Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0C044603.489ON69869833950.0
Kpol_480.163.489ON65570115430.0
TPHA0D042303.489ON65270514810.0
ZYRO0D10054g3.489ON66471114620.0
TDEL0D055703.489ON64970614600.0
NCAS0E008303.489ON67171914090.0
Suva_7.4163.489ON71373314020.0
YGR128C (UTP8)3.489ON71372913850.0
Skud_7.4393.489ON71373813830.0
Smik_6.2243.489ON70573113780.0
SAKL0F02838g3.489ON65470312901e-169
KLTH0F14762g3.489ON65070312861e-168
AFR307C3.489ON65072212701e-166
CAGL0I10560g3.489ON67870912421e-161
NDAI0G009603.489ON70075412221e-158
KLLA0E04665g3.489ON64770412111e-157
Kwal_55.212223.489ON3733898571e-108
KAFR0C019403.489ON6095537049e-83
KNAG0B008303.489ON6077236751e-78
Kwal_55.21225singletonOFF2152453972e-43
TBLA0A003808.493ON86379716.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0C04460
         (698 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0C04460 Chr3 complement(1080461..1082557) [2097 bp, 698 aa] ...  1312   0.0  
Kpol_480.16 s480 (33288..35255) [1968 bp, 655 aa] {ON} (33288..3...   598   0.0  
TPHA0D04230 Chr4 complement(913504..915462) [1959 bp, 652 aa] {O...   575   0.0  
ZYRO0D10054g Chr4 (847992..849986) [1995 bp, 664 aa] {ON} simila...   567   0.0  
TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa] ...   566   0.0  
NCAS0E00830 Chr5 (151952..153967) [2016 bp, 671 aa] {ON} Anc_3.4...   547   0.0  
Suva_7.416 Chr7 complement(718089..720230) [2142 bp, 713 aa] {ON...   544   0.0  
YGR128C Chr7 complement(747950..750091) [2142 bp, 713 aa] {ON}  ...   538   0.0  
Skud_7.439 Chr7 complement(727211..729352) [2142 bp, 713 aa] {ON...   537   0.0  
Smik_6.224 Chr6 complement(365799..367916) [2118 bp, 705 aa] {ON...   535   0.0  
SAKL0F02838g Chr6 (240272..242236) [1965 bp, 654 aa] {ON} simila...   501   e-169
KLTH0F14762g Chr6 complement(1209571..1211523) [1953 bp, 650 aa]...   499   e-168
AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON} S...   493   e-166
CAGL0I10560g Chr9 (1043862..1045898) [2037 bp, 678 aa] {ON} simi...   483   e-161
NDAI0G00960 Chr7 (199784..201886) [2103 bp, 700 aa] {ON} Anc_3.4...   475   e-158
KLLA0E04665g Chr5 (414183..416126) [1944 bp, 647 aa] {ON} simila...   471   e-157
Kwal_55.21222 s55 complement(736354..737475) [1122 bp, 373 aa] {...   334   e-108
KAFR0C01940 Chr3 complement(387789..389618) [1830 bp, 609 aa] {O...   275   9e-83
KNAG0B00830 Chr2 (151939..153762) [1824 bp, 607 aa] {ON} Anc_3.4...   264   1e-78
Kwal_55.21225 s55 complement(737726..738370) [645 bp, 215 aa] {O...   157   2e-43
TBLA0A00380 Chr1 complement(71855..74446) [2592 bp, 863 aa] {ON}...    32   6.6  

>TBLA0C04460 Chr3 complement(1080461..1082557) [2097 bp, 698 aa]
           {ON} Anc_3.489 YGR128C
          Length = 698

 Score = 1312 bits (3395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 664/698 (95%), Positives = 664/698 (95%)

Query: 1   MPSLSQPFRLAVLPKIASLSNYSLQTDYLQVAPDTFTYDTNKVTLXXXXXXXXXXXXNPT 60
           MPSLSQPFRLAVLPKIASLSNYSLQTDYLQVAPDTFTYDTNKVTL            NPT
Sbjct: 1   MPSLSQPFRLAVLPKIASLSNYSLQTDYLQVAPDTFTYDTNKVTLGISGSGISQYIINPT 60

Query: 61  PKLLFNIAIPSTNNVTASNISHYIEEVENANSTVTTDKSDLVDKDNMESTEEVSVAENTD 120
           PKLLFNIAIPSTNNVTASNISHYIEEVENANSTVTTDKSDLVDKDNMESTEEVSVAENTD
Sbjct: 61  PKLLFNIAIPSTNNVTASNISHYIEEVENANSTVTTDKSDLVDKDNMESTEEVSVAENTD 120

Query: 121 VTKRSVELWAYGLVANKSNTLNISVKTTGLDEFSTTPGEIIRKKTIKVDSKVVNIKIFKE 180
           VTKRSVELWAYGLVANKSNTLNISVKTTGLDEFSTTPGEIIRKKTIKVDSKVVNIKIFKE
Sbjct: 121 VTKRSVELWAYGLVANKSNTLNISVKTTGLDEFSTTPGEIIRKKTIKVDSKVVNIKIFKE 180

Query: 181 FKTIVVVLKNGLVKLFDFDLNLKSSLDIAYNDVQFVQHFTESKQNFLLILSNIDEEKSSV 240
           FKTIVVVLKNGLVKLFDFDLNLKSSLDIAYNDVQFVQHFTESKQNFLLILSNIDEEKSSV
Sbjct: 181 FKTIVVVLKNGLVKLFDFDLNLKSSLDIAYNDVQFVQHFTESKQNFLLILSNIDEEKSSV 240

Query: 241 CFKLYQLRLDSDSNQVSELSFSILQDFDLSKSKLSYQFGKLYRLTGSELFVYSLPQCQLL 300
           CFKLYQLRLDSDSNQVSELSFSILQDFDLSKSKLSYQFGKLYRLTGSELFVYSLPQCQLL
Sbjct: 241 CFKLYQLRLDSDSNQVSELSFSILQDFDLSKSKLSYQFGKLYRLTGSELFVYSLPQCQLL 300

Query: 301 QNISLAEIFPNTIDVSSIKPVANNRLVLAINNVVYLIDTLHRSILAEREFTHVKTFQLLQ 360
           QNISLAEIFPNTIDVSSIKPVANNRLVLAINNVVYLIDTLHRSILAEREFTHVKTFQLLQ
Sbjct: 301 QNISLAEIFPNTIDVSSIKPVANNRLVLAINNVVYLIDTLHRSILAEREFTHVKTFQLLQ 360

Query: 361 SATIGDSNITQRTIAIGVSTKSGPTSASALELINIEVGSGTLKDSLGKGVSKKLSEGSHS 420
           SATIGDSNITQRTIAIGVSTKSGPTSASALELINIEVGSGTLKDSLGKGVSKKLSEGSHS
Sbjct: 361 SATIGDSNITQRTIAIGVSTKSGPTSASALELINIEVGSGTLKDSLGKGVSKKLSEGSHS 420

Query: 421 DLKPLFDENDEKSLIGTPVHDISNVKSFNFNKILADLKSSDTISDFDKTFFESLEIKENH 480
           DLKPLFDENDEKSLIGTPVHDISNVKSFNFNKILADLKSSDTISDFDKTFFESLEIKENH
Sbjct: 421 DLKPLFDENDEKSLIGTPVHDISNVKSFNFNKILADLKSSDTISDFDKTFFESLEIKENH 480

Query: 481 YTENDRFISDQDFIANTIDLIFKKFDTEFPKAFTFLLTHPLFPIKLTVGLLDKLKDHPRL 540
           YTENDRFISDQDFIANTIDLIFKKFDTEFPKAFTFLLTHPLFPIKLTVGLLDKLKDHPRL
Sbjct: 481 YTENDRFISDQDFIANTIDLIFKKFDTEFPKAFTFLLTHPLFPIKLTVGLLDKLKDHPRL 540

Query: 541 FKQAIVTCPNLPLSELLFQLFTVKNGELTLDISLRVLQDYSRNDVKQEIKKLDNVDXXXX 600
           FKQAIVTCPNLPLSELLFQLFTVKNGELTLDISLRVLQDYSRNDVKQEIKKLDNVD    
Sbjct: 541 FKQAIVTCPNLPLSELLFQLFTVKNGELTLDISLRVLQDYSRNDVKQEIKKLDNVDIENF 600

Query: 601 XXXXXXXXXXXXXXXXXXLFQLLSLVLDSIGLFALKGPLLERLSNYINEQVTIAERSSEL 660
                             LFQLLSLVLDSIGLFALKGPLLERLSNYINEQVTIAERSSEL
Sbjct: 601 IEFIITPTTEEIQTNTPQLFQLLSLVLDSIGLFALKGPLLERLSNYINEQVTIAERSSEL 660

Query: 661 WHLLDTSTTPRPFKNAYLKSVIGNKETLSVYSVDYLDI 698
           WHLLDTSTTPRPFKNAYLKSVIGNKETLSVYSVDYLDI
Sbjct: 661 WHLLDTSTTPRPFKNAYLKSVIGNKETLSVYSVDYLDI 698

>Kpol_480.16 s480 (33288..35255) [1968 bp, 655 aa] {ON}
           (33288..35255) [1968 nt, 656 aa]
          Length = 655

 Score =  598 bits (1543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/701 (46%), Positives = 452/701 (64%), Gaps = 49/701 (6%)

Query: 1   MPSLSQPFRLAVLPKIASLSNYSLQTDYLQVAPDTFTYDTNKVTLXXXXXXXXXXXXNPT 60
           MPS SQPFRLAVLPKI SLSN   Q   LQ+A D F+ ++NK+T+            NPT
Sbjct: 1   MPSFSQPFRLAVLPKILSLSNVETQISSLQIA-DDFSLESNKITIGISGSTISQYIINPT 59

Query: 61  PKLLFNIAIPSTNNVTASNISHYIEEVENANSTVTTDKSDLVDKDNMESTEEVSVAENTD 120
           P L+FN+ IPSTNNVTA NI H++ +         TD S L                   
Sbjct: 60  PSLVFNVPIPSTNNVTACNIGHFVSD---------TDGSKL------------------- 91

Query: 121 VTKRSVELWAYGLVANKSNTLNISVKTTGLDEFSTTPGEIIRKKTIKVDSKVVNIKIFKE 180
                 E WAYGL  NK++TLNIS+KT+  D+++T+ GE++   + K D K+ +IKI ++
Sbjct: 92  ------ECWAYGLSYNKNHTLNISIKTSDDDKYATSGGEVVETYSQKCDDKIEHIKINEK 145

Query: 181 FKTIVVVLKNGLVKLFDFDLNLKSSLDIAYNDVQFVQHFTESKQNFLLILSNIDEEKSSV 240
            K IVVVLKNGL++ +DF L L  S+++ Y+D+ FV+HF E  + F +ILSNI+ +K  +
Sbjct: 146 EKVIVVVLKNGLIQFYDFTLKLLKSVNVMYSDISFVEHFEEDGKQFAIILSNIEGKK--I 203

Query: 241 CFKLYQLRLDSDSNQVSELSFSILQDFDLSKSKLSYQFGKLYRLTGSELFVYSLPQCQLL 300
            FKLY+L   +D   ++ELS +IL+D DL +S++ YQFGK+YRL    L++Y+LPQCQL 
Sbjct: 204 SFKLYEL-FTNDKTSINELSSTILEDADLGESQICYQFGKIYRLFEDRLYIYNLPQCQLQ 262

Query: 301 QNISLAEIFPNTIDVSSIKPVANNRLVLAINNVVYLIDTLHRSILAEREFTHVKTFQLLQ 360
           Q I L  I     DV S  P+ANNR++L +NN +YL+D +H SILAER+ +HVK +QLL+
Sbjct: 263 QTIELPFIQKKDSDVLSFSPIANNRILLTVNNKIYLLDLVHNSILAERDLSHVKVYQLLK 322

Query: 361 SATI--GDSNITQRTIAIGVSTKSGPTSASALELINIEVGSGTLKDSLGKGVSKKLSEGS 418
           S  +     N   +TIAIGVS K+GP+  S+LE+IN++VGSGTLKDSLGK   +  +   
Sbjct: 323 SIVVPSKGENKNSKTIAIGVSIKNGPSPISSLEVINVDVGSGTLKDSLGKSF-QVANVKK 381

Query: 419 HSDLKPLFDENDEKSLIGTPVHDISNVKSFNFNKILADLKSS-DTISDFDKTFFESLEIK 477
           +  L+ LF E++        ++     KSF++  IL +L+++ + I+ FD  FF+ L I 
Sbjct: 382 NIPLQSLFPEDE-------TIYAKGEQKSFDYKNILQELQNNKNDINKFDDIFFKKLNIM 434

Query: 478 ENHYTENDRFISDQDFIANTIDLIFKKFDTEFPKAFTFLLTHPLFPIKLTVGLLDKLKDH 537
           + +YTE DRFI DQ F+++ +DLIF  F  ++P+A TFLLTHPLFPI  T  LL K ++ 
Sbjct: 435 KEYYTEQDRFIYDQKFLSDVLDLIFSAFKKDYPRALTFLLTHPLFPISHTRNLLTKFRNQ 494

