Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0C044403.485ON1150115054770.0
Smik_6.2213.485ON103692528380.0
Skud_7.4363.485ON103692128110.0
NCAS0E009503.485ON105291928100.0
Suva_7.4133.485ON103791128050.0
YGR125W3.485ON103693727690.0
CAGL0I10626g3.485ON1070104427300.0
KAFR0C019103.485ON102091427150.0
Kpol_480.183.485ON105788827090.0
KNAG0B008603.485ON108891927060.0
NDAI0G009903.485ON105491927020.0
ZYRO0C07986g3.485ON102490126500.0
SAKL0F02926g3.485ON1050114626240.0
TDEL0D055303.485ON103186226230.0
TPHA0D042103.485ON104989725630.0
KLTH0F14674g3.485ON101090725000.0
Kwal_55.212013.485ON101191324980.0
KLLA0E04731g3.485ON106089923790.0
AFR304W3.485ON101581822000.0
Smik_16.2418.99ON7442711263e-06
Kpol_467.118.99ON7442791264e-06
Skud_16.2868.99ON7452741264e-06
SAKL0B03124g8.99ON7442771255e-06
Suva_16.3228.99ON7422711238e-06
TPHA0H007208.99ON7871591221e-05
NCAS0B048008.99ON7242641221e-05
NDAI0B022108.99ON7065321193e-05
YPR003C8.99ON7542721174e-05
KLLA0E14059g8.99ON7064561174e-05
TDEL0C012808.99ON7272691174e-05
KLTH0G16764g8.99ON7103441175e-05
TBLA0C052708.99ON776851131e-04
ZYRO0F04796g8.99ON7351371103e-04
SAKL0H08800gna 1ON6202751076e-04
AGR213Cna 1ON6892811068e-04
CAGL0L09207g8.99ON7252701050.001
KNAG0D023908.99ON7161371050.001
Kwal_27.110398.99ON7261271000.005
Skud_12.1608.271ON893204830.45
Suva_10.1768.271ON893204830.47
Smik_12.1518.271ON893204820.56
YBR294W (SUL1)na 2ON859167810.80
NCAS0B050508.271ON923184810.88
YLR092W (SUL2)8.271ON893214801.2
SAKL0H16830g8.271ON862176781.8
NDAI0B020208.271ON905177772.6
Suva_4.554na 2ON850167763.0
NDAI0E014008.644ON32574735.2
Skud_2.424na 2ON863167745.5
Smik_13.328.817ON46863719.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0C04440
         (1150 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0C04440 Chr3 (1075482..1078934) [3453 bp, 1150 aa] {ON} Anc_...  2114   0.0  
Smik_6.221 Chr6 (360160..363270) [3111 bp, 1036 aa] {ON} YGR125W...  1097   0.0  
Skud_7.436 Chr7 (721556..724666) [3111 bp, 1036 aa] {ON} YGR125W...  1087   0.0  
NCAS0E00950 Chr5 complement(171346..174504) [3159 bp, 1052 aa] {...  1087   0.0  
Suva_7.413 Chr7 (712372..715485) [3114 bp, 1037 aa] {ON} YGR125W...  1085   0.0  
YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative p...  1071   0.0  
CAGL0I10626g Chr9 complement(1048818..1052030) [3213 bp, 1070 aa...  1056   0.0  
KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3....  1050   0.0  
Kpol_480.18 s480 complement(36794..39967) [3174 bp, 1057 aa] {ON...  1048   0.0  
KNAG0B00860 Chr2 complement(156225..159491) [3267 bp, 1088 aa] {...  1046   0.0  
NDAI0G00990 Chr7 complement(205221..208385) [3165 bp, 1054 aa] {...  1045   0.0  
ZYRO0C07986g Chr3 complement(609503..612577) [3075 bp, 1024 aa] ...  1025   0.0  
SAKL0F02926g Chr6 complement(245957..249109) [3153 bp, 1050 aa] ...  1015   0.0  
TDEL0D05530 Chr4 (999021..1002116) [3096 bp, 1031 aa] {ON} Anc_3...  1014   0.0  
TPHA0D04210 Chr4 (908861..912010) [3150 bp, 1049 aa] {ON} Anc_3....   991   0.0  
KLTH0F14674g Chr6 (1201874..1204906) [3033 bp, 1010 aa] {ON} sim...   967   0.0  
Kwal_55.21201 s55 (727206..730241) [3036 bp, 1011 aa] {ON} YGR12...   966   0.0  
KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] ...   920   0.0  
AFR304W Chr6 (991645..994692) [3048 bp, 1015 aa] {ON} Syntenic h...   852   0.0  
Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {...    53   3e-06
Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON} (26194..2...    53   4e-06
Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {...    53   4e-06
SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {...    53   5e-06
Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {...    52   8e-06
TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {O...    52   1e-05
NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {O...    52   1e-05
NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {O...    50   3e-05
YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON} ...    50   4e-05
KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} simi...    50   4e-05
TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {O...    50   4e-05
KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]...    50   5e-05
TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa] ...    48   1e-04
ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} simila...    47   3e-04
SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} simila...    46   6e-04
AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}...    45   8e-04
CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]...    45   0.001
KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.9...    45   0.001
Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {...    43   0.005
Skud_12.160 Chr12 (306715..309396) [2682 bp, 893 aa] {ON} YLR092...    37   0.45 
Suva_10.176 Chr10 (328373..331054) [2682 bp, 893 aa] {ON} YLR092...    37   0.47 
Smik_12.151 Chr12 (303440..306121) [2682 bp, 893 aa] {ON} YLR092...    36   0.56 
YBR294W Chr2 (789235..791814) [2580 bp, 859 aa] {ON}  SUL1High a...    36   0.80 
NCAS0B05050 Chr2 (937285..940056) [2772 bp, 923 aa] {ON} Anc_8.271     36   0.88 
YLR092W Chr12 (323544..326225) [2682 bp, 893 aa] {ON}  SUL2High ...    35   1.2  
SAKL0H16830g Chr8 complement(1479446..1482034) [2589 bp, 862 aa]...    35   1.8  
NDAI0B02020 Chr2 (501062..503779) [2718 bp, 905 aa] {ON} Anc_8.271     34   2.6  
Suva_4.554 Chr4 (962125..964677) [2553 bp, 850 aa] {ON} YBR294W ...    34   3.0  
NDAI0E01400 Chr5 complement(279960..280937) [978 bp, 325 aa] {ON...    33   5.2  
Skud_2.424 Chr2 (758785..761376) [2592 bp, 863 aa] {ON} YBR294W ...    33   5.5  
Smik_13.32 Chr13 (64435..65841) [1407 bp, 468 aa] {ON} YML102W (...    32   9.2  

>TBLA0C04440 Chr3 (1075482..1078934) [3453 bp, 1150 aa] {ON} Anc_3.485
            YGR125W
          Length = 1150

 Score = 2114 bits (5477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1057/1150 (91%), Positives = 1057/1150 (91%)

