Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0C044503.488ON30930916520.0
Kpol_480.173.488ON3133128341e-111
TDEL0D055603.488ON3113118011e-106
YPR147C3.488ON3043097671e-101
TPHA0D042203.488ON3163177641e-100
NCAS0F035303.488ON3133207601e-100
Smik_16.4003.488ON3043097511e-98
Skud_16.4423.488ON3043107477e-98
Suva_16.4763.488ON3043097468e-98
ZYRO0D10076g3.488ON3053097261e-94
CAGL0L08514g3.488ON3123137112e-92
KLTH0F14740g3.488ON3022986731e-86
NDAI0B058303.488ON3293346621e-84
Kwal_55.212193.488ON3022856312e-80
SAKL0F02860g3.488ON3053096225e-79
AFR306C3.488ON3192845811e-72
Ecym_12413.488ON3052885564e-69
KAFR0E03110singletonON356127840.044
KLLA0F07381g2.379ON270128770.30
NDAI0C054308.524ON362116770.34
Kpol_1028.877.497ON44746770.42
NCAS0B022608.524ON363119760.47
ZYRO0F15950g1.114ON69350750.67
KAFR0E031208.524ON346150740.72
TDEL0C058701.114ON71750731.4
Smik_10.3861.114ON64950731.4
TDEL0B032508.524ON348121721.5
YJR098C1.114ON65656721.5
TDEL0A039805.535ON24377701.8
KLTH0H14322g1.460ON68183721.9
Kwal_14.1435singletonOFF16870673.5
Smik_2.3458.524ON375141683.9
ZYRO0F09064g8.524ON349110684.6
NCAS0H005401.114ON71447684.7
SAKL0H10450g8.524ON39244675.7
CAGL0G08624g2.242ON58387676.1
CAGL0M05467g8.524ON354114666.8
TPHA0L016008.524ON372111666.9
Ecym_13761.466ON75376676.9
YBR204C (LDH1)8.524ON375142667.4
TBLA0H035408.524ON37899668.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0C04450
         (309 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0C04450 Chr3 complement(1079139..1080068) [930 bp, 309 aa] {...   640   0.0  
Kpol_480.17 s480 (35641..36582) [942 bp, 313 aa] {ON} (35641..36...   325   e-111
TDEL0D05560 Chr4 complement(1004217..1005152) [936 bp, 311 aa] {...   313   e-106
YPR147C Chr16 complement(825645..826559) [915 bp, 304 aa] {ON} P...   300   e-101
TPHA0D04220 Chr4 complement(912211..913161) [951 bp, 316 aa] {ON...   298   e-100
NCAS0F03530 Chr6 complement(706175..707116) [942 bp, 313 aa] {ON...   297   e-100
Smik_16.400 Chr16 complement(697593..698507) [915 bp, 304 aa] {O...   293   1e-98
Skud_16.442 Chr16 complement(779364..780278) [915 bp, 304 aa] {O...   292   7e-98
Suva_16.476 Chr16 complement(822104..823018) [915 bp, 304 aa] {O...   291   8e-98
ZYRO0D10076g Chr4 (850134..851051) [918 bp, 305 aa] {ON} similar...   284   1e-94
CAGL0L08514g Chr12 (932629..933567) [939 bp, 312 aa] {ON} simila...   278   2e-92
KLTH0F14740g Chr6 complement(1208120..1209028) [909 bp, 302 aa] ...   263   1e-86
NDAI0B05830 Chr2 complement(1415309..1416298) [990 bp, 329 aa] {...   259   1e-84
Kwal_55.21219 s55 complement(734903..735811) [909 bp, 302 aa] {O...   247   2e-80
SAKL0F02860g Chr6 (242683..243600) [918 bp, 305 aa] {ON} similar...   244   5e-79
AFR306C Chr6 complement(996001..996960) [960 bp, 319 aa] {ON} Sy...   228   1e-72
Ecym_1241 Chr1 (494505..495422) [918 bp, 305 aa] {ON} similar to...   218   4e-69
KAFR0E03110 Chr5 (621949..623019) [1071 bp, 356 aa] {ON}               37   0.044
KLLA0F07381g Chr6 (696302..697114) [813 bp, 270 aa] {ON} similar...    34   0.30 
NDAI0C05430 Chr3 (1259106..1260194) [1089 bp, 362 aa] {ON} Anc_8...    34   0.34 
Kpol_1028.87 s1028 (195196..196539) [1344 bp, 447 aa] {ON} (1951...    34   0.42 
NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {O...    34   0.47 
ZYRO0F15950g Chr6 (1309553..1311634) [2082 bp, 693 aa] {ON} simi...    33   0.67 
KAFR0E03120 Chr5 (623464..624504) [1041 bp, 346 aa] {ON} Anc_8.5...    33   0.72 
TDEL0C05870 Chr3 (1057153..1059306) [2154 bp, 717 aa] {ON} Anc_1...    33   1.4  
Smik_10.386 Chr10 complement(602088..604037) [1950 bp, 649 aa] {...    33   1.4  
TDEL0B03250 Chr2 complement(575015..576061) [1047 bp, 348 aa] {O...    32   1.5  
YJR098C Chr10 complement(613186..615156) [1971 bp, 656 aa] {ON} ...    32   1.5  
TDEL0A03980 Chr1 complement(712902..713633) [732 bp, 243 aa] {ON...    32   1.8  
KLTH0H14322g Chr8 (1246601..1248646) [2046 bp, 681 aa] {ON} simi...    32   1.9  
Kwal_14.1435 s14 complement(321870..322376) [507 bp, 168 aa] {OF...    30   3.5  
Smik_2.345 Chr2 complement(618817..619944) [1128 bp, 375 aa] {ON...    31   3.9  
ZYRO0F09064g Chr6 (735162..736211) [1050 bp, 349 aa] {ON} simila...    31   4.6  
NCAS0H00540 Chr8 (93105..95249) [2145 bp, 714 aa] {ON} Anc_1.114...    31   4.7  
SAKL0H10450g Chr8 complement(897598..898776) [1179 bp, 392 aa] {...    30   5.7  
CAGL0G08624g Chr7 complement(811931..813682) [1752 bp, 583 aa] {...    30   6.1  
CAGL0M05467g Chr13 complement(583722..584786) [1065 bp, 354 aa] ...    30   6.8  
TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8....    30   6.9  
Ecym_1376 Chr1 (776759..779020) [2262 bp, 753 aa] {ON} similar t...    30   6.9  
YBR204C Chr2 complement(632254..633381) [1128 bp, 375 aa] {ON}  ...    30   7.4  
TBLA0H03540 Chr8 (863267..864403) [1137 bp, 378 aa] {ON} Anc_8.5...    30   8.8  

>TBLA0C04450 Chr3 complement(1079139..1080068) [930 bp, 309 aa] {ON}
           Anc_3.488 YPR147C
          Length = 309

 Score =  640 bits (1652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/309 (100%), Positives = 309/309 (100%)

Query: 1   MTIQIYPDSRYPTSIVHFPPAKDYKITEDTPLFIWIPGNPGLLEYYTKMLRSLHDKYPTW 60
           MTIQIYPDSRYPTSIVHFPPAKDYKITEDTPLFIWIPGNPGLLEYYTKMLRSLHDKYPTW
Sbjct: 1   MTIQIYPDSRYPTSIVHFPPAKDYKITEDTPLFIWIPGNPGLLEYYTKMLRSLHDKYPTW 60

Query: 61  EILGVSHAGMSNGNQIKNVLSTKVYTLDEQVSHKVEVINNFSSPKRNIIIMGHSVGAYMA 120
           EILGVSHAGMSNGNQIKNVLSTKVYTLDEQVSHKVEVINNFSSPKRNIIIMGHSVGAYMA
Sbjct: 61  EILGVSHAGMSNGNQIKNVLSTKVYTLDEQVSHKVEVINNFSSPKRNIIIMGHSVGAYMA 120

Query: 121 QRVIMDSNLIGNVIKLGLVTPTVVDIHRSVKGIKMTRAFNLFRELPIFLGLLSTLAFSKL 180
           QRVIMDSNLIGNVIKLGLVTPTVVDIHRSVKGIKMTRAFNLFRELPIFLGLLSTLAFSKL
Sbjct: 121 QRVIMDSNLIGNVIKLGLVTPTVVDIHRSVKGIKMTRAFNLFRELPIFLGLLSTLAFSKL 180

Query: 181 FPAIFTRWLLTIIMGCKNNDNHAADASTVFLTNGSFVKQCLGLASHEMKHIRDDWNFQKR 240
           FPAIFTRWLLTIIMGCKNNDNHAADASTVFLTNGSFVKQCLGLASHEMKHIRDDWNFQKR
Sbjct: 181 FPAIFTRWLLTIIMGCKNNDNHAADASTVFLTNGSFVKQCLGLASHEMKHIRDDWNFQKR 240

Query: 241 LIDYCNKENVSTWFLFSSTDHWVSDDTRNELINFYRTNCKSDILDVSVSNIIPHSFVINF 300
           LIDYCNKENVSTWFLFSSTDHWVSDDTRNELINFYRTNCKSDILDVSVSNIIPHSFVINF
Sbjct: 241 LIDYCNKENVSTWFLFSSTDHWVSDDTRNELINFYRTNCKSDILDVSVSNIIPHSFVINF 300