Query: 538 PRLFKQAIVTCPNLPLSELLFQLFTVKNGELTLDISLRVLQDYSRNDVKQEIKKLDNVDX 597
           PRLFKQA+VTCPNLPL ELL +LFT+ NGEL LDISLR+LQDY+R+ +KQE+K L  VD 
Sbjct: 495 PRLFKQAVVTCPNLPLKELLAELFTITNGELCLDISLRILQDYTRDSIKQELKTLSKVDI 554

Query: 598 XXXXXXXXXXXXXXXXXXXXXLFQLLSLVLDSIGLFALKGPLLERLSNYINEQVTIAERS 657
                                LFQLLSLVLD+ GLFAL+   LE+LS YI+ QV +AER+
Sbjct: 555 QNFIEFVIDTDSEDKSQFNPQLFQLLSLVLDASGLFALEEETLEKLSAYIDNQVNVAERN 614

Query: 658 SELWHLLDTSTTPRPFKNAYLKSVIGNKETLSVYSVDYLDI 698
           + LWHLLD ++  R   N      +   ++LS YSV+YL++
Sbjct: 615 NRLWHLLDENSDKRSTLNQANDQNVLQTKSLSAYSVEYLEL 655

>TPHA0D04230 Chr4 complement(913504..915462) [1959 bp, 652 aa] {ON}
           Anc_3.489 YGR128C
          Length = 652

 Score =  575 bits (1481), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/705 (46%), Positives = 449/705 (63%), Gaps = 60/705 (8%)

Query: 1   MPSLSQPFRLAVLPKIASLSNYSLQTDYLQVAPDTFTYDTNKVTLXXXXXXXXXXXXNPT 60
           MPSLSQPFRLA+LPKIA LS+Y++Q+  LQVA D FT D+NK+T+            NPT
Sbjct: 1   MPSLSQPFRLAILPKIAVLSDYNVQSKLLQVA-DDFTLDSNKITIGVSGCAVSQYVINPT 59

Query: 61  PKLLFNIAIPSTNNVTASNISHYIEEVENANSTVTTDKSDLVDKDNMESTEEVSVAENTD 120
           P +   + IPSTNNVTA N++ Y                    KD    TEE+       
Sbjct: 60  PNVSQTVPIPSTNNVTACNVAQY--------------------KD--ADTEEL------- 90

Query: 121 VTKRSVELWAYGLVANKSNTLNISVKTTGLDEFSTTPGEIIRKKTIKVDSKVVNIKIFKE 180
                 E+W Y L  NK NTL++++KT   D+FSTT  + +   T+K D+ VV IKI KE
Sbjct: 91  -----FEIWVYNLAVNKKNTLHVAIKTVDPDKFSTTQSDALETYTVKCDASVVGIKINKE 145

Query: 181 FKTIVVVLKNGLVKLFDFDLNLKSSLDIAYNDVQFVQHFTESKQNFLLILSNIDEEKSSV 240
            KTIVV L NG +++FDF L L +S++ +Y+++ F +HF E+K++F +ILS I+  K S 
Sbjct: 146 DKTIVVTLGNGFIQIFDFKLKLLNSVNTSYDNIYFSEHFVENKKSFAIILSTIEGNKLS- 204

Query: 241 CFKLYQLRLDSDSNQVSELSFSILQDFDLSKSKLSYQFGKLYRLTGSELFVYSLPQCQLL 300
            +KLY+L    D   + ELS +IL+D     SK+SYQFGKLYRL  +++FVYSLPQCQL+
Sbjct: 205 -YKLYEL-FGQDKTSIKELSSTILEDIQCKDSKISYQFGKLYRLYKNQMFVYSLPQCQLV 262

Query: 301 QNISLAEIFPNTIDVSSIKPVANNRLVLAINNVVYLIDTLHRSILAEREFTHVKTFQLLQ 360
             I+L +I        S KPV+NNR++L ++N ++++D +HR+ LAER   HVK FQLL+
Sbjct: 263 DTITLPQIDLKKSQAISFKPVSNNRILLTVDNKIFILDLVHRATLAERVLGHVKMFQLLK 322

Query: 361 SATI--GDSNITQRTIAIGVSTKSGPTSASALELINIEVGSGTLKDSLGKG--VSKKLSE 416
           S  I   D++   +TIAIGVS K+GP+  +ALE+IN  VG+GTLKDSLG    VSK    
Sbjct: 323 SVVIETNDASNNHKTIAIGVSVKNGPSPITALEIINANVGTGTLKDSLGNSFDVSKSFKS 382

Query: 417 GSHSDLKPLFDENDEKSLIGTPVHDISNVKSFNFNKILADLKSSDT-ISDFDKTFFESLE 475
                L+PLF   D+ +L+    HD      F +  IL  L S++  I  FD  FF  L 
Sbjct: 383 NI---LQPLF--TDDANLVKR--HD------FKYEAILKKLSSTENDIKKFDDIFFGDLY 429

Query: 476 IKENHYTENDRFISDQDFIANTIDLIFKKFDTEFPKAFTFLLTHPLFPIKLTVGLLDKLK 535
           I++N+YT+N+RFI D  F+++ IDLIFK F  E+P A TFLLTHPLFPI  T  LL KL+
Sbjct: 430 IQQNYYTDNERFIFDVTFLSDVIDLIFKNFQKEYPSALTFLLTHPLFPIHQTKNLLLKLR 489

Query: 536 DHPRLFKQAIVTCPNLPLSELLFQLFTVKNGELTLDISLRVLQDYSRNDVKQEIKKLDNV 595
           +HPRLFKQA+VTCPNLP+ ELL +LF++ NGEL++DISLR+LQDY+++ +K E+K L+ +
Sbjct: 490 EHPRLFKQAVVTCPNLPIDELLTELFSITNGELSVDISLRILQDYTKDSIKLELKNLNKI 549

Query: 596 DXXXXXXXXXXXXXXXXXXXXXXLFQLLSLVLDSIGLFALKGPLLERLSNYINEQVTIAE 655
           D                      LF LLSLVLD+ GLF+++GPLL +LS YI++QV + E
Sbjct: 550 DIQNFIDFVIDPNNEEEKKHNEQLFVLLSLVLDASGLFSIEGPLLTQLSEYIDKQVEMIE 609

Query: 656 RSSELWHLLDTSTTPRPFKNAYLKS--VIGNKETLSVYSVDYLDI 698
           +S++LWHL+D +   R   N Y  S   +   + L+ YSV+YL++
Sbjct: 610 KSNKLWHLIDGTLGKR--NNHYQTSGATVPEIKALTAYSVEYLEL 652

>ZYRO0D10054g Chr4 (847992..849986) [1995 bp, 664 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 664

 Score =  567 bits (1462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/711 (45%), Positives = 450/711 (63%), Gaps = 60/711 (8%)

Query: 1   MPSLSQPFRLAVLPKIASLSNYSLQTDYLQVAPDTFTYDTNKVTLXXXXXXXXXXXXNPT 60
           MPS+ QPFRL+VLP+I +LSNY +Q+DYL+V+ D  + ++NK+T+            NPT
Sbjct: 1   MPSIFQPFRLSVLPRIGALSNYEVQSDYLRVSSD-ISPNSNKITIGISESAISQYILNPT 59

Query: 61  PKLLFNIAIPSTNNVTASNISHYIEEVENANSTVTTDKSDLVDKDNMESTEEVSVAENTD 120
           PKLL NI+IPSTN V+A +++           T+  DK                      
Sbjct: 60  PKLLSNISIPSTNVVSACDVA-----------TLADDK---------------------- 86

Query: 121 VTKRSVELWAYGLVANKSNTLNISVKTTGLDE-FSTTPGEIIRKKTIKVDSKVVNIKIFK 179
                 E+W Y + + KS+ LN SVK    D    T  G+      IK+DSKVV IKI  
Sbjct: 87  ------EIWCYCVKSGKSHFLNASVKPVDADTVLDTDGGDKTEDFKIKMDSKVVGIKIIP 140

Query: 180 EFKTIVVVLKNGLVKLFDFDLNLKSSLDIAYNDVQFVQHFTESKQNFLLILSNIDEEKSS 239
           ++K IVVVL++GL++ +DF L   SSLDI+Y +V+ V +F+E+ QNF+ +LS  +  K  
Sbjct: 141 DYKAIVVVLESGLIQYYDFQLQKLSSLDISYQNVKVVNYFSENGQNFMFVLSGFENNK-- 198

Query: 240 VCFKLYQLRLDSDSNQ--VSELSFSILQDFDLSKSKLSYQFGKLYRLTGSELFVYSLPQC 297
           VCFKL++L          + ELS +IL++F+L +SKL YQ GKLY+L GS +  Y+LPQC
Sbjct: 199 VCFKLFELLYHDGKRHTPIKELSTTILENFNLDQSKLCYQSGKLYQLEGSTIKTYALPQC 258

Query: 298 QLLQNISLAEIF-PNTIDVSSIKPVANNRLVLAINNVVYLIDTLHRSILAEREFTHVKTF 356
            L+Q   L  I  PN+  VS + PV+ NR++L +NN VYL+D +H S+L+ER  TH KTF
Sbjct: 259 HLVQTTHLPMILDPNSQKVS-LAPVSTNRILLTVNNQVYLLDLVHSSVLSERTLTHAKTF 317

Query: 357 QLLQSA------TIGDSNITQRTIAIGVSTKSGPTSASALELINIEVGSGTLKDSLGKGV 410
           QLL+SA      ++  S    RT+AIGV+TK+G    SALE+IN++VG+GTLKDSLGK  
Sbjct: 318 QLLRSAPLNVSSSLKGSEFATRTLAIGVTTKNGNNPTSALEVINVDVGTGTLKDSLGKSF 377

Query: 411 SKKLSEGSHSDLKPLFDENDEKSLIGTPVHDISNVKSFNFNKILADL-KSSDTISDFDKT 469
            + +++    +L+PLF  +D++S  G    D   V +F +  I  +L K++ +IS FD T
Sbjct: 378 -QSINDSKTHNLQPLF--SDDESDAGDNA-DSDEVVAFAYEDIFKELSKNNKSISKFDST 433

Query: 470 FFESLEIKENHYTENDRFISDQDFIANTIDLIFKKFDTEFPKAFTFLLTHPLFPIKLTVG 529
           F + L I+E HYT+ +RFI DQ+F++  + LI   FD E+P+A TFLLTHPLFP   T G
Sbjct: 434 FAKRLNIQEEHYTDRERFICDQEFLSKVVRLILDSFDQEYPRALTFLLTHPLFPTDCTRG 493

Query: 530 LLDKLKDHPRLFKQAIVTCPNLPLSELLFQLFTVKNGELTLDISLRVLQDYSRNDVKQEI 589
           LL++ ++HPRLFKQAIVTCPNLPL +LL +LF++ NGEL LDISLR+LQD++ + +K E+
Sbjct: 494 LLERFRNHPRLFKQAIVTCPNLPLDDLLSELFSINNGELCLDISLRILQDFTTDMIKDEV 553

Query: 590 KKLDNVDXXXXXX--XXXXXXXXXXXXXXXXLFQLLSLVLDSIGLFALKGPLLERLSNYI 647
           KKL+ VD                        LFQLLSLV+D+IGLFAL G LL+RLS+YI
Sbjct: 554 KKLNKVDVHNFVNFLISPKDEELIQNKSTYELFQLLSLVIDAIGLFALDGALLQRLSDYI 613

Query: 648 NEQVTIAERSSELWHLLDTSTTPRPFKNAYLKSVIGNKETLSVYSVDYLDI 698
           +EQV +AER++ LW+LLDT    R    +   S    ++TL  Y+V+YL++
Sbjct: 614 DEQVYLAERNARLWNLLDTRNKNRGATGSLAGSSRAKEQTLPKYTVEYLEL 664

>TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa]
           {ON} Anc_3.489 YGR128C
          Length = 649

 Score =  566 bits (1460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/706 (45%), Positives = 444/706 (62%), Gaps = 65/706 (9%)

Query: 1   MPSLSQPFRLAVLPKIASLSNYSLQTDYLQVAPDTFTYDTNKVTLXXXXXXXXXXXXNPT 60
           MPSLSQ F+LAVLP++ASLSN++ QT++LQVA D     +N++T+            NPT
Sbjct: 1   MPSLSQSFKLAVLPRVASLSNFAFQTNFLQVA-DDIEPTSNRITIGISESAISQYVLNPT 59

Query: 61  PKLLFNIAIPSTNNVTASNISHYIEEVENANSTVTTDKSDLVDKDNMESTEEVSVAENTD 120
           PKL+ +I IPSTN VTA +++   E+                                  
Sbjct: 60  PKLVLSIPIPSTNIVTACDVARSDEQ---------------------------------- 85

Query: 121 VTKRSVELWAYGLVANKSNTLNISVKTTGLDEFSTTPGEIIRKKTIKVDSKVVNIKIFKE 180
                 E+W Y L A K  TLN++ K +   E      ++++   +KVD + V + +  +
Sbjct: 86  ------EIWCYALQAGKVCTLNVASKVSH-AENGVNSDDVLK---VKVDDQAVGVHVNGK 135