Query: 1    MVYAQQDSDNNSNRERNKLSEAISISLGLQEQQGXXXXXXXXXXXXIHGTLNNSRQRRKP 60
            MVYAQQDSDNNSNRERNKLSEAISISLGLQEQQG            IHGTLNNSRQRRKP
Sbjct: 1    MVYAQQDSDNNSNRERNKLSEAISISLGLQEQQGNDNDKYNNDNSNIHGTLNNSRQRRKP 60

Query: 61   SISLDPTLSRNIGARSFNCGAFLSRSIDNNLPTTDMXXXXXXXXXXXXXXXTHGLNSNND 120
            SISLDPTLSRNIGARSFNCGAFLSRSIDNNLPTTDM               THGLNSNND
Sbjct: 61   SISLDPTLSRNIGARSFNCGAFLSRSIDNNLPTTDMFNSSTFRSSNSNNYFTHGLNSNND 120

Query: 121  HLPVINPFPKSSIHGSDNLHKRTAEISNEFNNSXXXXXXXXXXXXXXXIPSTAQSSNNLN 180
            HLPVINPFPKSSIHGSDNLHKRTAEISNEFNNS               IPSTAQSSNNLN
Sbjct: 121  HLPVINPFPKSSIHGSDNLHKRTAEISNEFNNSPTDTEDDNANTETPNIPSTAQSSNNLN 180

Query: 181  DSNDFMIELDGXXXXXXXXXIVSSELPPTATSMFNNTNSTATSVQSLKIGNNEILKTISG 240
            DSNDFMIELDG         IVSSELPPTATSMFNNTNSTATSVQSLKIGNNEILKTISG
Sbjct: 181  DSNDFMIELDGNNNTNNSNNIVSSELPPTATSMFNNTNSTATSVQSLKIGNNEILKTISG 240

Query: 241  DNGGIVNRLPIQELDEDIIDNDEYSRLLPTPSPSIYDDENALFFSSSNNYDSTDLENNNY 300
            DNGGIVNRLPIQELDEDIIDNDEYSRLLPTPSPSIYDDENALFFSSSNNYDSTDLENNNY
Sbjct: 241  DNGGIVNRLPIQELDEDIIDNDEYSRLLPTPSPSIYDDENALFFSSSNNYDSTDLENNNY 300

Query: 301  ISSSIPTTTDVTQSTSLSFKDMLTKHSLQILHDIPACIXXXXXXXXXXXSYGMILFPITD 360
            ISSSIPTTTDVTQSTSLSFKDMLTKHSLQILHDIPACI           SYGMILFPITD
Sbjct: 301  ISSSIPTTTDVTQSTSLSFKDMLTKHSLQILHDIPACILGLLLNILDALSYGMILFPITD 360

Query: 361  SVFGHLGPTGLSMFYISTIISQLVYSGGFSAFPSGLGGEMIEIVPFFHTMALTVKNSIPS 420
            SVFGHLGPTGLSMFYISTIISQLVYSGGFSAFPSGLGGEMIEIVPFFHTMALTVKNSIPS
Sbjct: 361  SVFGHLGPTGLSMFYISTIISQLVYSGGFSAFPSGLGGEMIEIVPFFHTMALTVKNSIPS 420

Query: 421  KDQNEIITTTIFCYVISCIFTGIVFFCLGKFKLGKLVGFFPRHILIGCIGGVGYFLIVTG 480
            KDQNEIITTTIFCYVISCIFTGIVFFCLGKFKLGKLVGFFPRHILIGCIGGVGYFLIVTG
Sbjct: 421  KDQNEIITTTIFCYVISCIFTGIVFFCLGKFKLGKLVGFFPRHILIGCIGGVGYFLIVTG 480

Query: 481  IEVTTRVKKLEYSLEFLLSVITNMSTLFKLVLPISLSVLLNILQKIYSHSLLLPSFYIIT 540
            IEVTTRVKKLEYSLEFLLSVITNMSTLFKLVLPISLSVLLNILQKIYSHSLLLPSFYIIT
Sbjct: 481  IEVTTRVKKLEYSLEFLLSVITNMSTLFKLVLPISLSVLLNILQKIYSHSLLLPSFYIIT 540

Query: 541  FIAFHFIVALVPNLSLDSLRATGWIFPVAESSDTWYSHYKYFNFFNCHWDLVFKQIPTMF 600
            FIAFHFIVALVPNLSLDSLRATGWIFPVAESSDTWYSHYKYFNFFNCHWDLVFKQIPTMF
Sbjct: 541  FIAFHFIVALVPNLSLDSLRATGWIFPVAESSDTWYSHYKYFNFFNCHWDLVFKQIPTMF 600

Query: 601  ALTFFGILHVPINVPALAMSVQMDKYDVDKELIAHGYSNLISGLFGSVQNYLVYTNSVLF 660
            ALTFFGILHVPINVPALAMSVQMDKYDVDKELIAHGYSNLISGLFGSVQNYLVYTNSVLF
Sbjct: 601  ALTFFGILHVPINVPALAMSVQMDKYDVDKELIAHGYSNLISGLFGSVQNYLVYTNSVLF 660

Query: 661  IRAGGNTASAGLVLAGFTAIILFIGPVIISFIPVCIVGSLIFLLGWELIVEALLDTWGKV 720
            IRAGGNTASAGLVLAGFTAIILFIGPVIISFIPVCIVGSLIFLLGWELIVEALLDTWGKV
Sbjct: 661  IRAGGNTASAGLVLAGFTAIILFIGPVIISFIPVCIVGSLIFLLGWELIVEALLDTWGKV 720

Query: 721  TKFEYITIMIIVFTMGIYDFVLGILVGILIACFSFLVDSTKLQTVNGEFNGTVAKSTVYR 780
            TKFEYITIMIIVFTMGIYDFVLGILVGILIACFSFLVDSTKLQTVNGEFNGTVAKSTVYR
Sbjct: 721  TKFEYITIMIIVFTMGIYDFVLGILVGILIACFSFLVDSTKLQTVNGEFNGTVAKSTVYR 780

Query: 781  DYVQSQFLSGIAEQIYVLKLQNVLFFGTIISIEEKIDMLLEISDNDSSKRRIKYLILDLK 840
            DYVQSQFLSGIAEQIYVLKLQNVLFFGTIISIEEKIDMLLEISDNDSSKRRIKYLILDLK
Sbjct: 781  DYVQSQFLSGIAEQIYVLKLQNVLFFGTIISIEEKIDMLLEISDNDSSKRRIKYLILDLK 840

Query: 841  NVNSDNIDYSAAEGFNRIKRFTQSKRIQLIISSIKDTDKIYKMFXXXXXXXXXXXFSDLN 900
            NVNSDNIDYSAAEGFNRIKRFTQSKRIQLIISSIKDTDKIYKMF           FSDLN
Sbjct: 841  NVNSDNIDYSAAEGFNRIKRFTQSKRIQLIISSIKDTDKIYKMFNNVNLLENVELFSDLN 900

Query: 901  GALEWCENEFLYQYRQVKNXXXXXXXXXXTSRDVVRTGYLSTSVSNTLNDRKSSGNLPIN 960
            GALEWCENEFLYQYRQVKN          TSRDVVRTGYLSTSVSNTLNDRKSSGNLPIN
Sbjct: 901  GALEWCENEFLYQYRQVKNKARARAKRKATSRDVVRTGYLSTSVSNTLNDRKSSGNLPIN 960