Query: 301 SDFTVNSYF 309
           SDFTVNSYF
Sbjct: 301 SDFTVNSYF 309

>Kpol_480.17 s480 (35641..36582) [942 bp, 313 aa] {ON}
           (35641..36582) [942 nt, 314 aa]
          Length = 313

 Score =  325 bits (834), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 160/312 (51%), Positives = 216/312 (69%), Gaps = 7/312 (2%)

Query: 3   IQIYPDSRYPTSIVHFPPAKDYKITEDTPLFIWIPGNPGLLEYYTKMLRSLHDKYPTWEI 62
           ++++ DS YPTSIVH  P       ED+PLF+WIPGNPGLLEYY   L  +H K PTWE+
Sbjct: 4   VKVFEDSIYPTSIVHLDPLTKELSPEDSPLFVWIPGNPGLLEYYVDFLALVHKKNPTWEV 63

Query: 63  LGVSHAGMS-NGNQIKNVLST----KVYTLDEQVSHKVEVINNFSSPKRNIIIMGHSVGA 117
           LG+SHAGMS +GN+ K   S+    KV+ L+EQV HKV++IN FSS  R +IIMGHSVGA
Sbjct: 64  LGISHAGMSYDGNEKKKKTSSNDKFKVFDLEEQVQHKVDIINKFSSKNRPLIIMGHSVGA 123

Query: 118 YMAQRVIMDSNLIGNVIKLGLVTPTVVDIHRSVKGIKMTRAFNLFRELPIFLGLLSTLAF 177
           Y+ QRVIM + L G +IK+G +TPTVVDIH S KGIKMT+ FN    LP  +G +S   F
Sbjct: 124 YLTQRVIMTNKLNGKLIKVGYLTPTVVDIHLSDKGIKMTKVFNWTSNLPHHVGWISQFIF 183

Query: 178 SKLFPAIFTRWLLTIIMGCKNNDNHAADASTVFLTNGSFVKQCLGLASHEMKHIRDDWNF 237
            KL P  F ++ ++ ++ C + D++A  AS   L N + ++Q LGLA++EM+ I DDW F
Sbjct: 184 HKLLPLFFVKFFISKMIKC-SEDSNAVLASGTLLRNANLIEQALGLATYEMEAIHDDWGF 242

Query: 238 QKRLIDYCNKENVSTWFLFSSTDHWVSDDTRNELINFYRTNCKSDILDVSVSNIIPHSFV 297
            K+LIDYCN+  V TWFLF+  DHWV+  TR E+I+FY+ + K + + + + + IPH+FV
Sbjct: 243 HKKLIDYCNETGVKTWFLFAEDDHWVAHSTRKEVIDFYQYHNKPENIRIDI-DTIPHAFV 301

Query: 298 INFSDFTVNSYF 309
           I  S + V+ YF
Sbjct: 302 IKKSKYIVDQYF 313

>TDEL0D05560 Chr4 complement(1004217..1005152) [936 bp, 311 aa] {ON}
           Anc_3.488 YPR147C
          Length = 311

 Score =  313 bits (801), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 147/311 (47%), Positives = 206/311 (66%), Gaps = 5/311 (1%)

Query: 1   MTIQIYPDSRYPTSIVHFPPAKDYKITEDTPLFIWIPGNPGLLEYYTKMLRSLHDKYPTW 60
           M  + Y    YPTSIVHF  +   +   + PLF+WIPGNPGL+EYY + L  +H ++P W
Sbjct: 1   MAAREYIKCAYPTSIVHFK-SISIRGKSECPLFVWIPGNPGLIEYYEEFLMLIHRQHPEW 59

Query: 61  EILGVSHAGMSNGNQIKNVLSTK--VYTLDEQVSHKVEVINNFSSPKRNIIIMGHSVGAY 118
           E+LG+SHAGMS  +  K+  S +  VY+L +Q+ HK+E+I +FSS  R +IIMGHSVGAY
Sbjct: 60  EVLGISHAGMSTASVSKSEKSERNDVYSLKQQIDHKLEIIKDFSSTNRPLIIMGHSVGAY 119

Query: 119 MAQRVIMDSNLIGNVIKLGLVTPTVVDIHRSVKGIKMTRAFNLFRELPIFLGLLSTLAFS 178
           M Q +++   L+G V K+GL+TPT++DIH S KG+ +T+     ++LP   G  S+L F 
Sbjct: 120 MVQHIVLSDKLVGKVAKMGLLTPTILDIHTSKKGVVLTKVLYWLKDLPQLAGWFSSLLFG 179

Query: 179 KLFPAIFTRWLLTIIMGCKNNDNHAADASTVFLTNGSFVKQCLGLASHEMKHIRDDWNFQ 238
              P+   R LL+  MGC  N +     +TV L NG FVKQ LGL+ +EM+ IR DW FQ
Sbjct: 180 FFLPSFILRILLSFFMGCHRNSS-GVLTTTVLLENGEFVKQALGLSVYEMEEIRSDWAFQ 238

Query: 239 KRLIDYCNKENVSTWFLFSSTDHWVSDDTRNELINFYRTNCKSDILDVSVSNIIPHSFVI 298
           +RLI +CN+  +STW LFS +DHWV+D TR +LI FYR + ++D + +     IPHSFV+
Sbjct: 239 RRLIVHCNERGISTWLLFSDSDHWVADTTREDLIKFYRDHYRADKIKIHTCK-IPHSFVL 297

Query: 299 NFSDFTVNSYF 309
           N S + ++ YF
Sbjct: 298 NHSKYLISEYF 308

>YPR147C Chr16 complement(825645..826559) [915 bp, 304 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and is induced in response to the DNA-damaging agent MMS
          Length = 304

 Score =  300 bits (767), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 145/309 (46%), Positives = 204/309 (66%), Gaps = 5/309 (1%)

Query: 1   MTIQIYPDSRYPTSIVHFPPAKDYKITEDTPLFIWIPGNPGLLEYYTKMLRSLHDKYPTW 60
           MT++ Y  S+ P SI++  P    K  ED PL +WIPGNPGLL YY +ML  LH K+P W
Sbjct: 1   MTVKEYTKSKLPCSILNIKPTVT-KSGEDAPLLVWIPGNPGLLYYYQEMLHHLHLKHPDW 59

Query: 61  EILGVSHAGMSNGNQIKNVLSTKVYTLDEQVSHKVEVINNFSSPKRNIIIMGHSVGAYMA 120
           EILG+SHAGM+    +    +T +++L +QV H+VEVINNFS   R IIIMGHSVGAY+ 
Sbjct: 60  EILGISHAGMT----LNAHSNTPIFSLQDQVDHQVEVINNFSCKNRKIIIMGHSVGAYIV 115

Query: 121 QRVIMDSNLIGNVIKLGLVTPTVVDIHRSVKGIKMTRAFNLFRELPIFLGLLSTLAFSKL 180
           Q+V + + L+G+V K+GLVTPTV+DIH S  GIKMT A      L   + L S + F  +
Sbjct: 116 QKVCLSNKLVGSVQKVGLVTPTVMDIHTSEMGIKMTAALRYIPPLAHVVSLFSYIFFYWI 175

Query: 181 FPAIFTRWLLTIIMGCKNNDNHAADASTVFLTNGSFVKQCLGLASHEMKHIRDDWNFQKR 240
               F+R+++   MGC +    A  ++ +FLT+  FV+Q LGLA+ EM+ I  +W FQ R
Sbjct: 176 LSEGFSRFIIDKFMGCGSTGYQAVLSTRIFLTHRQFVRQSLGLAAQEMEEITTNWEFQDR 235

Query: 241 LIDYCNKENVSTWFLFSSTDHWVSDDTRNELINFYRTNCKSDILDVSVSNIIPHSFVINF 300
            I+YC +  +S WFLFSS DHWVS  TR+ L ++Y+   K + L + V++ IPHSFV+  
Sbjct: 236 FINYCEENGISIWFLFSSNDHWVSGKTRSHLSDYYKDKVKQERLKIDVTDKIPHSFVVKH 295

Query: 301 SDFTVNSYF 309
           +++ +N++F
Sbjct: 296 AEYAINAFF 304

>TPHA0D04220 Chr4 complement(912211..913161) [951 bp, 316 aa] {ON}
           Anc_3.488 YPR147C
          Length = 316

 Score =  298 bits (764), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 146/317 (46%), Positives = 205/317 (64%), Gaps = 9/317 (2%)

Query: 1   MTIQIYPDSRYPTSIVHFPP-------AKDYKITED-TPLFIWIPGNPGLLEYYTKMLRS 52
           MTI ++ DS++PTSI+           + D   T+  +PLF+WIPGNPGLLEYY + L+ 
Sbjct: 1   MTITVFKDSKFPTSILSIKGTYVADELSVDLTKTDKLSPLFVWIPGNPGLLEYYEEFLKL 60

Query: 53  LHDKYPTWEILGVSHAGMSNGNQIKNVLSTKVYTLDEQVSHKVEVINNFSSPKRNIIIMG 112
           LH K P W+ILG+SHAGMS+GN         VYTLDEQ+ HK+E+IN F++  R +I+MG
Sbjct: 61  LHVKNPEWDILGISHAGMSSGNSNLKENECSVYTLDEQIHHKIEIINKFAAYGRELIVMG 120

