-----LVTHLNDVSK-----KRYLVRK--NKMKRQ 177

Query: 175 SDRLYKHLGERRKNYSTTLSGHVNTKNQEFNEKLTR 210
             R             ++L G++N KN++FN+KL R
Sbjct: 178 GAR-----------GGSSLDGYINEKNKQFNKKLQR 202

>KLLA0A06952g Chr1 complement(628173..630323) [2151 bp, 716 aa] {ON}
           similar to uniprot|Q05497 Saccharomyces cerevisiae
           YDR338C
          Length = 716

 Score = 39.3 bits (90), Expect = 0.005,   Method: Composition-based stats.
 Identities = 24/88 (27%), Positives = 50/88 (56%), Gaps = 6/88 (6%)

Query: 25  NQHFLTSLRDKSATNNKPKVYSMTDEFDKDELPINDENARKNHSEEERISKLMNYTLREY 84
           ++ F +S+R+ S  ++  +V    DE+D+D  P++     +  S   R+S+  N + ++ 
Sbjct: 74  DEDFGSSVREPSVYDDLDEVLEDIDEYDEDGEPLS-----RTVSLPSRVSEPSNVS-QQN 127

Query: 85  KDWELKQNEYTTESQTNSKDDQIESLDS 112
            DW L+++E    S  NS++D+ E L++
Sbjct: 128 LDWLLEEHERRFSSSQNSENDEDEDLEN 155

>KAFR0C01950 Chr3 (390143..390616) [474 bp, 157 aa] {ON} Anc_3.490
           YGR129W
          Length = 157

 Score = 37.4 bits (85), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 48/209 (22%), Positives = 83/209 (39%), Gaps = 61/209 (29%)

Query: 3   DINELETSWKTLKEKAENTRINNQHFLTSLRDKSATNNKPKVYSMTDEFDKDELPINDEN 62
           D+  L   ++ L++K    +I N+  ++         +KPK YS+ +E    E+   DE+
Sbjct: 4   DMANLREEFRDLRKKCREIKIENRKLIS-------IASKPKTYSIREEEIGAEVSDEDED 56

Query: 63  ARKNHSEEERISKLMNYTLREYKDWELKQNEYTTESQTNSKDDQIESLDSLAKRTYDKDI 122
                  +  I KL+   LRE++          TE+      + I+ L      TY+K++
Sbjct: 57  -------DSEIIKLLTKPLREFE----------TEAHVAENKEDIDRL------TYNKEV 93

Query: 123 RKLNKALRATNSGNKSNKPGKIIKNHRNESNKIVIKDDKFLVEELVNNLKTKSDRLYKHL 182
             L K                                +K  VE LV+ +   SD  YK  
Sbjct: 94  MSLGKR-------------------------------EKRDVESLVSEMNRISDERYKKG 122

Query: 183 GERRKNYSTTLSGHVNTKNQEFNEKLTRE 211
            ++R+    T  G +N +N+ FN +L +E
Sbjct: 123 AQKRRRLKDTERGFINEQNKAFNLRLEKE 151

>SAKL0D04070g Chr4 (331254..333257) [2004 bp, 667 aa] {ON} similar
           to uniprot|P38227 Saccharomyces cerevisiae YBR043C QDR3
           Multidrug transporter required for resistance to
           quinidine barban cisplatin and bleomycin member of the
           major facilitator superfamily of transporters conferring
           multiple drug resistance (MFS-MDR)
          Length = 667

 Score = 36.2 bits (82), Expect = 0.061,   Method: Composition-based stats.
 Identities = 28/99 (28%), Positives = 44/99 (44%), Gaps = 15/99 (15%)

Query: 59  NDENARKNHSEEERISKLMNYTLREYKDWELKQNEYTTESQTNSKDDQIESLDS----LA 114
           NDEN+ +   E+ RI ++M YT         +   Y  E+  +    QI  + S    L 
Sbjct: 324 NDENSDE---EDSRIERMMTYTS--------EVPNYIVENYLDPGAPQISKIQSHDPKLE 372

Query: 115 KRTYDKDIRKLNKALRATNSGNKSNKPGKIIKNHRNESN 153
           +R  + D++KL   L       ++ K GK   NH  +SN
Sbjct: 373 QRVRENDLKKLKTNLENEIERIETRKSGKSNANHNQQSN 411

>CAGL0M10527g Chr13 complement(1052421..1059914) [7494 bp, 2497 aa]
            {ON} similar to uniprot|P35194 Saccharomyces cerevisiae
            YBL004w
          Length = 2497

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 65/169 (38%), Gaps = 34/169 (20%)

Query: 47   MTDEFDKDELPINDENARKNHSEEERISKLMNYTLREYKDWELKQNEYTTESQTNSKDDQ 106
            + D   KDE+ I   N  KN  EE+   KLM Y LR    +   Q   T+ S+ +SK   
Sbjct: 894  LNDTLFKDEITIFFANKEKNQLEEQHEIKLMPYILRIL--YGRAQTPITSGSKKSSKYAV 951

Query: 107  IESLDSLAKRTYDKDIRKLNKALRATNSGNKSNKPGKIIKNHRNESNKIVIKDDKFLVEE 166
            +  L +  KR Y  D   L      T +G    K                  D K+ V++
Sbjct: 952  VSVLPNF-KRKYIIDFLSL------TYNGLAFEK----------------FFDKKYAVDK 988