Query: 961  TPRNHQMVSVAKNIFQNIEQPVRSFSTNLNKSIPVLELLVFALKQYRSDIFSDDNKVRDK 1020
            TPRNHQMVSVAKNIFQNIEQPVRSFSTNLNKSIPVLELLVFALKQYRSDIFSDDNKVRDK
Sbjct: 961  TPRNHQMVSVAKNIFQNIEQPVRSFSTNLNKSIPVLELLVFALKQYRSDIFSDDNKVRDK 1020

Query: 1021 EVEFWSQLCPYFTKQPLANKTSLLHNNNVFFIVESGVLKMEFNLPQGSVYETMSNRTCYG 1080
            EVEFWSQLCPYFTKQPLANKTSLLHNNNVFFIVESGVLKMEFNLPQGSVYETMSNRTCYG
Sbjct: 1021 EVEFWSQLCPYFTKQPLANKTSLLHNNNVFFIVESGVLKMEFNLPQGSVYETMSNRTCYG 1080

Query: 1081 RILGKGYLKKSTSPLNIKAETDCIIWLINSEGLDKMKAENXXXXXXXXXXVMSVKDDRFN 1140
            RILGKGYLKKSTSPLNIKAETDCIIWLINSEGLDKMKAEN          VMSVKDDRFN
Sbjct: 1081 RILGKGYLKKSTSPLNIKAETDCIIWLINSEGLDKMKAENLELYTELTLLVMSVKDDRFN 1140

Query: 1141 NLLGYALISA 1150
            NLLGYALISA
Sbjct: 1141 NLLGYALISA 1150

>Smik_6.221 Chr6 (360160..363270) [3111 bp, 1036 aa] {ON} YGR125W
            (REAL)
          Length = 1036

 Score = 1097 bits (2838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/925 (58%), Positives = 683/925 (73%), Gaps = 21/925 (2%)

Query: 241  DNGGIVNRLPIQELDEDIID--NDEYSRLLPTPSPS-IYDDENALFFSSSNNYDSTDLEN 297
            D+G   +   ++ ++EDI +  +DEYSRLL +P+ S I DD N        N  +++LE+
Sbjct: 118  DSGDRKDDQSMRTIEEDIDEEYSDEYSRLLLSPASSNINDDRN----RGLQNGLTSELED 173

Query: 298  NNYISSSIPTTTDVTQSTSLSFKDMLTKHSLQILHDIPACIXXXXXXXXXXXSYGMILFP 357
            +         ++   +S   +F+ + T    + +H +PA +           SYGMI+FP
Sbjct: 174  DYEGGYQSLRSSHNLRSRPRNFRRLCTSFPSKFIHYLPAAVLGLLLNILDALSYGMIIFP 233

Query: 358  ITDSVFGHLGPTGLSMFYISTIISQLVYSGGFSAFPSGLGGEMIEIVPFFHTMALTVKNS 417
            IT+ VF HLGPTG+SMFYISTIISQ VYSGG S+FPSG+G EMIEI PF+HTMAL VK +
Sbjct: 234  ITEPVFSHLGPTGISMFYISTIISQAVYSGGCSSFPSGIGSEMIEITPFYHTMALAVKEA 293

Query: 418  IPSKDQNEIITTTIFCYVISCIFTGIVFFCLGKFKLGKLVGFFPRHILIGCIGGVGYFLI 477
            + + D +EIITTTIFCYVIS + TG VF+ LGK +LGK+VGFFPRHILIGCIGGVGYFLI
Sbjct: 294  L-AGDDDEIITTTIFCYVISSMLTGTVFYVLGKLQLGKIVGFFPRHILIGCIGGVGYFLI 352

Query: 478  VTGIEVTTRVKKLEYSLEFLLSVITNMSTLFKLVLPISLSVLLNILQKIYSHSLLLPSFY 537
            +TGIEVTTRV K EYS  F L + TN  TL K +LP+ L+V+L   Q+ + +SL+LPSFY
Sbjct: 353  ITGIEVTTRVAKFEYSWPFFLGLFTNYDTLAKWLLPVILTVILIGTQRYFKNSLVLPSFY 412

Query: 538  IITFIAFHFIVALVPNLSLDSLRATGWIFPVAESSDTWYSHYKYFNFFNCHWDLVFKQIP 597
            I+T + FHFIVA++P LSLD+LRA GWIFP+A S   WY HYK FN    HW LV +QIP
Sbjct: 413  ILTLVLFHFIVAIIPTLSLDTLRAAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIP 472

Query: 598  TMFALTFFGILHVPINVPALAMSVQMDKYDVDKELIAHGYSNLISGLFGSVQNYLVYTNS 657
            TM ALTFFGILHVPINVPALAMS+QMDKYDVD+ELIAHGYSN  SGL GSVQNYLVYTNS
Sbjct: 473  TMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNS 532

Query: 658  VLFIRAGGNTASAGLVLAGFTAIILFIGPVIISFIPVCIVGSLIFLLGWELIVEALLDTW 717
            VLFIRAG +++ AG +L   T  I+ IGPVIISFIP+CIVGSLIFLLG+EL+VEAL+DTW
Sbjct: 533  VLFIRAGADSSFAGFLLIALTICIMMIGPVIISFIPICIVGSLIFLLGYELLVEALIDTW 592

Query: 718  GKVTKFEYITIMIIVFTMGIYDFVLGILVGILIACFSFLVDSTKLQTVNGEFNGTVAKST 777
             K+ +FEY+T++IIVFTMGI+DFVLGI+VGILIACFSFLVDSTKLQT+NGE+NG VAKST
Sbjct: 593  NKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKST 652

Query: 778  VYRDYVQSQFLSGIAEQIYVLKLQNVLFFGTIISIEEKIDMLLEISDNDSSKRRIKYLIL 837
            VYRDYVQ++FL GI EQIYVLKLQN+LFFGTI+SIEEKI+ LL+IS+ D++KRRIKYLIL
Sbjct: 653  VYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTILSIEEKIEKLLQISNKDATKRRIKYLIL 712

Query: 838  DLKNVNSDNIDYSAAEGFNRIKRFTQSKRIQLIISSIKDTDKIYKMFXXXXXXXXXXXFS 897
            D KN+N+DNIDYSAAEGFNRIKRFT++K+I+LIISSI++ D+IY  F           F+
Sbjct: 713  DFKNINADNIDYSAAEGFNRIKRFTETKKIKLIISSIRERDRIYNAFNNVGLLNDVELFA 772

Query: 898  DLNGALEWCENEFLYQYRQVKNXXXXXXXXXXTSRDVVRTGYLSTSVS--NTLNDRKSSG 955
            DLN ALEWCENEFL+QY+Q++              ++V     +T     N L +  + G
Sbjct: 773  DLNSALEWCENEFLFQYKQLR-IKAKERLEERKQNNIVSAVMAATQNKNINALGNGLNKG 831