Query: 113 HSVGAYMAQRVIMDSNLIGNVIKLGLVTPTVVDIHRSVKGIKMTRAFNLFRELPIFLGLL 172
           HSVGA+MAQ+V+M + L G V K+GL+ PTV+DIH S KG +++   N    LP   G +
Sbjct: 121 HSVGAFMAQKVVMSNKLEGKVKKIGLLMPTVIDIHLSEKGTQISTILNWIPNLPQLAGWV 180

Query: 173 STLAFSKLFPAIFTRWLLTIIMGCKNNDNHAADASTVFLTNGSFVKQCLGLASHEMKHIR 232
           S   F    P    +++++  M   NN+N AA A+  FL + +FV+Q LGLA +EM+ IR
Sbjct: 181 SEKIFGGFLPITLVKFIISFFMEL-NNENKAAHATYTFLKDSNFVEQSLGLAKYEMQIIR 239

Query: 233 DDWNFQKRLIDYCNKENVSTWFLFSSTDHWVSDDTRNELINFYRTNCKSDILDVSVSNII 292
            DW FQ+ L+  CN   +  W LF+ +DHWVS+ TR+ELI  YR +  SD    S+++ +
Sbjct: 240 HDWEFQRELVKMCNVNQIELWTLFAESDHWVSNQTRSELIELYRNSVNSDYYSYSITDQV 299

Query: 293 PHSFVINFSDFTVNSYF 309
           PH+FVI  S   V++YF
Sbjct: 300 PHAFVIKNSCHVVDNYF 316

>NCAS0F03530 Chr6 complement(706175..707116) [942 bp, 313 aa] {ON}
           Anc_3.488 YPR147C
          Length = 313

 Score =  297 bits (760), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 149/320 (46%), Positives = 206/320 (64%), Gaps = 18/320 (5%)

Query: 1   MTIQIYPDSRYPTSIVHFPPAKDYKITEDTPLFIWIPGNPGLLEYYTKMLRSLHDKYPTW 60
           M+++ Y D  +PT +VH  P K  +I    P+F+WIPGNPG+LEYY +ML +LH+K+PTW
Sbjct: 1   MSVEAYDDDEFPTCVVHILPIKTAEIN---PVFVWIPGNPGILEYYQEMLINLHEKHPTW 57

Query: 61  EILGVSHAGMS-------NGNQIKNVLSTKVYTLDEQVSHKVEVINNFSSPKR-NIIIMG 112
           EIL +SH GM+        G+   N   ++V+TL EQ+ HK+++INNF       I I G
Sbjct: 58  EILAISHIGMNTKTTSLFKGSHQDN---SRVFTLKEQIQHKIKIINNFVKDSNVPIYISG 114

Query: 113 HSVGAYMAQRVIMDSNLIGNVIKLGLVTPTVVDIHRSVKGIKMTR-AFNLFRELPIFLGL 171
           HSVGAYM Q+++    LIG V+K+GL+TPT++DIH S KG  MTR A    R+LP  L  
Sbjct: 115 HSVGAYMVQKIVASDELIGQVLKMGLITPTIIDIHLSEKGKSMTRYARWSCRQLPHILSF 174

Query: 172 LSTLAFSKLFPAIFTRWLLTIIMGCKNNDNHAADASTVFLTNGSFVKQCLGLASHEMKHI 231
           L  + F  L P I   +++  +MGC ++D+ AA ++ +FLT  +FV+Q LGLA  EM  I
Sbjct: 175 LCYIVFGWLVPGILRSYIIGYVMGC-HHDSQAAISTELFLTGPNFVRQSLGLAQEEMDTI 233

Query: 232 RDDWNFQKRLIDYCNKENVSTWFLFSSTDHWVSDDTRNELINFYRTNCKS--DILDVSVS 289
            DDW FQ  LI+YC K ++   FLFS+TDHWV + TR E+I FY+  CK    +L + VS
Sbjct: 234 HDDWQFQAELIEYCLKNSIKIQFLFSATDHWVREATRKEIIQFYQERCKGAKALLKIDVS 293

Query: 290 NIIPHSFVINFSDFTVNSYF 309
           +  PHSFV+  S + V  YF
Sbjct: 294 DQFPHSFVVRRSKYVVEHYF 313

>Smik_16.400 Chr16 complement(697593..698507) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  293 bits (751), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 143/309 (46%), Positives = 201/309 (65%), Gaps = 5/309 (1%)

Query: 1   MTIQIYPDSRYPTSIVHFPPAKDYKITEDTPLFIWIPGNPGLLEYYTKMLRSLHDKYPTW 60
           M IQ Y  S++P SI++  P    +  ED  L +WIPGNPGLL YY +ML+ LH K+P W
Sbjct: 1   MPIQEYTKSKFPCSILNIKPTIT-RSDEDAALLVWIPGNPGLLYYYQEMLQYLHSKHPDW 59

Query: 61  EILGVSHAGMSNGNQIKNVLSTKVYTLDEQVSHKVEVINNFSSPKRNIIIMGHSVGAYMA 120
           EILG+SHAGM+    +    +T VY+L +QV H+VEVINNFS   R IIIMGHSVGAY+ 
Sbjct: 60  EILGISHAGMT----LNAHSNTPVYSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYIL 115

Query: 121 QRVIMDSNLIGNVIKLGLVTPTVVDIHRSVKGIKMTRAFNLFRELPIFLGLLSTLAFSKL 180
           Q+V +  NL+G V K+GLVTPTV+DIH S  G+K+T A +    L   + L S + F  +
Sbjct: 116 QKVCLSHNLVGTVQKVGLVTPTVMDIHTSEMGVKLTTALHYIPPLAHVVSLFSYIFFYWI 175

Query: 181 FPAIFTRWLLTIIMGCKNNDNHAADASTVFLTNGSFVKQCLGLASHEMKHIRDDWNFQKR 240
               F+R+++   MGC +    A  ++ +FLT+  FV+Q LGLAS EM+ I  +W FQ +
Sbjct: 176 LSEGFSRFIIDKFMGCGSTSCQAVLSTRIFLTHKQFVRQSLGLASQEMEEITTNWEFQDK 235

Query: 241 LIDYCNKENVSTWFLFSSTDHWVSDDTRNELINFYRTNCKSDILDVSVSNIIPHSFVINF 300
            I+YC +     WFLFSS DHWVS  TR+ L ++Y+     + L++ V++ IPHSFV+  
Sbjct: 236 FINYCEQNGTLIWFLFSSNDHWVSGKTRSHLSHYYKDKVDQNRLEIDVTDKIPHSFVVKH 295

Query: 301 SDFTVNSYF 309
           + + +N++F
Sbjct: 296 AKYAINTFF 304

>Skud_16.442 Chr16 complement(779364..780278) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  292 bits (747), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 142/310 (45%), Positives = 201/310 (64%), Gaps = 7/310 (2%)

Query: 1   MTIQIYPDSRYPTSIVHFPPAKDYKITEDTPLFIWIPGNPGLLEYYTKMLRSLHDKYPTW 60
           M +Q Y  S  P SI++  P+   +  ED PL +WIPGNPGLL YY +ML+ LH K+P W
Sbjct: 1   MPVQEYTKSTLPCSILNIKPSVATE-NEDAPLLVWIPGNPGLLYYYQEMLQHLHSKHPDW 59

Query: 61  EILGVSHAGMS-NGNQIKNVLSTKVYTLDEQVSHKVEVINNFSSPKRNIIIMGHSVGAYM 119
           EILGVSHAGM+ N +      +T +++L +QV H+VEVINNFS   R IIIMGHSVGAY+
Sbjct: 60  EILGVSHAGMTLNAHS-----NTPIFSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYI 114

Query: 120 AQRVIMDSNLIGNVIKLGLVTPTVVDIHRSVKGIKMTRAFNLFRELPIFLGLLSTLAFSK 179
            Q+V +   L+G+V K+GL+TPTV+DIH S  G+KMT   +    L   + LLS + F  
Sbjct: 115 LQKVCLSDKLVGSVRKIGLITPTVMDIHTSEMGVKMTAVLHYIPPLAHVVSLLSYVFFYW 174

Query: 180 LFPAIFTRWLLTIIMGCKNNDNHAADASTVFLTNGSFVKQCLGLASHEMKHIRDDWNFQK 239
           +     +R+++   MGC +    A  ++ + LT+  FV+Q LGLAS EMK I  +W FQ 
Sbjct: 175 ILSEGLSRFVIDKFMGCGSTGYQAVLSTRILLTHKQFVRQSLGLASQEMKEITTNWEFQD 234

Query: 240 RLIDYCNKENVSTWFLFSSTDHWVSDDTRNELINFYRTNCKSDILDVSVSNIIPHSFVIN 299
             I+YC +  +  WFLFS+ DHWV+D TR  L ++Y+   K + L + V++ IPHSFV+ 
Sbjct: 235 EFINYCQENEIFIWFLFSTKDHWVADKTRTHLSHYYKDKIKQERLKIDVTDKIPHSFVVK 294