Query: 181 FKTIVVVLKNGLVKLFDFDLNLKSSLDIAYNDVQFVQHFTESKQNFLLILSNIDEEKSSV 240
            KTIVVVLKNGL++ +DF L L  SLD++Y+DV   + FTE   +FL IL ++ E+K  V
Sbjct: 136 DKTIVVVLKNGLIQFYDFQLKLLHSLDVSYSDVSVTKFFTEGANDFLFILCSLPEDK--V 193

Query: 241 CFKLYQLRLDSDSNQV--SELSFSILQDFDLSKSKLSYQFGKLYRLTGSELFVYSLPQCQ 298
           CFKL++L L  + NQV   ELS  IL+DF L+ SK+ YQ G+LYRL G E+ VY+LPQCQ
Sbjct: 194 CFKLFELSL-PNYNQVPIKELSSIILEDFSLATSKICYQSGRLYRLIGHEVLVYALPQCQ 252

Query: 299 LLQNISLAEIFPNTIDVSSIKPVANNRLVLAINNVVYLIDTLHRSILAEREFTHVKTFQL 358
           L+Q ++L  +     DV S+KP+++NR+++  +N +YL++  H SIL +RE TH+K+FQL
Sbjct: 253 LVQAVTLPMV--QGADVISMKPISSNRILVTADNKIYLLNLTHNSILFQRELTHLKSFQL 310

Query: 359 LQSATIGDSNIT-----QRTIAIGVSTKSGPTSASALELINIEVGSGTLKDSLGKGVSKK 413
           L+SA I DS ++     Q+T  IGV TK G    S+LE++N++VG+GTLKDSLGKG +  
Sbjct: 311 LKSAVI-DSRVSSSLPNQKTFVIGVGTKHGKNPTSSLEIVNVDVGTGTLKDSLGKGFTVS 369

Query: 414 LSEGSHSDLKPLFDENDEKSLIGTPVHDISNVKSFNFNKILADL-KSSDTISDFDKTFFE 472
            +E     LKPLF + D ++         +  + F+FN+I   L K+  +IS FD+ F  
Sbjct: 370 -NEPISQVLKPLFSDEDNEAEDED-----NKFEHFDFNQIYQHLEKNKQSISSFDRIFLR 423

Query: 473 SLEIKENHYTENDRFISDQDFIANTIDLIFKKFDTEFPKAFTFLLTHPLFPIKLTVGLLD 532
            L IK  HYTE DRFI D+ F++N + LI + F  E+PKA TFLLTHPLFP+  T  LL 
Sbjct: 424 ELNIKREHYTELDRFICDRQFLSNVVHLILQNFQEEYPKALTFLLTHPLFPVDCTPKLLS 483

Query: 533 KLKDHPRLFKQAIVTCPNLPLSELLFQLFTVKNGELTLDISLRVLQDYSRNDVKQEIKKL 592
           +L++HPRLFKQAIVTCPNLPL ELL +LF+++NGEL+LDISLR+LQDY+ + +KQE++KL
Sbjct: 484 RLREHPRLFKQAIVTCPNLPLQELLSELFSIENGELSLDISLRILQDYTTDMIKQEVRKL 543

Query: 593 DNVDXXXXXXXXXXXXXXXXXXXXXXLFQLLSLVLDSIGLFALKGPLLERLSNYINEQVT 652
           + +D                      LFQLLSLVLDSIGLFAL G LL+RL++YI E+V 
Sbjct: 544 NKIDVQNFIEFVISSNDENAIRSSHQLFQLLSLVLDSIGLFALDGVLLDRLADYIQERVA 603

Query: 653 IAERSSELWHLLDTSTTPRPFKNAYLKSVIGNKETLSVYSVDYLDI 698
           IAER+S+L HLLD     R F  +   SV   +E +  Y+V+YLD+
Sbjct: 604 IAERNSKLCHLLDDKQNSRGFAKSGAGSVGSTREAVPKYTVEYLDL 649

>NCAS0E00830 Chr5 (151952..153967) [2016 bp, 671 aa] {ON} Anc_3.489
           YGR128C
          Length = 671

 Score =  547 bits (1409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/719 (44%), Positives = 452/719 (62%), Gaps = 69/719 (9%)

Query: 1   MPSLSQPFRLAVLPKIASLSNYSLQTDYLQVAPDTFTYDTNKVTLXXXXXXXXXXXXNPT 60
           MPSLSQPFRL +LPKIASLSN++LQ+DY+QV   TF+  TNK+T+            NPT
Sbjct: 1   MPSLSQPFRLTILPKIASLSNFALQSDYIQVNDSTFSPTTNKITIGISGSSVSQYIVNPT 60

Query: 61  PKLLFNIAIPSTNNVTASNISHYIEEVENANSTVTTDKSDLVDKDNMESTEEVSVAENTD 120
           PKL+FN  IPSTN VTA N+       E   S                            
Sbjct: 61  PKLIFNFPIPSTNIVTACNV------FEQKGS---------------------------- 86

Query: 121 VTKRSVELWAYGLVANKSNTLNI----SVKTTGLDEFSTTPGE--IIRKKTIKVDSKVVN 174
               S E W +  +ANK++TLN+      +T   +   + P +  +  +  IK D  VV+
Sbjct: 87  ----SEETWCFATMANKTSTLNLINKNQYQTNEEESGDSAPSDSSVTSEFKIKADDHVVD 142

Query: 175 IKIFKEFKTIVVVLKNGLVKLFDFDLNLKSSLDIAYNDVQFVQHFTESKQNFLLILSNID 234
           IKI  + K I+VVLKNG ++ +DF+L L +S+++AYN+V+FV+HF E  ++F+ +L +++
Sbjct: 143 IKILNK-KKIIVVLKNGKIQTYDFELKLLNSINMAYNNVRFVEHFHEDGKDFMFVLCDLE 201

Query: 235 EEKSSVCFKLYQLR--LDSDSNQVSELSFSILQDFDLSKSKLSYQFGKLYRLTGSELFVY 292
            +K  VC KL+Q+   +++ ++   EL+ +IL++F L  +K  YQFGK Y+LT  ++ VY
Sbjct: 202 NDK--VCLKLFQINENIETINDSAIELTSTILENFPLENAKFCYQFGKFYKLTDDKILVY 259

Query: 293 SLPQCQLLQNISLAEI--FPNTIDVSSIKPVANNRLVLAINNVVYLIDTLHRSILAEREF 350
           SLPQ Q   +I+L  I        V S KP++ NR++L +NN +YL+D +H SIL+ERE 
Sbjct: 260 SLPQFQFQYSITLPMITDLKEGERVVSFKPISPNRILLTVNNKIYLLDLIHNSILSEREL 319

Query: 351 THVKTFQLLQSATIGDSNITQ-RTIAIGVSTKSGPTSASALELINIEVGSGTLKDSLGKG 409
           TH+KTFQLL++A + D+NI Q RT+AIGVSTK G    S+LEL+N++VG+ T+KDSLGK 
Sbjct: 320 THLKTFQLLKTAVV-DTNINQNRTLAIGVSTKFGSNPTSSLELLNVDVGTSTIKDSLGKS 378

Query: 410 VSKKLSEGSHSDLKPLFDENDEKSLIGTPVHDISNVKSFNFNKILADL-KSSDTISDFDK 468
                +E +   LK LFD+ ++ S           VK+FN+ KI  +L  S + ++ FD 
Sbjct: 379 FQTSSTENNVQSLKSLFDDENDYS------DKKKQVKNFNYEKIYKELVDSKNDVTKFDD 432

Query: 469 TFFESLEIKENHYTENDRFISDQDFIANTIDLIFKKFDTEFPKAFTFLLTHPLFPIKLTV 528
            FF+S +IK+ +YTE DRFI + +F+   IDLIF+ F  E+PK FT+LLT PLFP++ T 
Sbjct: 433 IFFKSFDIKKEYYTEKDRFIYNHEFLVQIIDLIFETFKEEYPKTFTYLLTDPLFPLERTK 492

Query: 529 GLLDKLKDHPRLFKQAIVTCPNLPLSELLFQLFTVKNGELTLDISLRVLQDYSRNDVKQE 588
           GLL +L +HPRLFKQAIVTCPNLPL+ELL +LFT+ NGEL+LDISLR+LQDY+R+ +K+E
Sbjct: 493 GLLARLNNHPRLFKQAIVTCPNLPLNELLAELFTISNGELSLDISLRILQDYTRDSIKKE 552

Query: 589 IKKLDNVDXXXXXXXXXXXXXXXXXXXXX-XLFQLLSLVLDSIGLFALKGPLLERLSNYI 647
           +KKL  ++                       LFQLLSLV+DSIGLFAL   +LERLS YI
Sbjct: 553 LKKLPKIEVENFIEFIIDEESDIKDTTNAPHLFQLLSLVVDSIGLFALDNAVLERLSKYI 612

Query: 648 NEQVTIAERSSELWHLLDTSTTPRPFKNAYLKSVIGN--------KETLSVYSVDYLDI 698
           +EQV IA+ ++ELWHLLD S       + ++ S   +        +E L  YSV+YLD+
Sbjct: 613 DEQVAIAQSNTELWHLLDYSNVLAYKNDKFVTSTSKDSNTSLKLQEEVLPKYSVEYLDL 671

>Suva_7.416 Chr7 complement(718089..720230) [2142 bp, 713 aa] {ON}
           YGR128C (REAL)
          Length = 713

 Score =  544 bits (1402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/733 (45%), Positives = 466/733 (63%), Gaps = 55/733 (7%)

Query: 1   MPSLSQPFRLAVLPKIASLSNYSLQTDYLQVAPDTFTYDTNKVTLXXXXXXXXXXXXNPT 60
           MPSLSQPFRLA LPKIASLSN+SLQ DY+QVA   F   TN +TL            NPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGPFNEFTNNITLGISGSSISQYIINPT 60

Query: 61  PKLLFNIAIPSTNNVTASNISHYIEEVENANSTVTTDKSDLVDKDNMESTEEVSVAENTD 120
           PKL F+  IPSTN +TA N      E+EN          D  + DN ++  EV+  +   
Sbjct: 61  PKLTFDYPIPSTNIITACNAVQGQVEIEN----------DTKNSDNDKTDHEVTNFQ--- 107

Query: 121 VTKRSVELWAYGLVANKSN-TLNISVKTT--------------GLDEFS-TTPGEIIRKK 164
            +KR VE+W++GL+ NK N TLN+  K                G D+ +     +I+ + 
Sbjct: 108 -SKRDVEIWSFGLMVNKGNYTLNVITKAVEDNDDTSNDHLTENGTDKKAYAGTDDILSQY 166

Query: 165 TIKVDSKVVNIKIFKEFKTIVVVLKNGLVKLFDFDLNLKSSLDIAYNDVQFVQHFTESKQ 224
            IK   KV+NIKI  +   ++ VL+NGLV+ +DF L L  S DI+Y ++++ + FTE+  
Sbjct: 167 KIKTKDKVMNIKIDAKNSLVIAVLQNGLVEFYDFKLKLLHSYDISYGNLKYAKWFTENGT 226

Query: 225 NFLLILSNIDEEKSSVCFKLYQLR--LDSDSNQVSELSFSILQDFDLSKSKLSYQFGKLY 282
            F+ +L  ++++K  VC+KL++L      +S+ + ELS +I++ F    SK  YQFGKLY
Sbjct: 227 EFVFVLCPLEDDK--VCYKLFELSDFEGKESSPIKELSSTIIEGFSFESSKFCYQFGKLY 284

Query: 283 RLTGSELFVYSLPQCQLLQNISLAEIFPNTI--DVSSIKPVANNRLVLAINNVVYLIDTL 340
           +L   ++ VYSLP CQL Q I +  I   T   D+ S +PV+ NR++L +NN +YL+D L
Sbjct: 285 KLNQGKIHVYSLPHCQLQQIIDVPLINKPTSENDLISFQPVSVNRILLTVNNTIYLLDLL 344

Query: 341 HRSILAEREFTHVKTFQLLQSATIGDSNITQ--RTIAIGVSTKSGPTSASALELINIEVG 398
           H SIL +RE THV+TFQLL+SA I DS  +Q  +TIAIG+STK+GP   S+LE+INI+VG
Sbjct: 345 HCSILNQRELTHVRTFQLLRSAVI-DSEKSQNSKTIAIGISTKNGPNPTSSLEIINIDVG 403

Query: 399 SGTLKDSLGKGVSKKLSEGSHSDLKPLFD-ENDEKSLIGTPVHDISN---VKSFNFNKIL 454
           + TLKDSLGK      ++ S   LKPLFD EN   +++    +DI     V +F +++I+
Sbjct: 404 TNTLKDSLGKSFQIGKNDTSSVVLKPLFDDENVADNMVKR--NDIDGNISVPTFQYDEII 461

Query: 455 ---ADLKSSDTISDFDKTFFESLEIKENHYTENDRFISDQDFIANTIDLIFKKFD-TEFP 510
              + LK++D ++ FD  FF+ L++KE HYTE DRFISD +F+   +DLIF+KF+  ++P
Sbjct: 462 KKISALKNND-VASFDDIFFKDLKVKEEHYTEKDRFISDSEFLNRVLDLIFEKFNGNDYP 520