Query: 956  N----------LPINTPRNHQMVSVAKNIFQNIEQPVRSFSTNLNKSIPVLELLVFALKQ 1005
            N          LP NTPRN+QM+SVA+N+F N EQ V++F        PVL +L+FALKQ
Sbjct: 832  NNIDPVRNLMSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKKEYKDDEPVLPILLFALKQ 891

Query: 1006 YRSDIFSDDNKVRDKEVEFWSQLCPYFTKQPLANKTSLLHNNNVFFIVESGVLKMEFNLP 1065
            YR DI S+  KVR+KE++FW+QLCPYFT++ LA+++ LLH +NVFF+VE+G+LK  + LP
Sbjct: 892  YRPDIISEIQKVREKEIKFWAQLCPYFTRRRLASQSLLLHADNVFFLVETGMLKATYELP 951

Query: 1066 QGSVYETMSNRTCYGRILGKGYLKKSTSPLNIKAETDCIIWLINSEGLDKMKAENXXXXX 1125
            QG++YE  SN TC+G+I+  G        L I+ ETD I+W+I+S  L KMK EN     
Sbjct: 952  QGTLYEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSILWVIDSSSLKKMKEENLALYV 1011

Query: 1126 XXXXXVMSVKDDRFNNLLGYALISA 1150
                 VM +KD RF  LLGY L+SA
Sbjct: 1012 EVALMVMCIKDTRFKELLGYTLVSA 1036

 Score = 40.0 bits (92), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 29/40 (72%), Gaps = 1/40 (2%)

Query: 115 LNSNND-HLPVINPFPKSSIHGSDNLHKRTAEISNEFNNS 153
           +NS +D  LP+ N      IHGS+NLH++TA++SNEF +S
Sbjct: 62  INSMSDSKLPLSNKQHPKVIHGSENLHRQTAQLSNEFCSS 101

>Skud_7.436 Chr7 (721556..724666) [3111 bp, 1036 aa] {ON} YGR125W
            (REAL)
          Length = 1036

 Score = 1087 bits (2811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/921 (58%), Positives = 670/921 (72%), Gaps = 31/921 (3%)

Query: 248  RLPIQELDEDIIDNDEYSRLLPTPSPSIYDDENALFFSSSNNYDSTDLENNNYISSSIPT 307
            R  ++ +DE+   +DEYSRLL +P+ S  DDE      S    +  D     Y S     
Sbjct: 129  RTIVENIDEEY--SDEYSRLLLSPASSNVDDERNRALQSGPISELEDDYGGGYQS----- 181

Query: 308  TTDVTQSTSLSFK-----DMLTKHSLQILHDIPACIXXXXXXXXXXXSYGMILFPITDSV 362
               +  S +L F+        T    +  H +PA +           SYGMI+FPIT+ V
Sbjct: 182  ---LRPSHNLRFRPRNIWQWCTSFPFKFAHYLPAAVLGLLLNILDALSYGMIIFPITEPV 238

Query: 363  FGHLGPTGLSMFYISTIISQLVYSGGFSAFPSGLGGEMIEIVPFFHTMALTVKNSIPSKD 422
            F HLGPTG+SMFYISTIISQ VYSGG+S+FPSG+G EMIEI PF+HTMAL VK+++   D
Sbjct: 239  FSHLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPFYHTMALAVKDALEGND 298

Query: 423  QNEIITTTIFCYVISCIFTGIVFFCLGKFKLGKLVGFFPRHILIGCIGGVGYFLIVTGIE 482
             +EIITTTIFCYVIS + TG+VF+ LGK +LGK+VGFFPRHILIGCIGGVGYFLI+TGIE
Sbjct: 299  -DEIITTTIFCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIE 357

Query: 483  VTTRVKKLEYSLEFLLSVITNMSTLFKLVLPISLSVLLNILQKIYSHSLLLPSFYIITFI 542
            VTTRV K EYS  F   + TN  TL K +LP+ L+V+L   Q+ + +SL+LP+FYI+T +
Sbjct: 358  VTTRVAKFEYSWPFFSGLFTNYDTLAKWLLPVLLTVILIGTQRYFKNSLVLPTFYILTLV 417

Query: 543  AFHFIVALVPNLSLDSLRATGWIFPVAESSDTWYSHYKYFNFFNCHWDLVFKQIPTMFAL 602
             FHFIVA++P LSLD+LR  GWIFP+A S   WY HYK FN    HW LV +QIPTM AL
Sbjct: 418  LFHFIVAIIPTLSLDTLREAGWIFPIANSDSKWYDHYKLFNVHKVHWSLVLQQIPTMMAL 477

Query: 603  TFFGILHVPINVPALAMSVQMDKYDVDKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIR 662
            TFFGILHVPINVPALAMS+QMDKYDVD+ELIAHGYSN  SGL GSVQNYLVYTNSVLFIR
Sbjct: 478  TFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIR 537

Query: 663  AGGNTASAGLVLAGFTAIILFIGPVIISFIPVCIVGSLIFLLGWELIVEALLDTWGKVTK 722
            AG +++ AG +L   T  ++ IGPVIISFIP+CIVGSLIFLLG+EL+VEAL+DTW K+ +
Sbjct: 538  AGADSSFAGFLLIALTICVMLIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWNKLNR 597

Query: 723  FEYITIMIIVFTMGIYDFVLGILVGILIACFSFLVDSTKLQTVNGEFNGTVAKSTVYRDY 782
            FEY+T++IIVFTMG++DFVLGI+VGILIACFSFLVDSTKLQT+NGE+NG VAKSTVYRDY
Sbjct: 598  FEYLTVVIIVFTMGVFDFVLGIIVGILIACFSFLVDSTKLQTINGEYNGNVAKSTVYRDY 657

Query: 783  VQSQFLSGIAEQIYVLKLQNVLFFGTIISIEEKIDMLLEISDNDSSKRRIKYLILDLKNV 842
            VQ++FL GI EQIYVLKLQNVLFFGTIISIEEKI+ LL+IS+ D+ KRRIKYLILD KN+
Sbjct: 658  VQTKFLDGIGEQIYVLKLQNVLFFGTIISIEEKIEKLLQISNKDAKKRRIKYLILDFKNI 717

Query: 843  NSDNIDYSAAEGFNRIKRFTQSKRIQLIISSIKDTDKIYKMFXXXXXXXXXXXFSDLNGA 902
            N+DNIDYSAAEGFNRIKRFT +KRI+LIISSIK+ D+IY  F           F+DLN A
Sbjct: 718  NADNIDYSAAEGFNRIKRFTGTKRIKLIISSIKERDRIYNAFNNVGLLNDVELFADLNSA 777

Query: 903  LEWCENEFLYQYRQVKNXXXXXXXXXXTSRDVVRTGYLSTSVSNTLN----------DRK 952
            LEWCENEFL+QY+Q++            S   V +  ++ + +  ++          +R 
Sbjct: 778  LEWCENEFLFQYKQLREKAKKRLEERKQSS--VASAIMAATQNKKIDGLGNGLSTGENRD 835