Query: 300 FSDFTVNSYF 309
            +++ VN++F
Sbjct: 295 HAEYAVNTFF 304

>Suva_16.476 Chr16 complement(822104..823018) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  291 bits (746), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 138/309 (44%), Positives = 204/309 (66%), Gaps = 5/309 (1%)

Query: 1   MTIQIYPDSRYPTSIVHFPPAKDYKITEDTPLFIWIPGNPGLLEYYTKMLRSLHDKYPTW 60
           M+IQ Y  S+ P SI++  P       ED PL +WIPGNPGLL YY +M+  LH K+P W
Sbjct: 1   MSIQEYTKSKLPCSILNIKPTVTTD-NEDAPLLVWIPGNPGLLHYYQEMIHHLHLKHPDW 59

Query: 61  EILGVSHAGMSNGNQIKNVLSTKVYTLDEQVSHKVEVINNFSSPKRNIIIMGHSVGAYMA 120
           EILG+SHAGMS+  +     +T +++L +QV H+V+VINNFS   R IIIMGHSVGAY+ 
Sbjct: 60  EILGISHAGMSSNARS----NTPIFSLQDQVDHQVKVINNFSHDNRKIIIMGHSVGAYIV 115

Query: 121 QRVIMDSNLIGNVIKLGLVTPTVVDIHRSVKGIKMTRAFNLFRELPIFLGLLSTLAFSKL 180
           Q+V + + L+G+V K+GL+TPTV+DIH S  G+KMT AF+    L   L  +S + F  +
Sbjct: 116 QKVCLSNELVGSVTKVGLITPTVMDIHASEMGVKMTTAFHYVPALAHVLSFISYVFFYWV 175

Query: 181 FPAIFTRWLLTIIMGCKNNDNHAADASTVFLTNGSFVKQCLGLASHEMKHIRDDWNFQKR 240
                ++ ++   MGC      A  ++ +FLT+  FV+Q LGLAS E+K I  +W FQ +
Sbjct: 176 LSEGLSKLIIDKFMGCGTAGRRAVLSTRLFLTHRQFVRQSLGLASQELKEITTNWEFQDK 235

Query: 241 LIDYCNKENVSTWFLFSSTDHWVSDDTRNELINFYRTNCKSDILDVSVSNIIPHSFVINF 300
            I++C ++ + TWFLFS+ DHWV+D+TR  L ++Y    K + L + V++ +PHSFV+  
Sbjct: 236 FINHCEEKGIFTWFLFSTKDHWVNDETRKHLSHYYHDKVKQEHLRIDVTDKMPHSFVVKH 295

Query: 301 SDFTVNSYF 309
           +++ +N++F
Sbjct: 296 AEYAINAFF 304

>ZYRO0D10076g Chr4 (850134..851051) [918 bp, 305 aa] {ON} similar to
           uniprot|Q06522 Saccharomyces cerevisiae YPR147C
           Hypothetical ORF
          Length = 305

 Score =  284 bits (726), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 139/309 (44%), Positives = 203/309 (65%), Gaps = 4/309 (1%)

Query: 1   MTIQIYPDSRYPTSIVHFPPAKDYKITEDTPLFIWIPGNPGLLEYYTKMLRSLHDKYPTW 60
           M+I+    +R PTS++H    K    +  +PLF+WIPGNPG+++YY + L  LH+KY ++
Sbjct: 1   MSIRYLAGARLPTSVLHI---KPKSPSPSSPLFVWIPGNPGIVQYYEEFLNLLHEKYDSF 57

Query: 61  EILGVSHAGMSNGNQIKNVLSTKVYTLDEQVSHKVEVINNFSSPKRNIIIMGHSVGAYMA 120
           EIL +SHAGM+  +         +YTLD+Q+ HKVE+IN FS+  R +I+MGHSVGAYMA
Sbjct: 58  EILAISHAGMATEDPDLQKRKATIYTLDDQIQHKVEIINQFSAKDRPLIVMGHSVGAYMA 117

Query: 121 QRVIMDSNLIGNVIKLGLVTPTVVDIHRSVKGIKMTRAFNLFRELPIFLGLLSTLAFSKL 180
           Q V++   L+G V+KLGL+TPTVVDIHRS KG ++TRAF   + LP     +S + F+KL
Sbjct: 118 QHVVLAEKLLGRVVKLGLITPTVVDIHRSQKGTQLTRAFYWVKYLPDIAAWVSDMLFNKL 177

Query: 181 FPAIFTRWLLTIIMGCKNNDNHAADASTVFLTNGSFVKQCLGLASHEMKHIRDDWNFQKR 240
              +FT  ++++ MG  + ++     S   + N   ++Q LGLA+ EM+ IR  W FQK+
Sbjct: 178 SSIMFTDQVISLFMGV-DKESVPVATSKSLVQNPEIIRQALGLAALEMQQIRGCWPFQKK 236

Query: 241 LIDYCNKENVSTWFLFSSTDHWVSDDTRNELINFYRTNCKSDILDVSVSNIIPHSFVINF 300
           LID+CN   + T F+FS+ D WVS+ TR  L+ FYR N +   L++SVS  + HSF++  
Sbjct: 237 LIDHCNSNEIETKFVFSANDPWVSNATREALMVFYRENYRDRNLEISVSQDLAHSFIVKH 296

Query: 301 SDFTVNSYF 309
           S + V+ YF
Sbjct: 297 SKYIVDEYF 305

>CAGL0L08514g Chr12 (932629..933567) [939 bp, 312 aa] {ON} similar
           to uniprot|Q06522 Saccharomyces cerevisiae YPR147c
          Length = 312

 Score =  278 bits (711), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 140/313 (44%), Positives = 190/313 (60%), Gaps = 5/313 (1%)

Query: 1   MTIQIYPDSRYPTSIVHFPPAKDYKITEDTPLFIWIPGNPGLLEYYTKMLRSLHDKYPTW 60
           M++Q Y DS  PT I+H  P       E +PLF+WIPGNPGLLEYY + L  +HDK PTW
Sbjct: 1   MSVQGYHDSALPTCIIHIKPTVTNN-DESSPLFVWIPGNPGLLEYYQEFLAKVHDKNPTW 59

Query: 61  EILGVSHAG-MSNGNQIKNVLSTK--VYTLDEQVSHKVEVINNFSS-PKRNIIIMGHSVG 116
           EILG+SHAG +   +Q+K        +Y L +Q  HK+++IN  ++ P R ++IMGHSVG
Sbjct: 60  EILGISHAGTVIESSQLKKFRKNPLPIYDLKQQTQHKIDIINKINNDPNRELVIMGHSVG 119

Query: 117 AYMAQRVIMDSNLIGNVIKLGLVTPTVVDIHRSVKGIKMTRAFNLFRELPIFLGLLSTLA 176
           AY+AQ V+   +L+G V KLGL+TPT+ DIH+S  G+  TR FN    +  +L  +S+  
Sbjct: 120 AYIAQHVVSSPDLVGRVSKLGLITPTIRDIHKSSHGLIFTRVFNYISNVNEYLSFISSNI 179

Query: 177 FSKLFPAIFTRWLLTIIMGCKNNDNHAADASTVFLTNGSFVKQCLGLASHEMKHIRDDWN 236
           F+KL PA +T+ L++  MGC  ++ H    + + LT    ++Q LGLA+HEM  IRDDW 
Sbjct: 180 FNKLIPAYWTKLLISFAMGCSFDEYHIILGTFLLLTQRETLRQVLGLAAHEMLEIRDDWA 239

Query: 237 FQKRLIDYCNKENVSTWFLFSSTDHWVSDDTRNELINFYRTNCKSDILDVSVSNIIPHSF 296
           FQ+ L+  C       W LFS  DHWVS  T+ ELI F +      +L V V   I HSF
Sbjct: 240 FQENLLTKCKDNGTKLWLLFSDNDHWVSQHTQAELIKFLKDRYPELLLRVDVDKDIKHSF 299

Query: 297 VINFSDFTVNSYF 309
           V+   D     YF
Sbjct: 300 VVKDVDLVTRRYF 312

>KLTH0F14740g Chr6 complement(1208120..1209028) [909 bp, 302 aa]
           {ON} similar to uniprot|Q06522 Saccharomyces cerevisiae
           YPR147C Hypothetical ORF
          Length = 302

 Score =  263 bits (673), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 129/298 (43%), Positives = 183/298 (61%), Gaps = 7/298 (2%)

Query: 12  PTSIVHFPPAKDYKITEDTPLFIWIPGNPGLLEYYTKMLRSLHDKYPTWEILGVSHAGMS 71
           P+SI+H        +  D  LF++IPGNPGL+EYY   L+ +H+K P WEILG+SHAGM+
Sbjct: 12  PSSILHLKSGVS-SLGSDACLFVFIPGNPGLIEYYVPFLQQVHEKNPDWEILGISHAGMN 70

Query: 72  NGNQIKNVLSTKVYTLDEQVSHKVEVINNFSSPKRNIIIMGHSVGAYMAQRVIMDSNLIG 131
           + N I    +  VYTL EQ++HKV+VIN+++   + I IMGHSVGA++AQ+V+    L  
Sbjct: 71  SCNDI----ACPVYTLQEQINHKVDVINSYAQGNKKITIMGHSVGAFIAQKVVTSGLLND 126