Query: 511 KAFTFLLTHPLFPIKLTVGLLDKLKDHPRLFKQAIVTCPNLPLSELLFQLFTVKNGELTL 570
           KA TFLLTHPLFP+  T  LL +L+D PRLFKQAIVTCPNLPL+ELL +LF+++N EL L
Sbjct: 521 KALTFLLTHPLFPLNRTHNLLSRLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNKELLL 580

Query: 571 DISLRVLQDYSRNDVKQEIKKLDNVDXXX-----XXXXXXXXXXXXXXXXXXXLFQLLSL 625
           DIS R+LQD++R+ +KQE+K L  +D                           LFQLLSL
Sbjct: 581 DISFRILQDFTRDSIKQEMKNLSKLDIQNFIDFITNTDEDSTLENLNHSQSSQLFQLLSL 640

Query: 626 VLDSIGLFALKGPLLERLSNYINEQVTIAERSSELWHLLDTSTTPRPFKNAYLKSVIGNK 685
           VLDSIGLF+L+G LL+ L++YI++QV IAER++ELW+L++T  +   F N    S    K
Sbjct: 641 VLDSIGLFSLEGALLDNLASYIDKQVEIAERNTELWNLVETKGSQHGFTNMNSDSRTSQK 700

Query: 686 ETLSVYSVDYLDI 698
           + L  Y+++YL+I
Sbjct: 701 QALPTYTMEYLEI 713

>YGR128C Chr7 complement(747950..750091) [2142 bp, 713 aa] {ON}
           UTP8Nucleolar protein required for export of tRNAs from
           the nucleus; also copurifies with the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 713

 Score =  538 bits (1385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/729 (44%), Positives = 452/729 (62%), Gaps = 47/729 (6%)

Query: 1   MPSLSQPFRLAVLPKIASLSNYSLQTDYLQVAPDTFTYDTNKVTLXXXXXXXXXXXXNPT 60
           MPSLSQPFRLA LPKIASLSN+SLQ DY+QVA  TF   TN +TL            NPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINPT 60

Query: 61  PKLLFNIAIPSTNNVTASNISHYIEEVENANSTVTTDKSDLVDKDNMESTEEVSVAENTD 120
           PKL F+  IPSTN +TA N       ++  N   +TD     D+ N E T          
Sbjct: 61  PKLTFDYPIPSTNIITACNAEKGQANID-GNIEASTD-----DEANNEKTINTQ------ 108

Query: 121 VTKRSVELWAYGLVANKSN-TLNISVKT------TGLDEFS---------TTPGEIIRKK 164
             KR+VE+WA+GL+ NK N TLN+  K       T  D  S         T   E + + 
Sbjct: 109 -KKRNVEIWAFGLMVNKGNYTLNVITKALEDTTDTSNDHLSESDIDNKAYTGSDEFLSQY 167

Query: 165 TIKVDSKVVNIKIFKEFKTIVVVLKNGLVKLFDFDLNLKSSLDIAYNDVQFVQHFTESKQ 224
            IK  +KV++IKI  +   ++ +L+NGL+++FDF L L  S DI+Y+++++ + FTE+  
Sbjct: 168 KIKAKAKVMSIKIDTKNSLVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWFTENGT 227

Query: 225 NFLLILSNIDEEKSSVCFKLYQLR--LDSDSNQVSELSFSILQDFDLSKSKLSYQFGKLY 282
            ++ +L  + ++K  VC+KL +L      +S+ + ELS +I++ F    SKL YQFGKLY
Sbjct: 228 EYVFVLCPLQDDK--VCYKLLELTDCGSGESSPIKELSSTIIEGFSFENSKLCYQFGKLY 285

Query: 283 RLTGSELFVYSLPQCQLLQNIS--LAEIFPNTIDVSSIKPVANNRLVLAINNVVYLIDTL 340
           +L   ++++YSLP CQL Q I   + +      D+ S +PV+ NR++L +NNV+YL+D L
Sbjct: 286 KLNQGKIYIYSLPHCQLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNNVIYLLDLL 345

Query: 341 HRSILAEREFTHVKTFQLLQSATI-GDSNITQRTIAIGVSTKSGPTSASALELINIEVGS 399
           H S L++RE THVKTFQLL+SA I  + +   +TIAIG+STK+GP   S+LE+INI+VG+
Sbjct: 346 HCSTLSQRELTHVKTFQLLKSAVINSEKSHNSKTIAIGISTKNGPNPTSSLEIINIDVGT 405

Query: 400 GTLKDSLGKGVSKKLSEGSHSDLKPLFDEND--EKSLIGTPVHDISNVKSFNFNKILADL 457
            TLKDSLGK      +  S   LKPLFD+ D  +K +    V   S+V   + N+++  L
Sbjct: 406 NTLKDSLGKSFQVG-NNDSSVILKPLFDDKDINDKRVKCNDVSGDSSVPVLHCNEVIEKL 464

Query: 458 KS--SDTISDFDKTFFESLEIKENHYTENDRFISDQDFIANTIDLIFKKF-DTEFPKAFT 514
            +   + I+ FD  FF+ L+IKE HYTE DR+ISD  F+   +DLIF KF   ++PK  T
Sbjct: 465 SALQDNDITSFDDIFFKELKIKEEHYTEKDRYISDPGFLNKVLDLIFGKFSGNDYPKTLT 524

Query: 515 FLLTHPLFPIKLTVGLLDKLKDHPRLFKQAIVTCPNLPLSELLFQLFTVKNGELTLDISL 574
           FLLTHPLFP+  T  LL  L+D PRLFKQAIVTCPNLPL+ELL +LF+++N EL LDIS 
Sbjct: 525 FLLTHPLFPLSRTRNLLSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNRELLLDISF 584

Query: 575 RVLQDYSRNDVKQEIKKLDNVDXXX-----XXXXXXXXXXXXXXXXXXXLFQLLSLVLDS 629
           R+LQD++R+ +KQE+KKL  +D                           LFQLLSLVLDS
Sbjct: 585 RILQDFTRDSIKQEMKKLSKLDVQNFIEFITSGGEDSSPECFNPSQSTQLFQLLSLVLDS 644

Query: 630 IGLFALKGPLLERLSNYINEQVTIAERSSELWHLLDTSTTPRPFKNAYLKSVIGNKETLS 689
           IGLF+L+G LLE L+ YI++QV IAER++ELW+L+DT      F ++   +    K  L 
Sbjct: 645 IGLFSLEGALLENLTLYIDKQVEIAERNTELWNLIDTKGFQHGFASSTFDNGTSQKRALP 704

Query: 690 VYSVDYLDI 698
            Y+++YLDI
Sbjct: 705 TYTMEYLDI 713

>Skud_7.439 Chr7 complement(727211..729352) [2142 bp, 713 aa] {ON}
           YGR128C (REAL)
          Length = 713

 Score =  537 bits (1383), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/738 (44%), Positives = 463/738 (62%), Gaps = 65/738 (8%)

Query: 1   MPSLSQPFRLAVLPKIASLSNYSLQTDYLQVAPDTFTYDTNKVTLXXXXXXXXXXXXNPT 60
           MPSLSQPFRLA LPKIASLSN+SLQ DY+QVA  TF   TN +TL            NPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINPT 60

Query: 61  PKLLFNIAIPSTNNVTASNISHYIEEVENANSTVTTDKSDLVDKDNMESTEEVSVAENTD 120
           PKL F+  IPSTN +TA + +    EV+     V  ++   +  D+    E+ + ++   
Sbjct: 61  PKLTFDYPIPSTNVITACSAA----EVQ-----VNVEEDLKISNDDSNDEEKAANSQ--- 108

Query: 121 VTKRSVELWAYGLVANKSN-TLNISVKT----------------------TGLDEFSTTP 157
            TKR++E+W++G + NK N TLN++ K                        G D+F    
Sbjct: 109 -TKRNIEIWSFGSMVNKGNYTLNVTTKMLESNKNTSNEHLVEDSIDSRRHAGADDF---- 163

Query: 158 GEIIRKKTIKVDSKVVNIKIFKEFKTIVVVLKNGLVKLFDFDLNLKSSLDIAYNDVQFVQ 217
              + +  IK  +KV+NIKI  +   I+ VL+NGL++ +D  L L  S DI+Y+++++ +
Sbjct: 164 ---LSQHKIKTKAKVMNIKIDAKNSLIIAVLQNGLIEFYDLKLKLLYSFDISYDNLKYAK 220

Query: 218 HFTESKQNFLLILSNIDEEKSSVCFKLYQLR--LDSDSNQVSELSFSILQDFDLSKSKLS 275
            FTE+  +F+ +L  ++++K  VC+K+ +L      D++ + ELS +I++ F    SKL 
Sbjct: 221 WFTENGTDFVFVLCPLEDDK--VCYKMLELSDFESKDNSPIKELSSTIIEGFSFESSKLC 278

Query: 276 YQFGKLYRLTGSELFVYSLPQCQLLQNISLAEIFPNTI--DVSSIKPVANNRLVLAINNV 333
           YQFGKLY+L   +++VYSLP CQL Q I L  I  +    D+ S +PV+ NR++L +NN+
Sbjct: 279 YQFGKLYKLNQGKIYVYSLPHCQLQQIIELPLINKSNSEDDLISFQPVSVNRILLTVNNI 338

Query: 334 VYLIDTLHRSILAEREFTHVKTFQLLQSATI-GDSNITQRTIAIGVSTKSGPTSASALEL 392
           +YL+D LH SIL  RE THVKTFQLL+SA I  + +   +TIAIG+STK+GP   S+LE+
Sbjct: 339 IYLLDLLHCSILNHRELTHVKTFQLLKSALIDSEKSHNSKTIAIGISTKNGPNPTSSLEI 398

Query: 393 INIEVGSGTLKDSLGKGVSKKLSEGSHSDLKPLFDENDEKSLIGTPVHDIS---NVKSFN 449
           INI+VG+ TLKDSLGK      ++ S   LKPLFD+ D  + +    +DI    NV  F+
Sbjct: 399 INIDVGTNTLKDSLGKSFQVGKNDAS-VILKPLFDDEDVTNNM-VKRNDIDGNINVPIFH 456

Query: 450 FNKI---LADLKSSDTISDFDKTFFESLEIKENHYTENDRFISDQDFIANTIDLIFKKFD 506
           ++++   L+ LK++D I+ FD+ FF  L++KE HYTE DRFISD  F+   +DLIF KF 
Sbjct: 457 YDEVIEKLSVLKNND-IASFDEIFFNDLKVKEEHYTEKDRFISDPGFLNKVLDLIFLKFG 515

Query: 507 -TEFPKAFTFLLTHPLFPIKLTVGLLDKLKDHPRLFKQAIVTCPNLPLSELLFQLFTVKN 565
             ++PKA TFLLTHPLFP+  T GLL  L+D PRLFKQAIVTCPNLPL+ELL +LF+++N
Sbjct: 516 GNDYPKALTFLLTHPLFPLNRTHGLLSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRN 575

Query: 566 GELTLDISLRVLQDYSRNDVKQEIKKLDNVDXXXXXXXXXXXXXXX-----XXXXXXXLF 620
            EL LDIS RVLQD++R+ +KQE+KKL  +D                           LF
Sbjct: 576 RELLLDISFRVLQDFTRDSIKQEMKKLSKLDIQNFIECITNTEEDGPLEGFNHNHSSQLF 635

Query: 621 QLLSLVLDSIGLFALKGPLLERLSNYINEQVTIAERSSELWHLLDTSTTPRPFKNAYLKS 680
           QLLSLVLDSIGLF+L+G LLE L+ YI++QV IAER++ELW+L+D   +   F      S
Sbjct: 636 QLLSLVLDSIGLFSLEGALLENLTLYIDKQVKIAERNTELWNLIDIKGSQHGFATLSSGS 695

Query: 681 VIGNKETLSVYSVDYLDI 698
               K+ L  Y+++YLDI
Sbjct: 696 TTSQKQALPAYAMEYLDI 713

>Smik_6.224 Chr6 complement(365799..367916) [2118 bp, 705 aa] {ON}
           YGR128C (REAL)
          Length = 705

 Score =  535 bits (1378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/731 (44%), Positives = 464/731 (63%), Gaps = 59/731 (8%)

Query: 1   MPSLSQPFRLAVLPKIASLSNYSLQTDYLQVAPDTFTYDTNKVTLXXXXXXXXXXXXNPT 60
           MPSLSQPFRLA LPKIASLSN+SLQ +Y+QVA  TF   TN +TL            NPT
Sbjct: 1   MPSLSQPFRLAALPKIASLSNFSLQANYVQVADGTFNESTNNITLGISGSSVSQYIINPT 60

Query: 61  PKLLFNIAIPSTNNVTASNISHYIEEVENANSTVTTDKSDLVDKDNMESTEEVSVAENTD 120
           PKL+F+  IPSTN +TA N       +E              DKDN    E+V  ++   
Sbjct: 61  PKLIFDYPIPSTNIITACNAGEAQVNIE--------------DKDN---NEKVINSQ--- 100