Query: 953  SSGN---LPINTPRNHQMVSVAKNIFQNIEQPVRSFSTNLNKSIPVLELLVFALKQYRSD 1009
             + N   LP NTPRN+QM+SVA+N+F N EQ V++F        P+L +L+FALKQYR D
Sbjct: 836  HARNLMSLPTNTPRNYQMLSVAQNVFVNDEQAVKNFKMEYKNDEPILPILLFALKQYRPD 895

Query: 1010 IFSDDNKVRDKEVEFWSQLCPYFTKQPLANKTSLLHNNNVFFIVESGVLKMEFNLPQGSV 1069
            I S+   VR+KE++FW+QLCPYFT++ LA+++ LLH +N+FF+VE+G+LK  + LPQG++
Sbjct: 896  IISEIQTVREKEIKFWAQLCPYFTRRRLASQSLLLHADNIFFLVETGMLKATYELPQGTL 955

Query: 1070 YETMSNRTCYGRILGKGYLKKSTSPLNIKAETDCIIWLINSEGLDKMKAENXXXXXXXXX 1129
            YE  SN TC+G+I+  G        L I+ ETD ++W+I+S  L KMK EN         
Sbjct: 956  YEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSLKKMKEENLALYVEVTL 1015

Query: 1130 XVMSVKDDRFNNLLGYALISA 1150
             VM +KD RF  LLGY L+SA
Sbjct: 1016 MVMCIKDTRFKELLGYTLVSA 1036

 Score = 35.8 bits (81), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 53/133 (39%), Gaps = 47/133 (35%)

Query: 21  EAISISLGLQEQQGXXXXXXXXXXXXIHGTLNNSRQRRKPSISLDPTLSRNIGARSFNCG 80
           EAIS+SLG+ +                    + ++  R    ++ P L R+  +  F  G
Sbjct: 16  EAISVSLGINQDS------------------SKNKMHRASVSAMSPPLCRSYMSGFFTGG 57

Query: 81  AFLSRSIDNNLPTTDMXXXXXXXXXXXXXXXTHGLNSNNDHLPVINPFPKSSIHGSDNLH 140
                       ++ M                   N ++  LP  N    + IHGS+NLH
Sbjct: 58  ------------SSPMVK-----------------NMSDSKLPFSNKQHPTVIHGSENLH 88

Query: 141 KRTAEISNEFNNS 153
           ++TA++SNEF +S
Sbjct: 89  RQTAQLSNEFCSS 101

>NCAS0E00950 Chr5 complement(171346..174504) [3159 bp, 1052 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1052

 Score = 1087 bits (2810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 549/919 (59%), Positives = 682/919 (74%), Gaps = 35/919 (3%)

Query: 252  QELDEDII-------DNDEYSRLLPTPSPSIYDDENALFFSSSNNYDSTDL------ENN 298
            +E +ED I       D DE SRLL +P             SS+ N +  DL      E+ 
Sbjct: 149  EEAEEDFIEPVAEAADVDESSRLLISP------------LSSNINPNIDDLLPTVTGEDV 196

Query: 299  NYISSSIPTTTDVTQSTSLSFKDMLTKHSLQILHDIPACIXXXXXXXXXXXSYGMILFPI 358
            +   S   T T      S +    +     Q +H +PA +           SYGMI+FPI
Sbjct: 197  SSYQSIYRTATPSLSRNSETIWQNIADFPYQFIHYLPAAVLGLLLNILDALSYGMIIFPI 256

Query: 359  TDSVFGHLGPTGLSMFYISTIISQLVYSGGFSAFPSGLGGEMIEIVPFFHTMALTVKNSI 418
            T+ +F HLGPTGLSMFYISTIISQ +YS G+S+FPSG+G EMIE+ PFFHTMAL +K ++
Sbjct: 257  TEPIFSHLGPTGLSMFYISTIISQTIYSSGWSSFPSGIGSEMIEVTPFFHTMALAIKETL 316

Query: 419  PSKDQNEIITTTIFCYVISCIFTGIVFFCLGKFKLGKLVGFFPRHILIGCIGGVGYFLIV 478
            P +D +EIITTTIFCYVIS + TG+ F+ LGK  LGK+VGFFPRHILIGCIGGVGYFL+V
Sbjct: 317  PGRD-DEIITTTIFCYVISSMLTGLTFYSLGKLHLGKIVGFFPRHILIGCIGGVGYFLLV 375

Query: 479  TGIEVTTRVKKLEYSLEFLLSVITNMSTLFKLVLPISLSVLLNILQKIYSHSLLLPSFYI 538
            TGIEVTTRV K EYS+ FL S+ ++ +TL+K +LP+ L+V+L + Q+ + +SL+LPSFYI
Sbjct: 376  TGIEVTTRVAKFEYSIPFLASLFSDWATLWKWLLPVLLTVILIVTQRCFKNSLVLPSFYI 435

Query: 539  ITFIAFHFIVALVPNLSLDSLRATGWIFPVAESSDTWYSHYKYFNFFNCHWDLVFKQIPT 598
            +T I FHFIVA++P+L+L+ LR +GWIFP+A S+  WY HYK F+F   HW LVFKQIPT
Sbjct: 436  LTLILFHFIVAIIPSLTLNQLRDSGWIFPIAISNSKWYDHYKLFDFKKVHWTLVFKQIPT 495

Query: 599  MFALTFFGILHVPINVPALAMSVQMDKYDVDKELIAHGYSNLISGLFGSVQNYLVYTNSV 658
            M ALTFFGILHVPINVPALAMS+ +DKYDVDKELIAHG SN ISG  GS+QNYLVYTNSV
Sbjct: 496  MLALTFFGILHVPINVPALAMSLHLDKYDVDKELIAHGLSNFISGAVGSIQNYLVYTNSV 555

Query: 659  LFIRAGGNTASAGLVLAGFTAIILFIGPVIISFIPVCIVGSLIFLLGWELIVEALLDTWG 718
            LFIRAG ++A AG +L   TAI++FIGPVIISFIP+CIVGSLIFLLG+EL+VEAL D WG
Sbjct: 556  LFIRAGADSAMAGYILIILTAIVMFIGPVIISFIPICIVGSLIFLLGYELLVEALWDPWG 615

Query: 719  KVTKFEYITIMIIVFTMGIYDFVLGILVGILIACFSFLVDSTKLQTVNGEFNGTVAKSTV 778
            K++ FEYITI+IIV TMGI+DFVLGI+VGILIACFSFL+DSTKLQT+NGE++GTVAKSTV
Sbjct: 616  KISNFEYITIVIIVLTMGIFDFVLGIIVGILIACFSFLIDSTKLQTINGEYDGTVAKSTV 675

Query: 779  YRDYVQSQFLSGIAEQIYVLKLQNVLFFGTIISIEEKIDMLLEISDNDSSKRRIKYLILD 838
            YRD +Q++FL+GI EQIYVLKLQN+LFFGTIISIEEKID LLEI   DSS+ RIKYLILD
Sbjct: 676  YRDLIQTKFLNGIGEQIYVLKLQNLLFFGTIISIEEKIDELLEICHKDSSRLRIKYLILD 735