Query: 132 NVIKLGLVTPTVVDIHRSVKGIKMTRAFNLFRELPIFLGLLSTLAFSKLFPAIFTRWLLT 191
            V ++GL+TPTV+DIH+S KG+K+T     F      +  L  +AF KLFP   T W+++
Sbjct: 127 EVARVGLLTPTVIDIHKSEKGLKLTAITERFPRFHQLVSALDWIAFEKLFPDFLTSWIIS 186

Query: 192 IIMGCKNNDNHAADASTVFLTNGSFVKQCLGLASHEMKHIRDDWNFQKRLIDYCNKENVS 251
                 +       A+ + LTN  FVKQ LGLA+ EM+ IR DW +QK  + YC  +   
Sbjct: 187 HF--ADDPKTCLGAATRLLLTNSRFVKQALGLATEEMQVIRSDWEYQKDFLHYCETKGAK 244

Query: 252 TWFLFSSTDHWVSDDTRNELINFYRTNCKSDILDVSVSNIIPHSFVINFSDFTVNSYF 309
            W+LFS  DHWVS +TR +LI FY  +   +++ + VS  I H+FV   +   V  YF
Sbjct: 245 IWWLFSDNDHWVSSETRKDLIQFYERHSSPELVSIDVSTAIEHAFVRRHAQVVVQHYF 302

>NDAI0B05830 Chr2 complement(1415309..1416298) [990 bp, 329 aa] {ON}
           Anc_3.488 YPR147C
          Length = 329

 Score =  259 bits (662), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 145/334 (43%), Positives = 199/334 (59%), Gaps = 30/334 (8%)

Query: 1   MTIQIYPDSRYPTSIVHFPPAKDYKITED---TPLFIWIPGNPGLLEYYTKMLRSLHDKY 57
           M ++ Y +S+YPTSI+H    K   I  D    PLFIWIPGNPG+L+YY + L SLH K+
Sbjct: 1   MLVKSYSESKYPTSIIHIEAEK--LIENDPSLNPLFIWIPGNPGILQYYQQFLCSLHKKH 58

Query: 58  PTWEILGVSHAGMSNGNQIKNVLSTKVYTLDEQVSHKVEVINNFSS---------PKRNI 108
           P WEIL + HAGM     +    + ++Y L+EQ+ HK+EVI  F +          KR +
Sbjct: 59  PHWEILAIPHAGMDTSLPVYRHPNDRIYHLNEQIEHKIEVITTFLTKANSSDGIMKKRPL 118

Query: 109 IIMGHSVGAYMAQRVIMDSNLIGNVI-------KLGLVTPTVVDIHRSVKGIKMTRAFNL 161
           +IMGHSVG YM QR+++       ++       K+G +TPT++DI+ S KGI ++    L
Sbjct: 119 VIMGHSVGTYMIQRMVLTKEFQDTILHNSFYLKKIGFITPTIIDINLSSKGILISHGLQL 178

Query: 162 FRE-LPIFLGLLSTLAFS---KLFPAIFTRWLLTIIMGCKNNDNHAADASTVFLTNGSFV 217
               LP  L  LS   FS   K F  I  R L+  IMGC+  D  AA  + + LTN   V
Sbjct: 179 THGYLPYILSYLSYFVFSLILKYFDNI-RRRLIAYIMGCQMTD-FAAIGTEILLTNSVLV 236

Query: 218 KQCLGLASHEMKHIRDDWNFQKRLIDYCNKENVSTWFLFSSTDHWVSDDTRNELINFYRT 277
           KQ LGLAS EM+ IR +W+ QK+ ++ CN  ++  W LF  TDHWV++ TR +LI FY++
Sbjct: 237 KQSLGLASIEMQEIRKNWDVQKQFVENCNHNDIQLWLLFCETDHWVNNVTRTDLIKFYQS 296

Query: 278 NCKSDI--LDVSVSNIIPHSFVINFSDFTVNSYF 309
           N K DI  L + VS+  PHSFV+N SD+ V  +F
Sbjct: 297 NYK-DISRLQIEVSSEFPHSFVVNHSDWVVERFF 329

>Kwal_55.21219 s55 complement(734903..735811) [909 bp, 302 aa] {ON}
           YPR147C - Hypothetical ORF [contig 131] FULL
          Length = 302

 Score =  247 bits (631), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 121/285 (42%), Positives = 184/285 (64%), Gaps = 14/285 (4%)

Query: 29  DTPLFIWIPGNPGLLEYYTKMLRSLHDKYPTWEILGVSHAGMSNGNQIKNVLSTKVYTLD 88
           + PLF++IPGNPGL+E+Y   L  +H+K P WEILG+SHAGM++ ++      + VY+L+
Sbjct: 28  EAPLFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGMNSCSE----EVSPVYSLE 83

Query: 89  EQVSHKVEVINNFSSPKRNIIIMGHSVGAYMAQRVIMDSNLIGNVIKLGLVTPTVVDIHR 148
           +Q+ HK+E+IN +    + IIIMGHSVGA+M Q++     L   VI++GL+TPTV+DIH+
Sbjct: 84  QQIDHKIEIINRYCLDGKPIIIMGHSVGAFMVQKITTSRRLKSKVIRVGLLTPTVIDIHK 143

Query: 149 SVKGIKMTRAFNLFRELPIFLGLLSTL---AFSKLFPAIFTRWLLTIIMGCKNNDNHAAD 205
           S KG+K+T   ++ R  P F  ++STL    F KL P   T+ ++++++   ++      
Sbjct: 144 SEKGVKLT---SITRWCPSFHNVVSTLNWALFEKLLPTKITKSIISLLV---DDPQSCLG 197

Query: 206 ASTVFL-TNGSFVKQCLGLASHEMKHIRDDWNFQKRLIDYCNKENVSTWFLFSSTDHWVS 264
           A+T  L TN  FVKQ LGLA+ E++ IR DW +QK  +  C + +   W+LFS  DHWVS
Sbjct: 198 ATTELLVTNSRFVKQALGLAAEEVRVIRSDWAYQKEFLLLCQENDTKIWWLFSEKDHWVS 257

Query: 265 DDTRNELINFYRTNCKSDILDVSVSNIIPHSFVINFSDFTVNSYF 309
             TRN++I+FYR +    +  + VS+ I H+FV   +D  +  YF
Sbjct: 258 PTTRNDIIDFYRQHSSPALSQIDVSSTIEHAFVRRHADLVIKQYF 302

>SAKL0F02860g Chr6 (242683..243600) [918 bp, 305 aa] {ON} similar to
           uniprot|Q06522 Saccharomyces cerevisiae YPR147C
           Hypothetical ORF
          Length = 305

 Score =  244 bits (622), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 126/309 (40%), Positives = 184/309 (59%), Gaps = 6/309 (1%)

Query: 1   MTIQIYPDSRYPTSIVHFPPAKDYKITEDTPLFIWIPGNPGLLEYYTKMLRSLHDKYPTW 60
           M IQ Y  + + +S+ H  P  + ++   TPLF++IPGNPGL+E+Y   L  +  K+  W
Sbjct: 1   MHIQPYSKNGFFSSLYHLKPL-NQEVNSQTPLFVFIPGNPGLIEFYKSFLDQIQKKHGNW 59

Query: 61  EILGVSHAGM-SNGNQIKNVLSTKVYTLDEQVSHKVEVINNFSSPKRNIIIMGHSVGAYM 119
           EILG+SHAGM +    +K    TKVY+L +QV HK+ VIN+F S  R +II GHS+GAY+
Sbjct: 60  EILGISHAGMITKCKGLKK--PTKVYSLKDQVQHKIYVINDFCSSNRPLIIAGHSIGAYI 117

Query: 120 AQRVIMDSNLIGNVIKLGLVTPTVVDIHRSVKGIKMTRAFNLFRELPIFLGLLSTLAFSK 179
            Q++ +D +L+G V K+ L+TPTV+DIH S KG K+            ++   S L F K
Sbjct: 118 VQKIALDVSLMGTVKKIMLLTPTVIDIHLSEKGRKLNWINEWCPNFHSYVATASWLVFEK 177

Query: 180 LFPAIFTRWLLTIIMGCKNNDNHAADASTVFLTNGSFVKQCLGLASHEMKHIRDDWNFQK 239
           + P   T  +L++ +G  +      +A+ + +TN  FV+Q LGLA  EM+ +RDDWNFQ 
Sbjct: 178 MLPQTITEKILSLFVG--SEQTCVREAAKLLVTNYEFVQQSLGLAREEMQKVRDDWNFQL 235

Query: 240 RLIDYCNKENVSTWFLFSSTDHWVSDDTRNELINFYRTNCKSDILDVSVSNIIPHSFVIN 299
             + +C  + V   FLF+  DHWV+  TR +L  FY +N   D L +     I HSFV+N
Sbjct: 236 SFLQFCKSQEVELQFLFAFKDHWVNSQTRFDLAEFYNSNYYKDFLTIDEDEKISHSFVLN 295

Query: 300 FSDFTVNSY 308
            +   V+ Y
Sbjct: 296 DTKSVVDRY 304

>AFR306C Chr6 complement(996001..996960) [960 bp, 319 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR147C
          Length = 319

 Score =  228 bits (581), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 115/284 (40%), Positives = 174/284 (61%), Gaps = 11/284 (3%)