Query: 167  LVNNLKTKSDRLYKHLGERRKNYSTTLSGHVNTKNQEFNEKLTREWKKL 215
                     D L +   +R   + T +SG + T   +F+ +L    K L
Sbjct: 989  ---------DDLTQGTLKRMSGFVTLMSGVIGTLGSKFSIELATVLKPL 1028

>Suva_13.216 Chr13 complement(347922..351272) [3351 bp, 1116 aa]
           {ON} YMR047C (REAL)
          Length = 1116

 Score = 31.2 bits (69), Expect = 2.3,   Method: Composition-based stats.
 Identities = 41/172 (23%), Positives = 78/172 (45%), Gaps = 11/172 (6%)

Query: 7   LETSWKTLKEKAENTRINNQHFLTSLRDKSATNNKPKVYSMTDEFDKDELPINDENARKN 66
           L ++++ + +    T++N+ + +    DK+ T N PK+Y   D+ +      N +    +
Sbjct: 784 LSSAYRMVPKTLFTTKLNSNNVVM---DKAKTKNDPKLYISLDKKNNQATISNQQEENLD 840

Query: 67  HSEEERISKLMNYTLREYKDWELKQNEYT-TESQTN--SKDDQIESLDSLAKRTYDKDIR 123
            S  +  + L N   R +K+    +   T TE + N  S     +   S  + T    ++
Sbjct: 841 ESILKASNLLFNPDKRSFKNLINNKKLLTATEEKKNGLSNSSTSKKSKSSEQGTIPAMVQ 900

Query: 124 KLNKALRATNSGNKSNKPGKIIKNHRNESNKIVIKDDKFLVEELVNNLKTKS 175
            + K    T SGN S  P KII+ +  +S    + ++    +E + +LKTKS
Sbjct: 901 VVEK--ETTGSGNSSTLPSKIIEQNNTKSQLRSVDEEN---KENIVDLKTKS 947

>NDAI0G00980 Chr7 complement(203951..204655) [705 bp, 234 aa] {ON}
           Anc_3.486 YGR126W
          Length = 234

 Score = 30.0 bits (66), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 46/106 (43%), Gaps = 8/106 (7%)

Query: 29  LTSLRDKSATNNKPKVYSMTDEFDKDELPINDENARKNHSEEERISKLMNYTLREYKDWE 88
            T L+     N +P   + T E D D+  I+  +    H EE   S+    TL   K  +
Sbjct: 34  FTGLKGNELPNAQPSTTATTTEQDHDDTVISSHSHDTKHGEEP--SRTSTATL---KKLD 88

Query: 89  LKQNEYTTESQTNSKDDQIESLDSLAKR---TYDKDIRKLNKALRA 131
              N+      TN  +D+ E+LDSL K+   T  K +  +N  L A
Sbjct: 89  SNVNDIEKTMTTNIMNDKTETLDSLVKQGLNTRKKSVADINTPLNA 134

>TDEL0D01340 Chr4 complement(257445..259457) [2013 bp, 670 aa] {ON}
           Anc_1.265 YJL101C
          Length = 670

 Score = 30.0 bits (66), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 35/73 (47%), Gaps = 12/73 (16%)

Query: 11  WKTLKEKAENTRINNQHFLTSLRDKSATNNKPKVYSMTDEFDKDELPINDENARKNHSEE 70
           W+ LKE +E+ R+   ++   L    A+   P +     +F  D          K++ ++
Sbjct: 573 WEELKESSEHLRL---YYYLKLISNRASGKTPSIAKFLRDFVLDH---------KDYKQD 620

Query: 71  ERISKLMNYTLRE 83
            R+SK++NY L E
Sbjct: 621 SRVSKIINYDLLE 633

>Skud_16.57 Chr16 (106443..108842) [2400 bp, 799 aa] {ON} YGL139W
           (REAL)
          Length = 799

 Score = 29.6 bits (65), Expect = 7.6,   Method: Composition-based stats.
 Identities = 37/165 (22%), Positives = 68/165 (41%), Gaps = 35/165 (21%)

Query: 5   NELETSWKTLKEKAENTRINNQHFLTSLRDKSATNNKPKVYSMTDEFDKDELPINDENAR 64
           NEL       K+  EN     +H L S  ++S  N           +D ++   N +NA 
Sbjct: 623 NELMALGNVAKDHTENW----EHELKSQENRSEDN----------LYDDEKTGTNSDNAE 668

Query: 65  KNHSEEERISKLMNYTLREYKDWELKQNEYTTESQTNSKDDQIESLDSLAKRTYDKDIRK 124
            +  +  R +    ++ +  +   +K+N+    S+        E+ D  A+R Y  D   
Sbjct: 669 TSSKDTSRPT----FSEKVLRSLSIKRNKSKLGSRRG------ETPDKSAQRGYTPD--- 715

Query: 125 LNKALRATNSGNKSNKPGKIIKNHRNESNKIVI---KDDKFLVEE 166
                RA+ S N  + PG +     +E+N  +I   +D++F + E
Sbjct: 716 -----RASPSSNTKSYPGGMHMRQASEANNGLINAYEDEQFSLSE 755

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.306    0.124    0.339 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 28,269,900
Number of extensions: 1409104
Number of successful extensions: 8849
Number of sequences better than 10.0: 800
Number of HSP's gapped: 8698
Number of HSP's successfully gapped: 864
Length of query: 222
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 117
Effective length of database: 41,441,469
Effective search space: 4848651873
Effective search space used: 4848651873
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 63 (28.9 bits)