Query: 839  LKNVNSDNIDYSAAEGFNRIKRFTQSKRIQLIISSIKDTDKIYKMFXXXXXXXXXXXFSD 898
             KN+N+DNIDYSAAEGFNRIKRFTQ+K+IQL+ISSIK+ D IYK F           F+D
Sbjct: 736  FKNINADNIDYSAAEGFNRIKRFTQTKKIQLLISSIKERDHIYKAFDNVGLLKGVELFND 795

Query: 899  LNGALEWCENEFLYQYRQVKNXXXXXXXXXXTSRDVVRTGYLSTSVSNTLNDRKSS---- 954
            LN ALEWCENEFL++Y+Q+++                  G      +   ND+KS+    
Sbjct: 796  LNSALEWCENEFLFKYKQLRDKAKSRLHRKQIIDINASIGSQKYQFTAG-NDKKSNLDIP 854

Query: 955  ---GNLPINTPRNHQMVSVAKNIFQNIEQPVRSFSTNLNKSIPVLELLVFALKQYRSDIF 1011
                +LPINTPRNHQ++SVA+N+FQN EQ V++  T L    P L LL+F LKQYR  I 
Sbjct: 855  RNLMSLPINTPRNHQILSVAQNVFQNEEQTVKNLKTELKDQAPFLPLLLFTLKQYRPGII 914

Query: 1012 SDDNKVRDKEVEFWSQLCPYFTKQPLANKTSLLHNNNVFFIVESGVLKMEFNLPQGSVYE 1071
            S D  V++ E++FWSQLCPYF K PLA++++L+HNNN+FFIVE+G+LK  FNLPQG++YE
Sbjct: 915  STDKTVKENEIKFWSQLCPYFVKLPLASQSTLIHNNNIFFIVETGILKATFNLPQGNIYE 974

Query: 1072 TMSNRTCYGRILGKGYLKKSTSPLNIKAETDCIIWLINSEGLDKMKAENXXXXXXXXXXV 1131
            TMSNRTCYG+I G+ + + +   L I+AE D I+W+I+S  L KM+AEN          +
Sbjct: 975  TMSNRTCYGKITGQ-HNESTLKTLTIRAEIDSILWVIDSGSLIKMRAENAELFTELTLLI 1033

Query: 1132 MSVKDDRFNNLLGYALISA 1150
            M+VKD+RF  LLGY L+SA
Sbjct: 1034 MAVKDNRFKELLGYTLVSA 1052

>Suva_7.413 Chr7 (712372..715485) [3114 bp, 1037 aa] {ON} YGR125W
            (REAL)
          Length = 1037

 Score = 1085 bits (2805), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/911 (59%), Positives = 670/911 (73%), Gaps = 19/911 (2%)

Query: 252  QELDEDIIDNDEYSRLLPTPSPSIYDDENALFFSSSNNYDSTDLENNNYISSSIPTTTDV 311
            + +DE+    DEYSRLL +P+ S  DDE       S   D  D     Y   S+  + D+
Sbjct: 134  ENIDEEY--ADEYSRLLLSPASSNVDDERNRALQGSPTSDLEDGHGGGY--QSVHPSHDL 189

Query: 312  TQSTSLSFKDMLTKHSLQILHDIPACIXXXXXXXXXXXSYGMILFPITDSVFGHLGPTGL 371
             +    S     T    +    +PA +           SYGMI+FPIT+ VF HLGPTG+
Sbjct: 190  -RFGPRSVWQWFTSFPSKFAQYLPAAVLGLLLNILDALSYGMIIFPITEPVFSHLGPTGI 248

Query: 372  SMFYISTIISQLVYSGGFSAFPSGLGGEMIEIVPFFHTMALTVKNSIPSKDQNEIITTTI 431
            SMFYISTIISQ VYSGG+S+FPSG+G EMIEI PF+HTMAL +K ++   D +EIITTTI
Sbjct: 249  SMFYISTIISQSVYSGGWSSFPSGVGSEMIEITPFYHTMALGIKEALVGSD-DEIITTTI 307

Query: 432  FCYVISCIFTGIVFFCLGKFKLGKLVGFFPRHILIGCIGGVGYFLIVTGIEVTTRVKKLE 491
            FCYVIS + TG+VF+ LGK +LGK+VGFFPRHILIGCIGGVGYFLI+TGIEVTTRV K E
Sbjct: 308  FCYVISSMLTGVVFYVLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITGIEVTTRVAKFE 367

Query: 492  YSLEFLLSVITNMSTLFKLVLPISLSVLLNILQKIYSHSLLLPSFYIITFIAFHFIVALV 551
            YS  F+  + TN  TL K +LP+ L+V+L   Q+ + +SL+LP+FYI+T + FHFIVA++
Sbjct: 368  YSWPFVSGLFTNYDTLAKWLLPVLLTVVLIGTQRCFKNSLVLPTFYILTLVLFHFIVAII 427

Query: 552  PNLSLDSLRATGWIFPVAESSDTWYSHYKYFNFFNCHWDLVFKQIPTMFALTFFGILHVP 611
            P LSLD+LR +GWIFP+A S   WY HYK FN    HW LV +QIPTM ALTFFGILHVP
Sbjct: 428  PTLSLDTLRDSGWIFPIASSDSKWYDHYKLFNIHKVHWTLVLQQIPTMMALTFFGILHVP 487

Query: 612  INVPALAMSVQMDKYDVDKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASAG 671
            INVPALAMS+QMDKYDVDKELIAHGYSN  SGL GSVQNYLVYTNSVLFIRAG +++ AG
Sbjct: 488  INVPALAMSLQMDKYDVDKELIAHGYSNFFSGLLGSVQNYLVYTNSVLFIRAGADSSFAG 547

Query: 672  LVLAGFTAIILFIGPVIISFIPVCIVGSLIFLLGWELIVEALLDTWGKVTKFEYITIMII 731
             +L   T  I+ IGPVIISFIP+CIVGSLIFLLG+EL+VEAL+DTW K+ +FEY+T++II
Sbjct: 548  FLLVALTVCIMVIGPVIISFIPICIVGSLIFLLGYELLVEALVDTWSKLNRFEYLTVVII 607

Query: 732  VFTMGIYDFVLGILVGILIACFSFLVDSTKLQTVNGEFNGTVAKSTVYRDYVQSQFLSGI 791
            VFTMGI+DFVLGI+VGILIACFSFLVDSTKLQTVNGE+NG VAKSTVYRDYVQ++FL GI
Sbjct: 608  VFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTVNGEYNGNVAKSTVYRDYVQTKFLDGI 667

Query: 792  AEQIYVLKLQNVLFFGTIISIEEKIDMLLEISDNDSSKRRIKYLILDLKNVNSDNIDYSA 851
             EQIYVLKLQNVLFFGTIISIEEKI+ LLEIS+ DS+KRRIKYLILD KN+N+DNIDYSA
Sbjct: 668  GEQIYVLKLQNVLFFGTIISIEEKIERLLEISNKDSTKRRIKYLILDFKNINADNIDYSA 727