Query: 32  LFIWIPGNPGLLEYYTKMLRSLHDKYPTWEILGVSHAGMSNGNQIKNVLSTKVYTLDEQV 91
           + I++PGNPGL+ +Y + LRS+H+K PTWEI+G+SH GMS     +++   +VYTL EQV
Sbjct: 41  ILIFLPGNPGLINFYREFLRSIHEKNPTWEIVGISHTGMSAKTGPEDL--KRVYTLVEQV 98

Query: 92  SHKVEVINNFSSPKRNIII--MGHSVGAYMAQRVIMDSNLIGNVIKLGLVTPTVVDIHRS 149
            HKV+ IN+F   + N+ +  +GHS+GAYMAQ+V++   L  NV  +GL+TPT++DIHRS
Sbjct: 99  EHKVKAINDFVENRGNLAVKLVGHSIGAYMAQKVVVHPALRVNVEMVGLLTPTIIDIHRS 158

Query: 150 VKGIKMTRAFNLFRELPIFLGLLSTLAFSKLFPAIFTRWLLTIIMGCKNNDNHAADASTV 209
            KG+++TR    F     ++ ++  +    L PA +  WL   I+G   +D     ++  
Sbjct: 159 PKGVQLTRISEWFPRFYEYVSIVDRVLLEWLLPATWISWLARKIIG--GSDECVLQSAEK 216

Query: 210 FLTNGSFVKQCLGLASHEMKHIRDDWNFQKRLIDYCNKENVSTWFLFSSTDHWVSDDTRN 269
            + N S+V+Q LG+A  EM  +R+ W+FQ+  I  C +   S W LFS  DHWV  DT  
Sbjct: 217 LVKNPSYVRQALGMAQLEMHQVRNQWDFQEEFIKTCQERRSSLWLLFSGHDHWVHSDTMK 276

Query: 270 ELINFYR----TNCKSDILDVSVSNIIPHSFVINFSDFTVNSYF 309
           +++ FY     TN  S +L +++   I HSFV+  +   VN YF
Sbjct: 277 DIVEFYEAKYGTNADS-LLRITIDEHISHSFVVKDTTKVVNIYF 319

>Ecym_1241 Chr1 (494505..495422) [918 bp, 305 aa] {ON} similar to
           Ashbya gossypii AFR306C
          Length = 305

 Score =  218 bits (556), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 108/288 (37%), Positives = 171/288 (59%), Gaps = 8/288 (2%)

Query: 27  TEDTPLFIWIPGNPGLLEYYTKMLRSLHDKYPTWEILGVSHAGMSNGNQIKNVLSTKVYT 86
           T   PL ++IPGNPGL+ +Y + L+ +H++ PTWE++G+ H GMS+  +  N LS +V+T
Sbjct: 21  TPPGPLLLFIPGNPGLINFYEEFLKCIHERNPTWEVVGIGHTGMSSLRE-NNSLSGRVHT 79

Query: 87  LDEQVSHKVEVINNF--SSPKRNIIIMGHSVGAYMAQRVIMDSNLIGNVIKLGLVTPTVV 144
           LDEQ+  KV+VIN F  +   R I ++GHS+GAYM Q++ +   L G +  + L+TPT++
Sbjct: 80  LDEQIEDKVKVINEFVDAGGDRCIKLIGHSIGAYMVQKIALHKGLRGKIDMVMLLTPTII 139

Query: 145 DIHRSVKGIKMTRAFNLFRELPIFLGLLSTLAFSKLFPAIFTRWLLTIIMGCKNNDNHAA 204
           DIHRS KG+++TR  + F +   +  ++  + F  + P  +  W+   ++G   +D    
Sbjct: 140 DIHRSSKGVQLTRISDWFPKFYEYAYVVDRVLFKWILPTSWIEWIARKLIG--GSDECVL 197

Query: 205 DASTVFLTNGSFVKQCLGLASHEMKHIRDDWNFQKRLIDYCNKENVSTWFLFSSTDHWVS 264
            ++   ++   FVKQ LGLA  EM  +R+ W+FQ   I +C    +   FLFS  DHWV 
Sbjct: 198 QSAQKLVSTPEFVKQALGLAQIEMYQVRNQWDFQDEFISFCQANKIKVRFLFSGHDHWVH 257

Query: 265 DDTRNELINFYRTNCKS---DILDVSVSNIIPHSFVINFSDFTVNSYF 309
            DT  ++I  Y     S   D+L++++   I HSFV+  +   VN YF
Sbjct: 258 PDTMKDIIELYEAKYSSDEKDLLNITIDGHINHSFVVKDTTKVVNIYF 305

>KAFR0E03110 Chr5 (621949..623019) [1071 bp, 356 aa] {ON} 
          Length = 356

 Score = 37.0 bits (84), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 56/127 (44%), Gaps = 6/127 (4%)

Query: 25  KITEDTPLFIWIPGNPGLLEYYTKMLRSLHDKYPTWEILGVSHAGMSNGNQIKNVLSTKV 84
           +I  D+ LF+ IPG  G LE +  ++R +      +  L +   G        N   T +
Sbjct: 76  RIDSDS-LFLCIPGLGGNLEQFEPLVRLIDASNKNF--LAIDLPGFGKSEDYSNYSMTHI 132

Query: 85  YTLDEQVSHKVEVINNFSSPKRNIIIMGHSVGAYMAQRVIMDSNLIGNVIKLGLVTPTVV 144
            TL +Q+   +E +   +     I +MGHS+G ++A       N    V KL LV+P   
Sbjct: 133 ATLIDQM---LETVIGTAPDNYKINVMGHSMGTHLALHFYELFNKKYTVEKLILVSPPKP 189

Query: 145 DIHRSVK 151
            I +  K
Sbjct: 190 QIDQLAK 196

>KLLA0F07381g Chr6 (696302..697114) [813 bp, 270 aa] {ON} similar to
           uniprot|Q07505 Saccharomyces cerevisiae YDL086W
           Hypothetical ORF
          Length = 270

 Score = 34.3 bits (77), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 28/128 (21%), Positives = 56/128 (43%), Gaps = 9/128 (7%)

Query: 2   TIQIYPDSRYPTSIVHFPPAKDYKITEDTPLFIWIPGNPGLLEYYTKMLRSLHDKYPTWE 61
           T++ YP++++P  +V    ++ Y++T     F       G    Y  +L S +  +    
Sbjct: 26  TVKGYPNAKFPAVLVF---SEIYQVTGPVLRFAQTIAAEG----YIAILPSSYHNFVDST 78

Query: 62  ILGVSHAGMSNGNQIKNVLSTKVYTLDEQVSHKVEVINNFSSPKRNIIIMGHSVGAYMAQ 121
            L     G   GN+ K  +   + + DE V+  ++V+ N       +   G  +G ++A 
Sbjct: 79  PLAYDTEGTDLGNKFK--IEKPLESYDEDVTLCLDVLENLPQWNGRVGATGMCLGGHLAF 136

Query: 122 RVIMDSNL 129
           R  +DS +
Sbjct: 137 RAQLDSRI 144

>NDAI0C05430 Chr3 (1259106..1260194) [1089 bp, 362 aa] {ON}
           Anc_8.524 YBR204C
          Length = 362

 Score = 34.3 bits (77), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 26/116 (22%), Positives = 54/116 (46%), Gaps = 12/116 (10%)

Query: 29  DTPLFIWIPGNPGLLEYYTKMLRSL---HDKYPTWEILGVSHAGMSNGNQIKNVLSTKVY 85
           + PL+++I G  G+LE +  +LR L    +K+   ++ G   +       + +V+S    
Sbjct: 88  NEPLYLFIHGLGGVLEQFEPLLRLLDLNENKFLALDLPGFGKSDEYEDYNMFDVISIIHT 147

Query: 86  TLDEQVSHKVEVINNFSSPKRNIIIMGHSVGAYMAQRVIMDSNLIGNVIKLGLVTP 141
            +D  +  +            NI+++GHS+G Y++  +   S    +  KL  ++P
Sbjct: 148 IVDRLIPERT---------TSNIVLVGHSMGCYISLHLFYKSYTRFSFKKLVFLSP 194

>Kpol_1028.87 s1028 (195196..196539) [1344 bp, 447 aa] {ON}
           (195196..196539) [1344 nt, 448 aa]
          Length = 447

 Score = 34.3 bits (77), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 86  TLDEQVSHKVEVINNFSSPKRNIIIMGHSVGAYMAQRVIMDSNLIG 131
           TL  Q  HKV+ I   + P  NI+++GHS+GA MA    ++  L G
Sbjct: 273 TLGRQFLHKVDSIFE-TYPTYNIVVVGHSLGAAMASIAAIELKLRG 317

>NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {ON}
           Anc_8.524 YBR204C
          Length = 363

 Score = 33.9 bits (76), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 26/119 (21%), Positives = 54/119 (45%), Gaps = 6/119 (5%)

Query: 26  ITEDTPLFIWIPGNPGLLEYYTKMLRSLH---DKYPTWEILGVSHAGMSNGNQIKNVLST 82
           + +  PL ++I G  G L  +  +LR  H    K+ T ++ G   +       +K+V+ T
Sbjct: 77  VNDGHPLHLFIHGLGGSLGQFEPLLRLTHLKGKKFLTLDLPGFGQSDELESYSMKSVIET 136