Query: 121 VTKRSVELWAYGLVANKSN-TLNISVKT-----TGLDE-----------FSTTPGEIIRK 163
            TKR++E+W++GL+ NK N TLN+  K         DE           ++ + G ++ +
Sbjct: 101 -TKRNIEIWSFGLMVNKGNYTLNVITKVLENTINNTDENLVENKIENNVYTGSEG-LLSQ 158

Query: 164 KTIKVDSKVVNIKIFKEFKTIVVVLKNGLVKLFDFDLNLKSSLDIAYNDVQFVQHFTESK 223
             IK  +KV++IKI  +   I+ +L+NGL++ +DF L L  S DI+Y+++++ + FTE+ 
Sbjct: 159 YKIKAKAKVMSIKIDTKNNLIIAILQNGLIEFYDFKLKLLHSFDISYDNLKYAKWFTENG 218

Query: 224 QNFLLILSNIDEEKSSVCFKLYQLR--LDSDSNQVSELSFSILQDFDLSKSKLSYQFGKL 281
             F+ +L  + ++K  VC+KL +L    + +++ + ELS +I++ F    SKL YQFGKL
Sbjct: 219 IEFIFVLCPLQDDK--VCYKLLELTDYENRENSPIKELSSTIIEGFSFDDSKLCYQFGKL 276

Query: 282 YRLTGSELFVYSLPQCQLLQNISLAEIFPNTI--DVSSIKPVANNRLVLAINNVVYLIDT 339
           Y+L   +++VYSLP CQL Q I L  I  +    D+ S +PV+ NR++L +NN+VYL+D 
Sbjct: 277 YKLNKGKIYVYSLPHCQLQQVIELPLINNSDFEHDLISFQPVSVNRVLLTVNNIVYLLDL 336

Query: 340 LHRSILAEREFTHVKTFQLLQSATI-GDSNITQRTIAIGVSTKSGPTSASALELINIEVG 398
           LH S L +RE +HVKTFQLL +A I  + + + +TIAIG+STK+G    S+LE+INI+VG
Sbjct: 337 LHCSTLGQRELSHVKTFQLLNTAVINSEKSHSSKTIAIGISTKNGANPTSSLEIINIDVG 396

Query: 399 SGTLKDSLGKGVSKKLSEGSHSDLKPLFDEND--EKSLIGTPVHDISNVKSFNFNKI--- 453
           + TLKDSLGK    +  + S   LKPLFD+ +  E  +    +    ++ +F +++I   
Sbjct: 397 TNTLKDSLGKSFQAE-KKDSSVILKPLFDDEEVTENMVKRNNIDGDISIPTFQYDEIIVK 455

Query: 454 LADLKSSDTISDFDKTFFESLEIKENHYTENDRFISDQDFIANTIDLIFKKFD-TEFPKA 512
           L+ LKS+D I+ FD  FF+ L+IKE HYTE DRFISD  F+   +DLIF+KF+  ++PK 
Sbjct: 456 LSALKSND-ITSFDDIFFKDLKIKEEHYTEKDRFISDLVFLNKVLDLIFEKFNGNDYPKT 514

Query: 513 FTFLLTHPLFPIKLTVGLLDKLKDHPRLFKQAIVTCPNLPLSELLFQLFTVKNGELTLDI 572
            TFLLTHPLFP+  T  LL  L+D PRLFKQAIVTCPNLPL+ELL +LF+++N EL LDI
Sbjct: 515 LTFLLTHPLFPLDRTRNLLSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNKELLLDI 574

Query: 573 SLRVLQDYSRNDVKQEIKKLDNVDXX-----XXXXXXXXXXXXXXXXXXXXLFQLLSLVL 627
           S R+LQD++R+ +KQE+K+L  +D                           LFQLLSLVL
Sbjct: 575 SFRILQDFTRDSIKQEMKRLSKLDIQNFIEFMTSTENDNSLEGFNHSQSTQLFQLLSLVL 634

Query: 628 DSIGLFALKGPLLERLSNYINEQVTIAERSSELWHLLDTSTTPRPFKNAYLKSVIGNKET 687
           DSIGLF+L+G LLE L++YI++QV IAER++ELW+L+D  ++   F N   +S    K+ 
Sbjct: 635 DSIGLFSLEGALLESLTSYIDKQVKIAERNTELWNLIDIKSSQHGFTNLAFESASSQKQA 694

Query: 688 LSVYSVDYLDI 698
           L  Y+++YLDI
Sbjct: 695 LPTYTMEYLDI 705

>SAKL0F02838g Chr6 (240272..242236) [1965 bp, 654 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 654

 Score =  501 bits (1290), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 311/703 (44%), Positives = 426/703 (60%), Gaps = 56/703 (7%)

Query: 1   MPSLSQPFRLAVLPKIASLSNYSLQTDYLQVAPDTFTYDTNKVTLXXXXXXXXXXXXNPT 60
           M S+SQPFRL  LPKIASL+N+S QTDYLQVA +T T   NK+ +            NPT
Sbjct: 1   MASISQPFRLTALPKIASLNNFSTQTDYLQVA-NTLTPSANKINIGVSGSSISQYIINPT 59

Query: 61  PKLLFNIAIPSTNNVTASNISHYIEEVENANSTVTTDKSDLVDKDNMESTEEVSVAENTD 120
           PKL+ N++IPST+ VTA ++S   E  +N   T T                         
Sbjct: 60  PKLVHNLSIPSTSIVTACDVS---EIQQNEGDTETQ------------------------ 92

Query: 121 VTKRSVELWAYGLVANKSNTLNISVKTTGLDEFSTTPGEIIRKKTIKVDSKVVNIKIFKE 180
                 E+W Y LVANKS TLN  +K    D  S    +      + +  KV ++KIF  
Sbjct: 93  ------EVWCYALVANKSFTLNTIIKPLTADAPSVNSTQTFENYKVSIKHKVASVKIFPS 146

Query: 181 FKTIVVVLKNGLVKLFDFDLNLKSSLDIAYNDVQFVQHFT-ESKQNFLLILSNIDEEKSS 239
            KTI+ VL+NGLV+ FDF L L  S DI+Y ++  V++FT E  Q+F+++L++++++K  
Sbjct: 147 RKTIIAVLQNGLVQTFDFQLKLLHSADISYGNISLVKYFTNEVLQDFMIVLTDLNDDK-- 204

Query: 240 VCFKLYQLRLDSDSN-QVSELSFSILQDFDLSKSKLSYQFGKLYRLTGSELFVYSLPQCQ 298
           VC+KL+++ +  DSN  + EL+  IL+ F L  SK  YQFGK+Y L+  ++ +YSLP  Q
Sbjct: 205 VCYKLFEI-IHHDSNVPLKELNSVILEGFSLQNSKTFYQFGKIYTLSNGKISIYSLPHFQ 263

Query: 299 LLQNISLAEIFPNTIDVSSIKPVANNRLVLAINNVVYLIDTLHRSILAEREFTHVKTFQL 358
           L   I+L   F    +V S KP++ NR +L ++N +YL+D LH +IL++RE THVKTFQL
Sbjct: 264 LSNTINLP--FVTHENVVSFKPISTNRALLTVDNRIYLLDLLHNAILSQRELTHVKTFQL 321

Query: 359 LQSATI-GDSNITQRTIAIGVSTKSGPTSASALELINIEVGSGTLKDSLGKGVSKKLSEG 417
           L +A I G++    +TIAIGVSTKS   + SAL+++NI VGSGTLKDS+ KG   +  + 
Sbjct: 322 LTTAIIPGNTAENNKTIAIGVSTKSDNNATSALDIVNINVGSGTLKDSMSKGFLTQ--DA 379

Query: 418 SHSDLKPLFDENDEKSLI-GTPVHDISNVKSFNFNKILADL-KSSDTISDFDKTFFESLE 475
           +   L  LFDE D++    GT          F++N+IL++L K+      FD  FF+SL 
Sbjct: 380 TEEVLNSLFDEQDDELDEDGT--------SQFDYNQILSELEKAKSKTEKFDNVFFKSLN 431

Query: 476 IKENHYTENDRFISDQDFIANTIDLIFKKFDTEFPKAFTFLLTHPLFPIKLTVGLLDKLK 535
           IK+ +YTE DRF + Q F+   + LIF+ F+ E+P+A T+LLTHPLFP K    LL K K
Sbjct: 432 IKKEYYTEYDRFFNSQGFLDKVLSLIFENFNKEYPRALTYLLTHPLFPAKHATCLLSKFK 491

Query: 536 DHPRLFKQAIVTCPNLPLSELLFQLFTVKNGELTLDISLRVLQDYSRNDVKQEIKKLDNV 595
           +HPRLF+QAIVTCPNLPL  LL +LFTV N EL LD+SLR+LQD++++ +KQ IKK+  V
Sbjct: 492 EHPRLFRQAIVTCPNLPLDALLHELFTVINDELCLDLSLRILQDFTKDSIKQSIKKMSKV 551

Query: 596 DXXXXXXXXXXXXXXXXXXXXX-XLFQLLSLVLDSIGLFALKGPLLERLSNYINEQVTIA 654
           D                       LFQLL+LVLDSIGLFAL G  LE L  +I  QV I 
Sbjct: 552 DINNFIGFVINEDDDEERNKSKPQLFQLLNLVLDSIGLFALDGESLENLHQFIENQVDIV 611

Query: 655 ERSSELWHLL-DTSTTPRPFKNAYLKSVIGNKETLSVYSVDYL 696
           E++ EL +LL DTS       ++Y  S    ++ L  YSV+YL
Sbjct: 612 EQNIELLNLLDDTSAKSTSIISSYSASSSTTEQALPSYSVEYL 654

>KLTH0F14762g Chr6 complement(1209571..1211523) [1953 bp, 650 aa]
           {ON} similar to uniprot|P53276 Saccharomyces cerevisiae
           YGR128C UTP8 Nucleolar protein required for export of
           tRNAs from the nucleus also copurifies with the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 650

 Score =  499 bits (1286), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 285/703 (40%), Positives = 431/703 (61%), Gaps = 58/703 (8%)

Query: 1   MPSLSQPFRLAVLPKIASLSNYSLQTDYLQVAPDTFTYDTNKVTLXXXXXXXXXXXXNPT 60
           MPS+SQPFRL  LPKIASL+NY+ Q +YLQVA DT T  TN + +            NPT
Sbjct: 1   MPSISQPFRLTALPKIASLNNYATQGNYLQVA-DTLTPTTNNINVGVSGSAVSQYIINPT 59

Query: 61  PKLLFNIAIPSTNNVTASNISHYIEEVENANSTVTTDKSDLVDKDNMESTEEVSVAENTD 120
           PKL++N  I STN V+A  +         A  T T++K                      
Sbjct: 60  PKLVYNQPISSTNVVSACAV---------AEITTTSEKD--------------------- 89

Query: 121 VTKRSVELWAYGLVANKSNTLNISVKTTGLDEFSTTPGEIIRKKTIKVDSKVVNIKIFKE 180
               S E+  YG+ +N+  +L  ++K        ++ GE      + V  ++VN+K+F +
Sbjct: 90  ----SQEVICYGIQSNRVYSLCATIKPVSSTASDSSFGETYAAHKVSVSDQIVNLKVFPD 145

Query: 181 FKTIVVVLKNGLVKLFDFDLNLKSSLDIAYNDVQFVQHFT-ESKQNFLLILSNIDEEKSS 239
            K+IV VL++GL++ FDF+L L+ SLD +Y +V +VQHFT ES Q +  +LS+ID  K  
Sbjct: 146 TKSIVAVLRSGLIQFFDFELKLQHSLDSSYKNVSYVQHFTSESGQRYTFLLSDIDGHK-- 203

Query: 240 VCFKLYQLRLDSDSNQVSELSFSILQDFDLSKSKLSYQFGKLYRLTGSELFVYSLPQCQL 299
           V FKL+++     +   +ELS  IL++  L  S++ YQFG++YRL G+ + +Y+LP  Q 
Sbjct: 204 VSFKLFEIGQSDSATPATELSSVILENMCLKDSQIFYQFGQVYRLHGNAVSIYNLPHFQH 263

Query: 300 LQNISLAEIFPNTIDVSSIKPVANNRLVLAINNVVYLIDTLHRSILAEREFTHVKTFQLL 359
            + I L  + P +I   S KP++ NR +L  +N ++L+D LH +IL++RE  HVK FQLL
Sbjct: 264 SRTIELPFLAPESI--ISFKPISTNRALLTSDNKIFLLDLLHNAILSQREMGHVKIFQLL 321

Query: 360 QSATI-GDSNITQRTIAIGVSTKSGPTSASALELINIEVGSGTLKDSLGKGVSKKLSEGS 418
           ++A I G+S +  +TIA+GVS K G   +S+L++INI+VG+GTL+DS+GKG   + ++  
Sbjct: 322 ETAVIPGNSTLNNKTIALGVSIKHGSNPSSSLDIINIDVGTGTLRDSMGKGFMSRENKSQ 381