Query: 852  AEGFNRIKRFTQSKRIQLIISSIKDTDKIYKMFXXXXXXXXXXXFSDLNGALEWCENEFL 911
            AEGFNRIKRFT++KRI+LIISSIK+ D IY  F           F+DLNGALEWCENEFL
Sbjct: 728  AEGFNRIKRFTETKRIKLIISSIKERDHIYNAFNNVGLLNDVELFADLNGALEWCENEFL 787

Query: 912  YQYRQVK------------NXXXXXXXXXXTSRDVVRTGYLSTSVSNTLNDRKSSGNLPI 959
            +QY+Q++            N           ++ + R+G +  +     +  +   +LP 
Sbjct: 788  FQYKQLREKAKKRLEERKQNNVVSAIMAATQNKKIDRSG-IDLNKGGNRDQARHLMSLPT 846

Query: 960  NTPRNHQMVSVAKNIFQNIEQPVRSFSTNLNKSIPVLELLVFALKQYRSDIFSDDNKVRD 1019
            NTPRNHQM+SVA+N+F N EQ V++      +  PVL +L+FALKQYR DI S+  KVR+
Sbjct: 847  NTPRNHQMLSVAQNVFANDEQAVKNLKKEYKEDEPVLPILLFALKQYRPDIVSEVQKVRE 906

Query: 1020 KEVEFWSQLCPYFTKQPLANKTSLLHNNNVFFIVESGVLKMEFNLPQGSVYETMSNRTCY 1079
            KE++FW+QLCPYF+++ LA+++ LLH +NVFF++E+G+LK  + LPQGS+YE MSN TC+
Sbjct: 907  KEIKFWAQLCPYFSRRRLASQSLLLHADNVFFLIETGMLKAVYELPQGSLYEIMSNGTCF 966

Query: 1080 GRILGKGYLKKSTSPLNIKAETDCIIWLINSEGLDKMKAENXXXXXXXXXXVMSVKDDRF 1139
            G+I+  G        L I+ ETD I+W+I+S  L KMK EN          +M +KD RF
Sbjct: 967  GKIIAPGNTMPREQKLTIETETDSILWVIDSSSLKKMKEENLALYVEVTLMIMCIKDTRF 1026

Query: 1140 NNLLGYALISA 1150
              LLGY L+SA
Sbjct: 1027 KELLGYTLVSA 1037

 Score = 36.6 bits (83), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 52/133 (39%), Gaps = 46/133 (34%)

Query: 21  EAISISLGLQEQQGXXXXXXXXXXXXIHGTLNNSRQRRKPSISLDPTLSRNIGARSFNCG 80
           EAI++SLG+  Q                   + ++  R  + ++ P L      RS+  G
Sbjct: 16  EAITVSLGINYQDS-----------------SKNKIHRASASTMSPPL-----CRSYMSG 53

Query: 81  AFLSRSIDNNLPTTDMXXXXXXXXXXXXXXXTHGLNSNNDHLPVINPFPKSSIHGSDNLH 140
            F   S   N                         N ++  LP  N      IHGS+NLH
Sbjct: 54  FFTGGSSPMN------------------------YNMSDPKLPFSNKQHPKVIHGSENLH 89

Query: 141 KRTAEISNEFNNS 153
           ++TA++SNEF +S
Sbjct: 90  RQTAQLSNEFCSS 102

>YGR125W Chr7 (742325..745435) [3111 bp, 1036 aa] {ON} Putative
            protein of unknown function; deletion mutant has
            decreased rapamycin resistance but normal wormannin
            resistance; green fluorescent protein (GFP)-fusion
            protein localizes to the vacuole
          Length = 1036

 Score = 1071 bits (2769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/937 (57%), Positives = 682/937 (72%), Gaps = 47/937 (5%)

Query: 242  NGGIVNRLPIQELDEDIID--NDEYSRLLPTPSPSIYDDENALFFSSSNNYDSTDLENNN 299
            NG   +   ++ ++E+I +  +DEYSRLL +P+ S  DD+                 N  
Sbjct: 119  NGDRKDDQSMRTIEENIDEEYSDEYSRLLLSPASSNVDDD----------------RNRG 162

Query: 300  YISSSIPTTTD--------VTQSTSLSFK-----DMLTKHSLQILHDIPACIXXXXXXXX 346
              +SS+P   D        +  S +L F+      M T    +  H +PA +        
Sbjct: 163  LQNSSLPELEDGYAGGYQSLRPSHNLRFRPRNLWHMCTSFPSKFAHYLPAAVLGLLLNIL 222

Query: 347  XXXSYGMILFPITDSVFGHLGPTGLSMFYISTIISQLVYSGGFSAFPSGLGGEMIEIVPF 406
               SYGMI+FPIT+ VF HLGPTG+SMFYISTIISQ VYSGG+S+FPSG+G EMIEI PF
Sbjct: 223  DALSYGMIIFPITEPVFSHLGPTGISMFYISTIISQAVYSGGWSSFPSGIGSEMIEITPF 282

Query: 407  FHTMALTVKNSIPSKDQNEIITTTIFCYVISCIFTGIVFFCLGKFKLGKLVGFFPRHILI 466
            +HTMAL +K ++   D +EIITTTIFCYVIS + TG+VF+ LGK +LGK+VGFFPRHILI
Sbjct: 283  YHTMALAIKEALAGND-DEIITTTIFCYVISSMLTGVVFYALGKLRLGKIVGFFPRHILI 341

Query: 467  GCIGGVGYFLIVTGIEVTTRVKKLEYSLEFLLSVITNMSTLFKLVLPISLSVLLNILQKI 526
            GCIGGVGYFLI+TGIEVTTRV K EYS  F   + T+  TL K +LP+ L+V+L   Q+ 
Sbjct: 342  GCIGGVGYFLIITGIEVTTRVAKFEYSWPFFSGLFTDYDTLAKWLLPVLLTVVLIGTQRY 401

Query: 527  YSHSLLLPSFYIITFIAFHFIVALVPNLSLDSLRATGWIFPVAESSDTWYSHYKYFNFFN 586
            + +SL+LPSFYI+T + FHFIVA++P LSLD+LR  GWIFP+A S   WY HY+ FN   
Sbjct: 402  FKNSLVLPSFYILTLVLFHFIVAIIPTLSLDALRQAGWIFPIANSDSKWYDHYRLFNVHK 461

Query: 587  CHWDLVFKQIPTMFALTFFGILHVPINVPALAMSVQMDKYDVDKELIAHGYSNLISGLFG 646
             HW LV +QIPTM ALTFFGILHVPINVPALAMS+QMDKYDVD+ELIAHGYSN  SGL G
Sbjct: 462  VHWSLVLQQIPTMMALTFFGILHVPINVPALAMSLQMDKYDVDRELIAHGYSNFFSGLLG 521

Query: 647  SVQNYLVYTNSVLFIRAGGNTASAGLVLAGFTAIILFIGPVIISFIPVCIVGSLIFLLGW 706
            SVQNYLVYTNSVLFIRAG ++  AG +L   T  I+ IGPVIISFIP+CIVGSLIFLLG+
Sbjct: 522  SVQNYLVYTNSVLFIRAGADSPFAGFLLIALTICIMIIGPVIISFIPICIVGSLIFLLGY 581