Query: 83  KVYTLDEQVSHKVEVINNFSSPKRNIIIMGHSVGAYMAQRVIMDSNLIGNVIKLGLVTP 141
               +D    ++  +  N    +  +I+ GHS+G Y+        +   ++ K+ L++P
Sbjct: 137 IRSVVDLATGNQKSLGEN---TQLKLILTGHSMGCYLCLHFFETYSKNYDIRKIALLSP 192

>ZYRO0F15950g Chr6 (1309553..1311634) [2082 bp, 693 aa] {ON} similar
           to uniprot|P47139 Saccharomyces cerevisiae YJR098C
           Hypothetical ORF
          Length = 693

 Score = 33.5 bits (75), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 89  EQVSHKVEVINNFSSPKRNIIIMGHSVGAYMAQRVIMD-SNLIGNVIKLG 137
           EQ+S+K++ I +    KR   I+ HS+G  +A + + D ++LI  +I +G
Sbjct: 326 EQLSNKLQQIYDSQEVKRGTYIIAHSMGGLVAHKALQDKTHLIRGIIYVG 375

>KAFR0E03120 Chr5 (623464..624504) [1041 bp, 346 aa] {ON} Anc_8.524
           YBR204C
          Length = 346

 Score = 33.1 bits (74), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 66/150 (44%), Gaps = 24/150 (16%)

Query: 32  LFIWIPGNPGLLEYYTKMLRSLHDKYPTWEILGVSHAGMSNGNQIKNVLSTKVYTLDEQV 91
           +++ +PG  G ++ Y ++LR L DK      + +     ++   + N     +  L E+ 
Sbjct: 84  VYLMLPGLGGNMDQYIQLLR-LIDKC-NQSFVSIDPPDFTSDKALSNYSMYNIAKLYEET 141

Query: 92  SHKVEVINNFSSPKRNIIIMGHSVGAYMAQRVIMDSNLIGNVIKLGLVTPTVVDIHRSVK 151
             ++   + F   K NI+  GHS+G Y++       N   NV KL L+TP + D      
Sbjct: 142 LSRLVGTSKF---KLNIV--GHSLGTYISIHFYHLFNYKYNVEKLILLTPPMSD------ 190

Query: 152 GIKMTRAFNLFRELPIFLGLLSTLAFSKLF 181
                      R+LPI+  ++ + A   +F
Sbjct: 191 -----------RDLPIYTRVIRSTALYAIF 209

>TDEL0C05870 Chr3 (1057153..1059306) [2154 bp, 717 aa] {ON}
           Anc_1.114 YJR098C
          Length = 717

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 89  EQVSHKVEVINNFSSPKRNIIIMGHSVGAYMAQRVIMD-SNLIGNVIKLG 137
           EQ+  K++   +    K+   I+ HS+G  +A +V+ D +NLI  +I +G
Sbjct: 349 EQLQQKLQERYDAQKVKKGTFIIAHSMGGLIAHKVLQDNTNLIRGIIYVG 398

>Smik_10.386 Chr10 complement(602088..604037) [1950 bp, 649 aa] {ON}
           YJR098C (REAL)
          Length = 649

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 89  EQVSHKVEVINNFSSPKRNIIIMGHSVGAYMAQRVIMD-SNLIGNVIKLG 137
           E + +K+E I +    K+ + I+ HS+G  +A +V+ D ++LI  +I +G
Sbjct: 339 EHLKNKLEEIYDEQKNKKGVYIIAHSMGGLVAHKVLQDYTHLIRGIIYVG 388

>TDEL0B03250 Chr2 complement(575015..576061) [1047 bp, 348 aa] {ON}
           Anc_8.524 YBR204C
          Length = 348

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 56/121 (46%), Gaps = 9/121 (7%)

Query: 32  LFIWIPGNPGLLEYYTKMLRSLHDKYPTWEILGVSHAGMSNGNQIKNVLSTKVYTLDEQV 91
           LF++I G  G LE +  +LR L  +  ++    +   G S+      +L   V ++D  +
Sbjct: 80  LFLFIHGLGGTLEQFEPVLRELDQRNKSFLAFDLPGFGKSDEWDQYPMLDV-VKSIDWLI 138

Query: 92  SHKVEVINNFSSPKRNIIIMGHSVGAYMAQRVIM---DSNLIGNVIKLGLVTPTVVDIHR 148
               ++ NN    K N+I  GHS+G Y+A    +   +S  I  ++ L    P V  + +
Sbjct: 139 H---QLTNNLKFEKLNLI--GHSMGCYLAVHFYLLFHESWCISRLVLLAPPKPNVDQLSK 193

Query: 149 S 149
           S
Sbjct: 194 S 194

>YJR098C Chr10 complement(613186..615156) [1971 bp, 656 aa] {ON}
           Putative protein of unknown function; the authentic,
           non-tagged protein is detected in highly purified
           mitochondria in high-throughput studies
          Length = 656

 Score = 32.3 bits (72), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 4/56 (7%)

Query: 86  TLDEQVSH---KVEVINNFSSPKRNIIIMGHSVGAYMAQRVIMD-SNLIGNVIKLG 137
           +LD    H   K+E I N    K+ I I+ HS+G  +A +V+ D ++LI  +I +G
Sbjct: 332 SLDISAKHLTTKLEEIYNKQKNKKGIYIIAHSMGGLVAHKVLQDCTHLIRGIIYVG 387

>TDEL0A03980 Chr1 complement(712902..713633) [732 bp, 243 aa] {ON}
           Anc_5.535 YDR428C
          Length = 243

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 40/77 (51%), Gaps = 9/77 (11%)

Query: 79  VLSTKVYTLDEQVSHKVEVINNFSSPKR--------NIIIMGHSVGAYMAQRV-IMDSNL 129
           VL++  Y L  +V H V + +   +  R        +I ++GHSVGA +A +V + D NL
Sbjct: 56  VLASIDYRLSPEVQHPVHLQDVVENLYRMIQELKLTSIQLLGHSVGATLAWQVSVSDENL 115

Query: 130 IGNVIKLGLVTPTVVDI 146
             +  KL LV   +V +
Sbjct: 116 FPSPDKLQLVKSKLVGV 132

>KLTH0H14322g Chr8 (1246601..1248646) [2046 bp, 681 aa] {ON} similar
           to uniprot|P39992 Saccharomyces cerevisiae YEL023C
           Hypothetical ORF
          Length = 681

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 42/83 (50%), Gaps = 12/83 (14%)

Query: 70  MSNGNQI-----KNVLSTKV-YTLDEQVSHKVEVINNFSSPKRNIIIMGHSVGAYMAQRV 123
           + NGN+I      N+L + V +TLD+ V      +  +  P   I + G S GA++A R+
Sbjct: 86  LDNGNRITPSKLSNLLDSVVAFTLDQHVCSAYLFLMRYYRPNDKIFMFGFSRGAFIA-RI 144

Query: 124 IMDSNLIGNVIKLGLVTPTVVDI 146
                L G + ++GL+   + DI
Sbjct: 145 -----LAGMIERVGLLNEGLEDI 162

>Kwal_14.1435 s14 complement(321870..322376) [507 bp, 168 aa] {OFF}
           [contig 242] FULL
          Length = 168

 Score = 30.4 bits (67), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 33/70 (47%), Gaps = 1/70 (1%)

Query: 86  TLDEQVSHKVEVINNFSSPKRNIIIMGHSVGAYMAQRVIMDSNLIGNVIKLGLVTPTVVD 145
           T+ ++  H +     F+SP   I+ +   + +  A R    S   GNV +  L + T+  
Sbjct: 5   TIQKRGGH-IHTSQKFTSPPGTIVDLMKEITSKRALRHRTRSRKRGNVKRKALASITLTF 63

Query: 146 IHRSVKGIKM 155
           IHR + G KM
Sbjct: 64  IHRLISGQKM 73

>Smik_2.345 Chr2 complement(618817..619944) [1128 bp, 375 aa] {ON}
           YBR204C (REAL)
          Length = 375

 Score = 30.8 bits (68), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 63/141 (44%), Gaps = 17/141 (12%)

Query: 23  DYKITEDTPLFIWIPGNPGLLEYYTKMLRSLHDKYPTWEILGVSHAGMSNGNQIKNVLST 82
           D  I  DT +F+++PG  G LE +  +L+ +      +  L +   G  + ++  +    
Sbjct: 80  DKGIRSDT-VFVFVPGLAGNLEQFEPLLKLVDSDRKAF--LALDLPGFGDSSEWSDYPML 136

Query: 83  KVYTL-----------DEQVSHKVEVINNFSSPKRNIIIMGHSVGAYMAQRVIMDSNLIG 131
           KV  L              V  K + +N F+  K  ++++GHS+G ++A  +     +  
Sbjct: 137 KVVELIFILLCDVLKGRPAVLSKDDNLNFFNGHK--LVLVGHSMGCFLACHLYEQHLVDA 194