Query: 419 HSDLKPLFDE-NDEKSLIGTPVHDISNVKSFNFNKILADL-KSSDTISDFDKTFFESLEI 476
           H  L+PL    ND ++              FN+++IL +L K++D I +FD  FF+ L I
Sbjct: 382 H--LQPLISTLNDTEA------------AEFNYDRILKELSKAADNIENFDSVFFKRLGI 427

Query: 477 KENHYTENDRFISDQDFIANTIDLIFKKFDTEFPKAFTFLLTHPLFPIKLTVGLLDKLKD 536
           K N+YT++DRF++D++F+ +   LIFK F +E+PKA T+LLT+PLFP+  T  LL KLKD
Sbjct: 428 KNNYYTDSDRFVNDREFLEDVSTLIFKSFKSEYPKALTYLLTNPLFPVSHTHNLLQKLKD 487

Query: 537 HPRLFKQAIVTCPNLPLSELLFQLFTVKNGELTLDISLRVLQDYSRNDVKQEIKKLDNVD 596
           HPRLFKQAIVTCPNL L EL+ +LFTV N EL LD+SLR+LQD++++ +K+ IK+   +D
Sbjct: 488 HPRLFKQAIVTCPNLLLDELVQELFTVINDELCLDLSLRILQDFNKDSIKEAIKQKSKID 547

Query: 597 XXX-XXXXXXXXXXXXXXXXXXXLFQLLSLVLDSIGLFALKGPLLERLSNYINEQVTIAE 655
                                  LFQLLSLVLDS+GLFAL+  +LE+L+ YI++Q+++ +
Sbjct: 548 VNNFINFVISENFEEDRIKNKPRLFQLLSLVLDSVGLFALENEMLEKLTKYIDQQLSVVK 607

Query: 656 RSSELWHLLDTSTTPRPFKNAYLKSVIGNKETLSVYSVDYLDI 698
            + EL++L++       F      +    +  ++ YS++ L++
Sbjct: 608 ENVELYNLVEEKNFKNGFGQPLGDTSTSGEPVITAYSIEQLEL 650

>AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR128C
           (UTP8)
          Length = 650

 Score =  493 bits (1270), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 305/722 (42%), Positives = 425/722 (58%), Gaps = 98/722 (13%)

Query: 1   MPSLSQPFRLAVLPKIASLSNYSLQTDYLQVAPDTFTYDTNKVTLXXXXXXXXXXXXNPT 60
           M  ++QPFRLA LPKI+SL+NY+ QT YLQVA D     +N VT+            NPT
Sbjct: 1   MAYIAQPFRLANLPKISSLNNYAQQTSYLQVA-DVLEPTSNTVTVGVSGSSISQYVINPT 59

Query: 61  PKLLFNIAIPSTNNVTASNISHYIEEVENANSTVTTDKSDLVDKDNMESTEEVSVAENTD 120
           PKL++NI IPSTN VT  ++                    L   D               
Sbjct: 60  PKLVYNIPIPSTNVVTGCDV--------------------LAMSDG-------------- 85

Query: 121 VTKRSVELWAYGLVAN-KSNTLNISVKTTGLDEFSTTPGEIIR--------KKTIKVDSK 171
                 ELW+Y L AN K +TL+  ++  G       P E           K+T+K   +
Sbjct: 86  -----AELWSYALTANGKVHTLHAVLRKAG-----AAPQETGLDASEDEHFKQTLK--GR 133

Query: 172 VVNIKIFKEFKTIVVVLKNGLVKLFDFDLNLKSSLDIAYNDVQFVQHFTESK-QNFLLIL 230
           VV ++I    K I+VVL  GL++ +D+ L L  SLDI+Y +V  V++FT+S  ++++ +L
Sbjct: 134 VVRVRILSACKRIMVVLDCGLIQTYDYQLQLLHSLDISYTNVGLVEYFTDSAGKDYMFVL 193

Query: 231 SNIDEEKSSVCFKLYQLRLDSDSNQVSELSFSILQDFDLSKSKLSYQFGKLYRLTGSELF 290
            +I  +K+  C+KL+QL   +++  ++EL+  IL+DF L++SK+ YQFGKLYRL  S+++
Sbjct: 194 CDIQNKKT--CYKLFQLNHSAENLPITELNSVILEDFALAESKMVYQFGKLYRLVDSKMY 251

Query: 291 VYSLPQCQLLQNISLAEIFPNTIDVSSIKPVANNRLVLAINNVVYLIDTLHRSILAEREF 350
           VYSLP  QL   + L   F    D  S++ ++ NRL+L   N ++L+D LH +IL ERE 
Sbjct: 252 VYSLPHFQLSHCVPLP--FVRKDDQVSLQAISTNRLLLTCCNKIFLLDLLHNAILYEREL 309

Query: 351 THVKTFQLLQSATI-----GDSNITQRTIAIGVSTKSGPTSASALELINIEVGSGTLKDS 405
           +++K FQLL++A I     G+SN   RT AIGVSTK G   +SAL+++ I VG+GTLKDS
Sbjct: 310 SNIKFFQLLRAAVIPGTTPGESN---RTFAIGVSTKQGSNPSSALDVVTIAVGTGTLKDS 366

Query: 406 LGKGVSKKLSEGSHSD---LKPLFDENDEKSLIGTPVHDISNVKSFNFNKILADLKSSDT 462
           LGKG       G H     LKPLF  +D++S             + +F  ILA+L S  T
Sbjct: 367 LGKG----FLSGEHRRTEALKPLFGTDDDES------------PNIDFAAILAELTSRTT 410

Query: 463 ISDFDKTFFESLEIKENHYTENDRFISDQDFIANTIDLIFKKFDTEFPKAFTFLLTHPLF 522
              FD  F++ L  K+ +YTE+DRFI++ +F+A  +D IF  F  EFPKA  +LLTHPLF
Sbjct: 411 PKAFDSIFYKRLGPKKEYYTEHDRFINNSEFLAGILDHIFATFADEFPKALIYLLTHPLF 470

Query: 523 PIKLTVGLLDKLKDHPRLFKQAIVTCPNLPLSELLFQLFTVKNGELTLDISLRVLQDYSR 582
           P   T GLL KLK HPRLFKQA+VTCPNLPL ELL +LFTV N EL+LD+SLRVLQ++++
Sbjct: 471 PSSHTKGLLPKLKAHPRLFKQAVVTCPNLPLDELLHELFTVLNDELSLDLSLRVLQEFTK 530

Query: 583 NDVKQEIKKLDNVDXX--XXXXXXXXXXXXXXXXXXXXLFQLLSLVLDSIGLFALKGPLL 640
            D+KQ I++L  VD                        LFQLLSLV+D++GL AL+G +L
Sbjct: 531 EDIKQGIRELSRVDLHNFLNFVIKDSTDVEERQKAKPQLFQLLSLVIDAVGLLALEGDIL 590

Query: 641 ERLSNYINEQVTIAERSSELWHLLDTSTTPRPFKNAYLKSVIGNKE-----TLSVYSVDY 695
            RLS +I+ QV +A++  EL +LL+ S+T    K  +L SV    E     T+ +YSV+Y
Sbjct: 591 HRLSAFIDSQVAVADQLVELLYLLENSSTK---KGKHLNSVTRLDESPVAATIPLYSVEY 647

Query: 696 LD 697
           LD
Sbjct: 648 LD 649

>CAGL0I10560g Chr9 (1043862..1045898) [2037 bp, 678 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128c
          Length = 678

 Score =  483 bits (1242), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 294/709 (41%), Positives = 444/709 (62%), Gaps = 42/709 (5%)

Query: 1   MPSLSQPFRLAVLPKIASLSNYSLQTDYLQVAPDTFTYDTNKVTLXXXXXXXXXXXXNPT 60
           MPSLSQPFRLAVLPKIASL N+S +  Y++VA D+FT D+N V L             PT
Sbjct: 1   MPSLSQPFRLAVLPKIASLHNFSQKKTYIKVA-DSFTPDSNSVLLGISGSSISKYVITPT 59

Query: 61  PKLLFNIAIPSTNNVTASNISHYIEEVENANSTVTTDKSDLVDKDNMESTEEVSVAENTD 120
           P+L+FN+ IPST+ V+A N+  Y E      STV++D     D    E+T+    + NT 
Sbjct: 60  PRLIFNVPIPSTHLVSACNMGTYSE-----TSTVSSDPQATAD----ETTDTAPTSTNTV 110

Query: 121 VTKRSVELWAYGLVAN-KSNTLNISVKTTGLDEFSTTPGEIIRKKTIKVDSKVVNIKIFK 179
              +  E+W Y L AN K++TLN  ++   +D  +T+  E   +   K   +++NI++  
Sbjct: 111 EETKHYEIWCYALSANNKTHTLNCLIRE--VDNNNTSITENNPQFNAKFKEQIINIEVDT 168

Query: 180 EFKTIVVVLKNGLVKLFDFDLNLKSSLDIAYNDVQFVQHFTESKQNFLLILSNIDEEKSS 239
           + K IV++ + GLV+ +D  L L +S++  Y D++ V+ F E+   ++L++S++ ++K  
Sbjct: 169 KHKVIVILFETGLVQFYDLQLKLLNSINTPYRDIKIVKTFEENGLEYMLLISDLKDQK-- 226

Query: 240 VCFKLYQLRLDSDSNQVSELSFSILQDFDLSKSKLSYQFGKLYRLTGSELFVYSLPQCQL 299
           V  +LY++   ++  +V EL+ SI+++F+L  S L YQFG++YRL   E+ VYS+P  QL
Sbjct: 227 VALQLYEV--STEEKKVKELTSSIIENFNLQDSLLCYQFGRIYRLFKDEIEVYSIPSLQL 284

Query: 300 LQNIS---LAEIFPNTIDVSSIKPVANNRLVLAINNVVYLIDTLHRSILAEREFTHVKTF 356
              +    L+EI      +S +KP+A NR++L + N +YL+D LH+SIL+ERE +H+KTF
Sbjct: 285 NSKVKIPFLSEIEDKNCLIS-LKPIATNRVLLTVKNKIYLLDLLHKSILSEREVSHMKTF 343

Query: 357 QLLQSATIGDSNITQRTIAIGVSTKSGPTSASALELINIEVGSGTLKDSLGKGVSKKLSE 416
           Q+L++A   D + ++ T+A+G+STK+G    SALE+INI+VGS +LKDSLGK   ++ + 
Sbjct: 344 QILKTAMNRDGSESKLTLALGISTKNGQNPTSALEIINIDVGSNSLKDSLGKSFLRR-NN 402

Query: 417 GSHSDLKPLFDENDEKSLIGTPVHDISNVKSFNFNKILADLKSSDTISDFDKTFFESLEI 476
                LK LF E         P +++    S NF +IL  LK++++   FD+TFF  L I
Sbjct: 403 QIQGQLKNLFPE---------PKYELP---SINFPEILGKLKNANSAEKFDETFFNLLNI 450

Query: 477 KENHYTENDRFISDQDFIANTIDLIFKKFD--TEFPKAFTFLLTHPLFPIKLTVGLLDKL 534
           KE  +TEN RF++DQ F+A+ +DLIF K D     P++  FLLTHPLFP +  +GLL K+
Sbjct: 451 KEEMFTENSRFLNDQRFLASVLDLIFTKIDYNKSCPRSLMFLLTHPLFPKEKAIGLLTKV 510

Query: 535 KDHPRLFKQAIVTCPNLPLSELLFQLFTVKNGELTLDISLRVLQDYSRNDVKQEIKKLDN 594
           K + RLFKQAIVTCPNLPL ELL +LFT+KN EL +DIS+R+LQDY+++ +K+EIKKLD 
Sbjct: 511 KSNSRLFKQAIVTCPNLPLQELLQELFTIKNSELVVDISMRILQDYTKDAIKEEIKKLDQ 570

Query: 595 VDXX-----XXXXXXXXXXXXXXXXXXXXLFQLLSLVLDSIGLFALKGPLLERLSNYINE 649
           V                            +F+LLSL+LDSIGLF L+  +L +LS+ I +
Sbjct: 571 VSVENFMNFIIKMNNREAAVSDFTMFTPQIFKLLSLILDSIGLFGLEESILIQLSSIIEK 630

Query: 650 QVTIAERSSELWHLLDTSTTPRPFKNAYLKSVIGNKETLSVYSVDYLDI 698
           +V IAER+ ELW+++D         ++   S +  + + + Y V+Y+DI
Sbjct: 631 EVKIAERNVELWNIMDAKMLSVKKSSSTAASKLA-ENSQTPYIVEYIDI 678

>NDAI0G00960 Chr7 (199784..201886) [2103 bp, 700 aa] {ON} Anc_3.489
           YGR128C
          Length = 700

 Score =  475 bits (1222), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 315/754 (41%), Positives = 434/754 (57%), Gaps = 110/754 (14%)

Query: 1   MPSLSQPFRLAVLPKIASLSNYSLQTDYLQVAPDTFTYDTNKVTLXXXXXXXXXXXXNPT 60
           MPSLSQPFRL VLPKIASLSNYSLQ DY+QV   TF   TNKV +            NPT
Sbjct: 1   MPSLSQPFRLTVLPKIASLSNYSLQGDYIQVTKSTFNPTTNKVVIGVSGSAISQYIINPT 60