Query: 132 NVIK-LGLVTPTVVDIHRSVK 151
            V+K L L+TP    I +  K
Sbjct: 195 KVVKTLVLLTPPKAHIEQLSK 215

>ZYRO0F09064g Chr6 (735162..736211) [1050 bp, 349 aa] {ON} similar
           to uniprot|P38139 Saccharomyces cerevisiae YBR204C
           Hypothetical ORF
          Length = 349

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 52/110 (47%), Gaps = 10/110 (9%)

Query: 32  LFIWIPGNPGLLEYYTKMLRSLHDKYPTWEILGVSHAGMSNGNQIKNVLSTKVYTLDEQV 91
           LF++I G  G LE +  +LR L D       L +   G    ++       KV    E++
Sbjct: 85  LFLFIHGLGGELEQFEPLLR-LVDAMDQ-RFLALDLPGFGKSDEWDEYPMLKVVETIEEI 142

Query: 92  SHKVEVINNFSSPKRNIIIMGHSVGAYMAQRVIMDSNLIGNVIKLGLVTP 141
           + K      F++ K  I+++GHS+G Y+        + + ++ ++ L++P
Sbjct: 143 AAK------FNAAK--IVLVGHSMGCYLTSHFYEAYHKVHSINRIVLLSP 184

>NCAS0H00540 Chr8 (93105..95249) [2145 bp, 714 aa] {ON} Anc_1.114
           YJR098C
          Length = 714

 Score = 30.8 bits (68), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 29/47 (61%), Gaps = 1/47 (2%)

Query: 89  EQVSHKVEVINNFSSPKRNIIIMGHSVGAYMAQRVIMD-SNLIGNVI 134
           EQ+  KV+ + +    K+ + ++ HS+G  +A +V+ D ++L+  VI
Sbjct: 395 EQLKEKVQKLYDAQPVKKGVYLIAHSMGGLVAHKVLQDYTSLVRGVI 441

>SAKL0H10450g Chr8 complement(897598..898776) [1179 bp, 392 aa] {ON}
           similar to uniprot|P38139 Saccharomyces cerevisiae
           YBR204C Hypothetical ORF
          Length = 392

 Score = 30.4 bits (67), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 25/44 (56%)

Query: 103 SPKRNIIIMGHSVGAYMAQRVIMDSNLIGNVIKLGLVTPTVVDI 146
           +P RN++++GHS+G Y+A           +  +L L+ P  +D+
Sbjct: 193 TPSRNLVLIGHSMGCYLAIHFCSAFQEQYSFQELVLLAPPSLDL 236

>CAGL0G08624g Chr7 complement(811931..813682) [1752 bp, 583 aa] {ON}
           similar to uniprot|P40474 Saccharomyces cerevisiae
           YIL121w
          Length = 583

 Score = 30.4 bits (67), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 43/87 (49%), Gaps = 7/87 (8%)

Query: 115 VGAYMAQRVIMD--SNLIGNVIKLGLVTPTVVDIHRSVKGIKMTRAFNLFREL--PIFLG 170
           V A +A  ++M   ++L  N I L   T  +VDI  S K    T   NLFR L   +F+G
Sbjct: 454 VKAPLASVLVMSGFASLFSNCI-LTFSTTLIVDIFPS-KTSTATGCLNLFRCLLSALFIG 511

Query: 171 LLSTLAFSKLFPAIFT-RWLLTIIMGC 196
            LS +A S  +  +FT    LT +  C
Sbjct: 512 CLSKMATSMTYGGVFTFLGALTALSAC 538

>CAGL0M05467g Chr13 complement(583722..584786) [1065 bp, 354 aa]
           {ON} weakly similar to uniprot|P38139 Saccharomyces
           cerevisiae YBR204c peroxisomal serine-active lipase
          Length = 354

 Score = 30.0 bits (66), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 51/114 (44%), Gaps = 13/114 (11%)

Query: 32  LFIWIPGNPGLLEYYT---KMLRSLHDKYPTWEILGVSHAGMS-NGNQIKNVLSTKVYTL 87
           +F+ I G  G ++ +    K+L  L  +    ++ G   +G S NG  +  V S     +
Sbjct: 77  VFLLIHGLGGSMDQFQPLMKLLTLLKYRVIALDLPGFGQSGSSTNGYDMLYVTSVVKKVV 136

Query: 88  DEQVSHKVEVINNFSSPKRNIIIMGHSVGAYMAQRVIMDSNLIGNVIKLGLVTP 141
           D  + +K ++         +  ++GHS+G Y+A   +   +   N+ KL L  P
Sbjct: 137 DNNIENKTDI---------DFKVVGHSMGCYIASHFVQMYHEEYNIDKLVLTCP 181

>TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8.524
           YBR204C
          Length = 372

 Score = 30.0 bits (66), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 50/111 (45%), Gaps = 4/111 (3%)

Query: 32  LFIWIPGNPGLLEYYTKMLRSLHDKYPTWEILGVSHAGMSNGNQIKNVLSTKVYTLDEQV 91
           ++I+I G  G LE +  +L+       ++  + +   G S  N   N+ +   Y++   +
Sbjct: 91  IYIFIHGLGGSLEQFLPLLKLTDLSNKSFIAVDLPGFGQSEFNDEYNIAN---YSMSSII 147

Query: 92  SH-KVEVINNFSSPKRNIIIMGHSVGAYMAQRVIMDSNLIGNVIKLGLVTP 141
              K +V + + +    II+ GHS+G Y+A            + K+ L+ P
Sbjct: 148 GFLKSQVFSRYLTTNTKIILTGHSMGCYLALHFYQQYKTEYQIQKIVLLAP 198

>Ecym_1376 Chr1 (776759..779020) [2262 bp, 753 aa] {ON} similar to
           Ashbya gossypii AEL071C
          Length = 753

 Score = 30.4 bits (67), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 36/76 (47%), Gaps = 9/76 (11%)

Query: 231 IRDDWNFQKRLIDYCNKENVSTWFLFSSTDHWVSDDTRNELINFYRTNCKSDILDVSVSN 290
           + D    +KR + Y +  N+ ++    ++D    D  RN +INF + N  +D       N
Sbjct: 609 VEDTNELEKRCVGYVSLRNIQSYLGMVTSD----DRARNTIINFNKENSTAD-----EDN 659

Query: 291 IIPHSFVINFSDFTVN 306
            I    ++N++ F V+
Sbjct: 660 FIHFKDLVNYTPFHVH 675

>YBR204C Chr2 complement(632254..633381) [1128 bp, 375 aa] {ON}
           LDH1Serine hydrolase; exhibits active esterase plus weak
           triacylglycerol lipase activities; proposed role in
           lipid homeostasis, regulating phospholipid and non-polar
           lipid levels and required for mobilization of LD-stored
           lipids; localizes to the lipid droplet (LD) surface;
           contains a classical serine containing catalytic triad
           (GxSxG motif)
          Length = 375

 Score = 30.0 bits (66), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 37/142 (26%), Positives = 65/142 (45%), Gaps = 19/142 (13%)

Query: 23  DYKITEDTPLFIWIPGNPGLLEYYTKMLR---SLHDKYPTWEILGVSHAGM-SNGNQIKN 78
           D  I  DT +F+++PG  G LE +  +L    S    + T ++ G  H+   S+   +K 
Sbjct: 80  DKGIRGDT-VFVFVPGLAGNLEQFEPLLELVDSDQKAFLTLDLPGFGHSSEWSDYPMLKV 138

Query: 79  VLSTKVYTLDEQVSHKVEVINN-----FSSPKRNIIIMGHSVGAYMA----QRVIMDSNL 129
           V    V   D        V NN     F+  K  I+++GHS+G ++A    ++ + D+  
Sbjct: 139 VELIFVLVCDVLRKWSTAVPNNDNVNPFNGHK--IVLVGHSMGCFLACHLYEQHMADTKA 196

Query: 130 IGNVIKLGLVTPTVVDIHRSVK 151
           +  ++   L+TP    I +  K
Sbjct: 197 VQTLV---LLTPPKAHIEQLSK 215

>TBLA0H03540 Chr8 (863267..864403) [1137 bp, 378 aa] {ON} Anc_8.524
           YBR204C
          Length = 378

 Score = 30.0 bits (66), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 20/99 (20%), Positives = 48/99 (48%), Gaps = 5/99 (5%)

Query: 25  KITEDTPLFIWIPGNPGLLEYYTKMLRS---LHDKYPTWEILGVSHAGMSNGNQIKNVLS 81
           ++  + P+++++PG  G L+ Y  +LR    L++K+  +++ G   +         N++ 
Sbjct: 89  EVLTNKPIYVFLPGLGGSLDQYEPLLRLMDILNEKFIGFDLPGFGGSEEDTSEGGYNMI- 147

Query: 82  TKVYTLDEQVSHKVEVINNFSSPKRNIIIMGHSVGAYMA 120
            KV  +  +    +   N  +     + ++GHS+G Y+ 
Sbjct: 148 -KVCHIINEALQSIITQNYSTRDTIELRLVGHSMGCYLV 185

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.137    0.423 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,214,449
Number of extensions: 1561668
Number of successful extensions: 4392
Number of sequences better than 10.0: 47
Number of HSP's gapped: 4458
Number of HSP's successfully gapped: 47
Length of query: 309
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 200
Effective length of database: 40,982,805
Effective search space: 8196561000
Effective search space used: 8196561000
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 65 (29.6 bits)