Query: 61  PKLLFNIAIPSTNNVTASNISHYIEEVENANSTVTTDKSDLVDKDNMESTEEVSVAENTD 120
           PKL+FN  IPSTN VTA ++                                       D
Sbjct: 61  PKLIFNYPIPSTNIVTACDVLE------------------------------------ND 84

Query: 121 VTKRSVELWAYGLVANKSNTLNISVK--------------------TTGLDEFSTTPGEI 160
               + E+W +GLVANK+ TL +  K                    TT  DEF+      
Sbjct: 85  NDNTNNEVWCFGLVANKTYTLTLITKDKQKSSATMEDDEDVVDVIDTTIKDEFN------ 138

Query: 161 IRKKTIKVDSKVVNIKIFKEFK---TIVVVLKNGLVKLFDFDLNLKSSLDIAYNDVQFVQ 217
                +K+DSK+V+IKI K+     +I++VL+NGL++ F+  L L +++ I Y +V+FV+
Sbjct: 139 -----VKLDSKIVDIKIIKKKADDISIMIVLENGLIQFFNSSLKLLNTVKINYKNVKFVE 193

Query: 218 HFTESKQNFLLILSNIDEEKSSVCFKLYQLRLDSDSNQVSELSFSILQDFDLSKSKLSYQ 277
           HF E  ++F+  + ++ +  + VC KL+Q+  DS      EL+  I+++F+   +K  YQ
Sbjct: 194 HFKEDNKDFMFTICDLGDN-NKVCIKLFQINNDS----AIELNSIIMENFNGQNAKFCYQ 248

Query: 278 FGKLYRLTGSELFVYSLPQCQLLQNISLAEIFPNTIDVSSIKPVANNRLVLAINNVVYLI 337
           FGK Y+LT + L VYSLPQ QL    ++  I  +   + S+KP++ NR++L INN +YL+
Sbjct: 249 FGKFYKLTNNNLMVYSLPQFQLEHTTTIPMIKTDD-QIVSMKPISTNRILLTINNKIYLL 307

Query: 338 DTLHRSILAEREFTHVKTFQLLQSATIGDSNITQRTIAIGVSTKSGPTSASALELINIEV 397
           D +H SIL+ERE TH+K+ QLL+SA IG      +TI IGVSTK G    S+LE+IN++V
Sbjct: 308 DLIHNSILSERELTHLKSLQLLRSAVIGKGENNNKTITIGVSTKFGVNPTSSLEIINVDV 367

Query: 398 GSGTLKDSLGKGVS----KKLSEGSHSDLKPLFDENDEKSLIGTPVHDISNVKSFNFNKI 453
           GS TLKDSLGK       +   + S   LKPLFD N +          +   + FN+++I
Sbjct: 368 GSNTLKDSLGKCFQNLNLQNQIQISTQALKPLFDPNTDGDKDDDLFKKLVTKEQFNYDEI 427

Query: 454 LADL-KSSDTISDFDKTFFESLEIKENHYTENDRFISDQDFIANTIDLIFKKFDT----- 507
           L  L ++++ I  FD+ FF+S  IK+ HYTENDRFI + +F    IDLIF+KF +     
Sbjct: 428 LTKLSENTNDIGKFDEIFFQSFNIKKEHYTENDRFIYNHEFFLKLIDLIFEKFGSTATTA 487

Query: 508 ---EFPKAFTFLLTHPLFPIKLTVGLLDKLKDHPRLFKQAIVTCPNLPLSELLFQLFTVK 564
              E+PK  TFLLTHPLFP++ T  LL +  +HPRLFKQAIVTCPNLPL ELL +L T+K
Sbjct: 488 QTNEYPKTLTFLLTHPLFPMERTQSLLSRFANHPRLFKQAIVTCPNLPLPELLNELLTIK 547

Query: 565 NGELTLDISLRVLQDYSRNDVKQEIKKLDNVDXXXXXXXXXXXXXXXXXXXXXXLFQLLS 624
           N EL+LDISLR+LQDYS++ +KQE++ L  ++                      LFQLL+
Sbjct: 548 NNELSLDISLRILQDYSKDSIKQELRNLPRLE-IENFIDFILNDEIKDDQNSPQLFQLLA 606

Query: 625 LVLDSIGLFALKGPLLERLSNYINEQVTIAERSSELWHLLDTSTT-------PRPFKNAY 677
           LVLDSIGLFAL   +LE LS YI+ QV+I E+++ELW+L+D++            F +A 
Sbjct: 607 LVLDSIGLFALSDNILENLSAYIDRQVSIVEKNTELWYLIDSNNNIFSHNKKDNSFSSAS 666

Query: 678 LKS-------------VIGNKETLSVYSVDYLDI 698
             +                 KE L +YSVDYL++
Sbjct: 667 ASTNSKSNNISSNNKKSFTQKEALPMYSVDYLEL 700

>KLLA0E04665g Chr5 (414183..416126) [1944 bp, 647 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 647

 Score =  471 bits (1211), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 276/704 (39%), Positives = 421/704 (59%), Gaps = 65/704 (9%)

Query: 1   MPSLSQPFRLAVLPKIASLSNYSLQTDYLQVAPDTFTYDTNKVTLXXXXXXXXXXXXNPT 60
           M S+SQPFRL+ LPKI SL+NY+ QTDYLQV  D  +   NKV +            NPT
Sbjct: 1   MASISQPFRLSALPKIPSLNNYANQTDYLQVV-DNLSPSANKVNIGISGSSISQYLINPT 59

Query: 61  PKLLFNIAIPSTNNVTASNISHYIEEVENANSTVTTDKSDLVDKDNMESTEEVSVAENTD 120
           PKL+FN+ IPSTN VTA ++      VE+A +T                           
Sbjct: 60  PKLVFNLPIPSTNIVTACDV------VEDAANT--------------------------- 86

Query: 121 VTKRSVELWAYGLVANKSNTLNISVKTTGLDEFSTTPGEIIRKKTIKVDSKVVNIKIFKE 180
                 E+W YGL A K + L+++ K    D  S++  EI  +   K+ S+VV+IKI+ +
Sbjct: 87  ------EVWCYGLEARKVSHLHLATKPMIQDAVSSSNAEITSQFKYKLKSEVVSIKIYSK 140

Query: 181 FKTIVVVLKNGLVKLFDFDLNLKSSLDIAYNDVQFVQHFTESKQN-FLLILSNIDEEKSS 239
            + ++V+L+NGL++ FD++L L +++DI+Y+D++FVQ F + + N F  +L  + +EK  
Sbjct: 141 AEKVLVILRNGLIQTFDYELKLSNTIDISYDDIRFVQFFQDGQGNDFFFVLCQLSDEK-- 198

Query: 240 VCFKLYQLRLDSDSNQVSELSFSILQDFDLSKSKLSYQFGKLYRLTGS-ELFVYSLPQCQ 298
           +C+KL+Q+R  S+S    EL+  IL+++ L  +KL ++FGKLY L  S EL +Y LP  Q
Sbjct: 199 ICYKLFQVR--SESVSCIELNSIILENYTLENAKLCFEFGKLYVLKNSNELSIYQLPHLQ 256

Query: 299 LLQNISLAEIFPNTIDVSSIKPVANNRLVLAINNVVYLIDTLHRSILAEREFTHVKTFQL 358
           L  +I L  I  +   V SIKPV++NR++L  +N +YL+D L+ +IL +++  ++K  QL
Sbjct: 257 LQTSIQLPFISKDA--VVSIKPVSSNRVLLTADNTIYLVDLLYNAILFQKDLQNIKAIQL 314

Query: 359 LQSATIGD-SNITQRTIAIGVSTKSGPTSASALELINIEVGSGTLKDSLGKGVSKKLSEG 417
           L +A + + S   ++TIA+ V+TK+G    S L++INI+VG+GTLKD++GKG   K  + 
Sbjct: 315 LSTAVVQENSEDNRKTIALDVTTKNGANPTSYLDVINIDVGTGTLKDAMGKGFMVKQKQK 374

Query: 418 SHSDLKPLFDENDEKSLIGTPVHDISNVKSFNFNKILADLKSSDTISDFDKTFFESLEIK 477
               L+ LF+E++E   +  P  D        + +I+  L     I +FD  FF+ L + 
Sbjct: 375 ----LQKLFEESNEDDDVELPSPD--------YERIIKQLHICKKIENFDSIFFKMLSLD 422

Query: 478 ENHYTENDRFISDQDFIANTIDLIFKKFDTEFPKAFTFLLTHPLFPIKLTVGLLDKLKDH 537
           + +YT+NDRF++D D +   ID +F  F  E+PKA T+LLTHPLFP     GLL KLK++
Sbjct: 423 KEYYTDNDRFLNDSDLLTQIIDCLFLNFKDEYPKALTYLLTHPLFPPVHAKGLLTKLKNN 482

Query: 538 PRLFKQAIVTCPNLPLSELLFQLFTVKNGELTLDISLRVLQDYSRNDVKQEIKKLDNVDX 597
           PRLFKQAIVTCPN+PL +LL +LF + N EL  DI+LRVLQDY +  +K  I+K++ +D 
Sbjct: 483 PRLFKQAIVTCPNVPLDDLLTELFNITNAELCFDITLRVLQDYKKESIKAGIRKIEKMDI 542

Query: 598 X--XXXXXXXXXXXXXXXXXXXXLFQLLSLVLDSIGLFALKGPLLERLSNYINEQVTIAE 655
                                  +FQL+SL++DSIGLFAL    LE+LS++++ QV++  
Sbjct: 543 TNFLDMILNSNKADSDLKLNKPQIFQLMSLIIDSIGLFALDDEYLEKLSSFVDAQVSVVS 602

Query: 656 RSSELWHLLD--TSTTPRPFKNAYLKSVIGNKETLSVYSVDYLD 697
           ++ EL HL +  T  +      +   +   + + +S Y+VDYL+
Sbjct: 603 QNIELLHLAEHYTKHSSVVNNKSNSSTNSSSTQPISAYTVDYLE 646

>Kwal_55.21222 s55 complement(736354..737475) [1122 bp, 373 aa] {ON}
           YGR128C (UTP8) - Protein required for cell viability
           [contig 131] PARTIAL
          Length = 373

 Score =  334 bits (857), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 187/389 (48%), Positives = 264/389 (67%), Gaps = 24/389 (6%)

Query: 317 SIKPVANNRLVLAINNVVYLIDTLHRSILAEREFTHVKTFQLLQSATI-GDSNITQRTIA 375
           S  P++ NR +L  +N VYL+D LH +IL++REFTHVKTFQLL +A I G+S+    TIA
Sbjct: 2   SFGPISINRALLTCDNKVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNSSSNNSTIA 61

Query: 376 IGVSTKSGPTSASALELINIEVGSGTLKDSLGKGVSKKLSEGSHSDLKPLFDENDEKSLI 435
           IGV+TK G TS S+L+++NI+VG+GTLKDS+GKG    LS  +             +SL+
Sbjct: 62  IGVATKPGNTSTSSLDVVNIDVGTGTLKDSMGKGF---LSSKTKVQC--------PQSLL 110

Query: 436 GTPVHDISNVKSFNFNKILADLKSSDTISD-FDKTFFESLEIKENHYTENDRFISDQDFI 494
           GTP  + + V+  N+ +IL DL  + + SD FD  FF+ L IK ++YT++DRF++DQ+F+
Sbjct: 111 GTP--NDTEVQEHNYTQILKDLAKTKSNSDKFDSVFFKKLNIKNDYYTDSDRFLNDQEFL 168

Query: 495 ANTIDLIFKKFDTEFPKAFTFLLTHPLFPIKLTVGLLDKLKDHPRLFKQAIVTCPNLPLS 554
            N++ LIF+ F +E+PKA T+LLTHPLFPI  T  LL KLKDHPRLFKQAIVTCPNLPLS
Sbjct: 169 GNSLKLIFENFQSEYPKALTYLLTHPLFPITCTHDLLQKLKDHPRLFKQAIVTCPNLPLS 228

Query: 555 ELLFQLFTVKNGELTLDISLRVLQDYSRNDVKQEIKKLDNVDXXX-XXXXXXXXXXXXXX 613
           +LL +LFTV N EL LD+SLR+LQD+S++ +K  IK+   VD                  
Sbjct: 229 DLLQELFTVINDELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNCFINFVMNENVDEDRV 288

Query: 614 XXXXXLFQLLSLVLDSIGLFALKGPLLERLSNYINEQVTIAERSSELWHLLDTSTTPRPF 673
                LFQLL+LVLDS+GLFAL+   L++LSNYI+ Q+++ +++ +L++L+D     R F
Sbjct: 289 KNKPRLFQLLNLVLDSVGLFALEDEALDKLSNYIDRQLSVVKQNVQLYNLVD----ERNF 344

Query: 674 KN----AYLKSVIGNKETLSVYSVDYLDI 698
           KN     +  S+   +  ++ YSV+ L++
Sbjct: 345 KNILGQHHADSLSVGEGAITAYSVEQLEL 373

>KAFR0C01940 Chr3 complement(387789..389618) [1830 bp, 609 aa] {ON}
           Anc_3.489 YGR128C
          Length = 609

 Score =  275 bits (704), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 204/553 (36%), Positives = 309/553 (55%), Gaps = 53/553 (9%)

Query: 164 KTIKVDSKVVNIKIFKEFKTIVVVLKNGLVKLFDFDLNLKSSLDIAYNDVQFVQHFTESK 223
           K + + SK+  +K+F +    + +L+NG ++ +D +L +KS+    + D+  V+ F ESK
Sbjct: 92  KKVPIQSKI--MKLFSDESQTITILENGTIEKYDSNL-IKSTYKTPHKDLVNVE-FIESK 147

Query: 224 QNFLLILSNIDEEKSSVCFKLYQLRLDSDSNQVSELSFSILQDFDLSKSKLSYQFGKLYR 283
              L+         S     LY +    +   V+ +   +  DF     KL YQF +   
Sbjct: 148 YALLI---------SQNSISLYDINTMIELRNVANVQDIVDSDFKSLDGKL-YQFNQ--- 194

Query: 284 LTGSELFVYSLPQCQLLQNISLAEIFPNTIDVSSIKPVANNRLVLAINNVVYLIDTLHRS 343
              S+  ++ +    ++  I++  I     DV S   V +N +V+A+N+ +Y ++    S
Sbjct: 195 -KLSKFDIWEISSMTIVNIITIPFINDVEKDVVSFTVVDDNCVVMAVNSTIYALNLHLSS 253

Query: 344 ILAEREFTHVKTFQLLQSATIGDSNITQRTIAIGVSTKSGPTSASALELINIEVGSG-TL 402
           +++  E  ++K F+L+ + +            +G+S  +        ELIN+++ S   L
Sbjct: 254 VISMSELLNLKWFKLIDNLS--------NQFVLGLSFNN---ENYKFELINLDLNSNFGL 302

Query: 403 KDSLGKGVSK----KLSEGSHSDLKPLF--DENDEKSLIGTPVHDISNVKSFNFNKILAD 456
           KDSLGKG       K SE     LK LF  DE DE  L      D+ +  +FN++KI+ D
Sbjct: 303 KDSLGKGFRNFLVDKQSEKETLVLKSLFSADEADE-DLHNDSDSDVEH--TFNYDKIIVD 359

Query: 457 L-KSSDTISDFDKTFFESLEIKENHYTENDRFISDQDFIANTIDLIFK--KFDTE---FP 510
           L K+    S FDK FFE   IK+ HYTE DRF+ +QDF+A  I+LI +  KFDT+   +P
Sbjct: 360 LNKAVKNPSKFDKIFFEKFNIKKEHYTEADRFLVNQDFLAKVIELILQNYKFDTDGNNYP 419

Query: 511 KAFTFLLTHPLFPIKLTVGLLDKLKDHPRLFKQAIVTCPNLPLSELLFQLFTVKNGELTL 570
           K  T+LLTHPLFP+ LT  LL K ++ PRL+KQAIVTCPNLPL ELL  LFT++N EL+L
Sbjct: 420 KTLTYLLTHPLFPVSLTKNLLPKFRESPRLYKQAIVTCPNLPLGELLADLFTIENNELSL 479

Query: 571 DISLRVLQDYSRNDVKQEIKKLDNVDXXXXXXXXXXXXXXXXXXXXXXLFQLLSLVLDSI 630
           DISLRVLQDY+++ +K++IK L  VD                      LFQLLSL++DSI
Sbjct: 480 DISLRVLQDYTKDSIKEQIKLLPKVD---IRNFIEFVTQDEDQQVSSQLFQLLSLIIDSI 536

Query: 631 GLFALKGPLLERLSNYINEQVTIAERSSELWHLLDTSTTPRPFKNAYLKSVIGN-----K 685
           GLFAL   +L R+SN+INE+  +A+++SEL HLLD + + +       K +  N     +
Sbjct: 537 GLFALDMDILGRISNFINEKTLVAKQNSELLHLLDYNPSKQSSARQSSKLINNNNKSLHR 596

Query: 686 ETLSVYSVDYLDI 698
           +TL  Y+V++LD+
Sbjct: 597 KTLPTYTVEHLDL 609

 Score = 44.3 bits (103), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 40/77 (51%), Gaps = 7/77 (9%)

Query: 1  MPSLSQPFRLAVLPKIASLSNYSLQTDYLQVAPDTFTYDTNKVTLXXXXXXXXXXXXNPT 60
          MPS+SQPF +  +PK +S       T  + V+  + T ++N + +            NPT
Sbjct: 1  MPSISQPFAITTVPKQSS-------TSPIIVSSHSLTANSNSLDVAISKYAVSKFVINPT 53

Query: 61 PKLLFNIAIPSTNNVTA 77
          PKL+ +I IPS   VTA
Sbjct: 54 PKLINSIPIPSNEVVTA 70

>KNAG0B00830 Chr2 (151939..153762) [1824 bp, 607 aa] {ON} Anc_3.489
           YGR128C
          Length = 607

 Score =  264 bits (675), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 233/723 (32%), Positives = 350/723 (48%), Gaps = 146/723 (20%)

Query: 3   SLSQPFRLAVLPKIASLSNYSLQTDYLQVAPDTFTYDTNKVTLXXXXXXXXXXXXNPTPK 62
           S+SQPF +A +P+ AS      QT  L ++  + T + N + +            NPTPK
Sbjct: 4   SISQPFTIANVPRQAS------QTKVL-ISQHSLTSNANTLDVAVSKYSISQYIINPTPK 56

Query: 63  LLFNIAIPSTNNVTASNISHYIEEVENANSTVTTDKSDLVDKDNMESTEEVSVAENTDVT 122
           L+ + AIPS                   N TVT         DN                
Sbjct: 57  LVNSKAIPS-------------------NLTVTA-------FDN---------------- 74

Query: 123 KRSVELWAYGLVANKSNTLNISVKTTGLDEFSTTPGEIIRKKTIKVDSKVVNI---KIFK 179
                    G+ A +SN  +  +    LDE    P          + S VVN    KI  
Sbjct: 75  ---------GVYATQSNNKSFCLY---LDESHQIP----------LKSAVVNCLSEKIHD 112

Query: 180 EFKTIVVVLKNGLVK-------LFDFDLNLKSSLDIAYNDVQFVQHFTESKQNFLLILSN 232
           E      +L++G V+       +F   L LK    + + D Q+      ++   L  L N
Sbjct: 113 ESVVTTAILQDGTVQKYKGGEQVFAKHLPLKDIKQVEFIDGQYAL-IVAAQSTALYELEN 171

Query: 233 IDEEKSSVCFKLYQLRLDSDSNQVSELSFSILQDFDLSKSKLSYQFGKLYRLTG-SELFV 291
           + E + S      Q +      Q+ +    I Q FDL+ +       K++ LT  +E+ V
Sbjct: 172 LTELRVSTTLHFEQFK------QIRQHLGKIYQ-FDLATNDF-----KIFELTTLNEIGV 219

Query: 292 YSLPQCQLLQNISLAEIFPNTIDVSSIKPVANNRLVLAINNVVYLIDTLHRSILAEREFT 351
            ++P       +S ++  P T  V     V ++R+ LA+ N +YL+D    S+L+  +F 
Sbjct: 220 VNIP------FLSASKGAPLTFTV-----VGDSRVCLALANEIYLLDLHLGSVLSHNKFA 268

Query: 352 HVKTFQLLQSATIGDSNITQRTIAIGVSTKSGPT-SASALELINIEVGSGTLKDSLGKG- 409
            +K  +L+  A  G       + AI +S   GP  +A +L++IN+E+GS ++KDSLGKG 
Sbjct: 269 QLKQVELIAGARDG-------SFAIALS--HGPQDNAVSLDIINLELGSRSIKDSLGKGF 319

Query: 410 ---VSKKLSEGSHSDLKPLFDENDEKSLIGTPVHDISNVKSFNFNKILADL-KSSDTISD 465
              + ++ S  S   L+P+ D  D+              +SF++  IL  L  ++   + 
Sbjct: 320 ATFMKERRSAESQVTLRPILDAGDKTK------------RSFDYASILKKLTAAAKDPAK 367

Query: 466 FDKTFFESLEIKENHYTENDRFISDQDFIANTIDLIFKKFDTE----FPKAFTFLLTHPL 521
           FD+ FF+ L I +  YTE DRFI DQ+F++ T+ +I K +  E    +P AFT+LLTHPL
Sbjct: 368 FDQIFFKELYIVQECYTEGDRFIIDQNFLSETVGVILKNYSFEPSSKYPAAFTYLLTHPL 427

Query: 522 FPIKLTVGLLDKLKDHPRLFKQAIVTCPNLPLSELLFQLFTVKNGELTLDISLRVLQDYS 581
           FP   T  LL K+K  PRL+KQ IVTCPNLPL ELL + F ++N EL+LD+SL++LQDY+
Sbjct: 428 FPADKTRHLLSKVKQIPRLYKQVIVTCPNLPLDELLTESFVIENNELSLDLSLKILQDYT 487

Query: 582 RNDVKQEIKKLD--NVDXXXXXXXXXXXXXXXXXXXXXXLFQLLSLVLDSIGLFALKGPL 639
           ++ +K+E+K L   NV                       LFQLLSLV+DSIGLFAL G L
Sbjct: 488 KDSIKKEMKALPRVNVTNFIKFVIGNYNNSDESSVATPQLFQLLSLVIDSIGLFALDGEL 547

Query: 640 LERLSNYINEQVTIAERSSELWHLLDTSTTPRPF----KNAYLKSVIGNKETLSVYSVDY 695
           L  L+ YI+  V IAE ++ELW+LL+  T         ++ Y+K+    K+    Y VD+
Sbjct: 548 LTELAGYIDNMVKIAEMNTELWNLLEFRTNKASVAGSNRSKYVKT---QKKVFPPYLVDH 604

Query: 696 LDI 698
           L+I
Sbjct: 605 LEI 607

>Kwal_55.21225 s55 complement(737726..738370) [645 bp, 215 aa] {OFF}
           YGR128C (UTP8) - Protein required for cell viability
           [contig 130] PARTIAL
          Length = 215

 Score =  157 bits (397), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 97/245 (39%), Positives = 135/245 (55%), Gaps = 35/245 (14%)

Query: 1   MPSLSQPFRLAVLPKIASLSNYSLQTDYLQVAPDTFTYDTNKVTLXXXXXXXXXXXXNPT 60
           MPS+SQPFRL  LPKIASL+NY+ Q  YLQVA DT T  TN+V +            NPT
Sbjct: 1   MPSISQPFRLTALPKIASLNNYATQGSYLQVA-DTLTPATNRVNVGISGSAISQYVINPT 59

Query: 61  PKLLFNIAIPSTNNVTASNISHYIEEVENANSTVTTDKSDLVDKDNMESTEEVSVAENTD 120
           PKL++N+ I STN VTA +++                    V   N E T E        
Sbjct: 60  PKLVYNLPISSTNVVTACDVAE-------------------VAGTNNEGTAEAH------ 94

Query: 121 VTKRSVELWAYGLVANKSNTLNISVKTTGLDEFSTTPGEIIRKKTIKVDSKVVNIKIFKE 180
                 E+  Y L ANK+ ++    K        ++ GE      + + ++ VN+K+F  
Sbjct: 95  ------EVLCYALQANKTFSICAVKKPIPSAATDSSFGETYATHKVALANQAVNVKVFPA 148

Query: 181 FKTIVVVLKNGLVKLFDFDLNLKSSLDIAYNDVQFVQHF-TESKQNFLLILSNIDEEKSS 239
            K+IV VL +GL++ FD+DL L+ S+D +Y +VQFVQHF +ESKQ+F+ +LS++D  K  
Sbjct: 149 TKSIVAVLSSGLIQFFDYDLKLQHSIDSSYGNVQFVQHFVSESKQDFMFLLSDLDGRK-- 206

Query: 240 VCFKL 244
           V FKL
Sbjct: 207 VSFKL 211

>TBLA0A00380 Chr1 complement(71855..74446) [2592 bp, 863 aa] {ON}
           Anc_8.493 YPL045W
          Length = 863

 Score = 32.0 bits (71), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 39/79 (49%), Gaps = 11/79 (13%)

Query: 426 FDENDEKSLIGT--PVHDISNVKSFNFNKILADLKSSDTISDFDKTFFESLEIKENHYTE 483
           F+ N+E  +I T   +H I N     +  I   L  +D+I DF K +F  L+  +N Y  
Sbjct: 84  FNHNNENLIIITNDSIHQIKNWTPLEYTSISLPLSLNDSIWDFKKNYF-ILKESQNIYFY 142

Query: 484 NDRFISDQDFIANTIDLIF 502
           ND        I N+I+LIF
Sbjct: 143 ND--------IQNSIELIF 153

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 70,966,512
Number of extensions: 3207953
Number of successful extensions: 14383
Number of sequences better than 10.0: 119
Number of HSP's gapped: 14916
Number of HSP's successfully gapped: 129
Length of query: 698
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 581
Effective length of database: 40,065,477
Effective search space: 23278042137
Effective search space used: 23278042137
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)