Query: 707  ELIVEALLDTWGKVTKFEYITIMIIVFTMGIYDFVLGILVGILIACFSFLVDSTKLQTVN 766
            EL+VEAL+DTW K+ +FEY+T++IIVFTMGI+DFVLGI+VGILIACFSFLVDSTKLQT+N
Sbjct: 582  ELLVEALVDTWNKLNRFEYLTVVIIVFTMGIFDFVLGIIVGILIACFSFLVDSTKLQTIN 641

Query: 767  GEFNGTVAKSTVYRDYVQSQFLSGIAEQIYVLKLQNVLFFGTIISIEEKIDMLLEISDND 826
            GE+NG VA+STVYRDYVQ++FL GI EQIYVLKLQN+LFFGTIISIEEKI+ LL+IS+ D
Sbjct: 642  GEYNGNVARSTVYRDYVQTKFLDGIGEQIYVLKLQNLLFFGTIISIEEKIERLLQISNKD 701

Query: 827  SSKRRIKYLILDLKNVNSDNIDYSAAEGFNRIKRFTQSKRIQLIISSIKDTDKIYKMFXX 886
            ++KRRIKYLILD KN+N+DNIDYSAAEGFNRIKRFT++KRI+LIISSIK+ D+IY  F  
Sbjct: 702  ATKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTETKRIKLIISSIKERDRIYNAFNN 761

Query: 887  XXXXXXXXXFSDLNGALEWCENEFLYQYRQVKNXXXXXXXXXXTSRDVVRTGYLST---- 942
                     F+DLN ALEWCENEFL+QY+Q++            + +VV     +T    
Sbjct: 762  VGLLNDVELFADLNSALEWCENEFLFQYKQLRKKAKERLEEGKQN-NVVSAVIAATKNKK 820

Query: 943  --SVSNTLNDRKSSGN-------LPINTPRNHQMVSVAKNIFQNIEQPVRSFSTNLNKSI 993
              ++ N LN R S+G+       LP NTPRN+Q++SVA+N+F N EQ V++F        
Sbjct: 821  IDTIGNGLN-RGSNGDTARNLMSLPTNTPRNYQILSVAQNVFVNDEQAVKNFKKEYKDDE 879

Query: 994  PVLELLVFALKQYRSDIFSDDNKVRDKEVEFWSQLCPYFTKQPLANKTSLLHNNNVFFIV 1053
            PVL +L+FALKQYR DI S+  KVR+KE++FW+QLCPYFT++ LA+++ LLH +N+FF+V
Sbjct: 880  PVLPILLFALKQYRPDIISEVQKVREKEIKFWAQLCPYFTRRRLASQSHLLHADNIFFLV 939

Query: 1054 ESGVLKMEFNLPQGSVYETMSNRTCYGRILGKGYLKKSTSPLNIKAETDCIIWLINSEGL 1113
            E+G+LK  + LPQG++YE  SN TC+G+I+  G        L I+ ETD ++W+I+S  L
Sbjct: 940  ETGMLKATYELPQGTLYEIFSNGTCFGKIIAPGNAMPREQKLTIETETDSVLWVIDSSSL 999

Query: 1114 DKMKAENXXXXXXXXXXVMSVKDDRFNNLLGYALISA 1150
            +K+K +N          VM +KD RF  LLGY L+SA
Sbjct: 1000 NKLKEDNLALYVEVALMVMCIKDTRFKELLGYTLVSA 1036

 Score = 40.8 bits (94), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 27/38 (71%)

Query: 116 NSNNDHLPVINPFPKSSIHGSDNLHKRTAEISNEFNNS 153
           N ++  LP+ N      IHGS+NLH++TA++SNEF +S
Sbjct: 64  NLSDSKLPISNKQHPKVIHGSENLHRQTAQLSNEFCSS 101

>CAGL0I10626g Chr9 complement(1048818..1052030) [3213 bp, 1070 aa]
            {ON} similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125w
          Length = 1070

 Score = 1056 bits (2730), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/1044 (52%), Positives = 703/1044 (67%), Gaps = 77/1044 (7%)

Query: 122  LPVINPFPKSSIHGSDNLHKRTAEISNEFNNSXXXXXXXXXXXXXXXIPSTAQSSNNLND 181
            LPV N F   +IH  + LH++TA I+ EF++                 PS+ +   NL D
Sbjct: 89   LPVSNKFGSRAIHEQNKLHRQTAAIAEEFDDGTIGES-----------PSSLKEYLNLLD 137

Query: 182  SNDFMIELDGXXXXXXXXXIVSSELPPTATSMFNNTNSTATSVQSLKIGNNEILKTISGD 241
                  ELD          +++    P +    N   +T   ++   +     L T S  
Sbjct: 138  EAQEE-ELDLRNRRDLDNDLITDNKTPVS---INLKRATDPELEQQTVA----LLTPSSS 189

Query: 242  NGGIVNRLPIQELDEDIIDNDEYSRLLPTPSPSIYDDENALFFSSSNNYDSTDLENNNYI 301
            N                  ND Y  + P        +EN  F S+++NY+    + + Y 
Sbjct: 190  N------------------NDNYGSVSP--------EEN--FLSATSNYE----QESTYQ 217

Query: 302  S-SSIPTTTDVTQSTSLSFKDMLTKHSLQILHDIPACIXXXXXXXXXXXSYGMILFPITD 360
            S + +P+       TS + K  +T    ++ + +PA I           SYGMI+FPIT+
Sbjct: 218  SITVVPSAGFRQMPTSTTAKAWMTLK--RVTNYMPAAILGLLLNILDALSYGMIIFPITE 275

Query: 361  SVFGHLGPTGLSMFYISTIISQLVYSGGFSAFPSGLGGEMIEIVPFFHTMALTVKNSIPS 420
             +F  LGPTG+SMFYISTIISQ +YS G+S+FPSG+G EMIEI PF+HTMAL +  ++P 
Sbjct: 276  PIFAQLGPTGISMFYISTIISQFIYSSGWSSFPSGIGSEMIEITPFYHTMALAISQALPG 335

Query: 421  KDQNEIITTTIFCYVISCIFTGIVFFCLGKFKLGKLVGFFPRHILIGCIGGVGYFLIVTG 480
            +D +EIITTTIFCYVIS + TG+ F+ LGK +LGK+VGFFPRHILIGCIGGVGYFLI+TG
Sbjct: 336  RD-DEIITTTIFCYVISSVITGLTFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLIITG 394

Query: 481  IEVTTRVKKLEYSLEFLLSVITNMSTLFKLVLPISLSVLLNILQKIYSHSLLLPSFYIIT 540
            +EVTTR+ K EYS+ FL  +  + S LFK +LP  L+++L + QK + +SL+LPSFYIIT
Sbjct: 395  LEVTTRIAKFEYSIPFLTKLFLDSSMLFKWLLPTILTIILIVTQKCFKNSLVLPSFYIIT 454

Query: 541  FIAFHFIVALVPNLSLDSLRATGWIFPVAESSDTWYSHYKYFNFFNCHWDLVFKQIPTMF 600
             I FHF+VA+ PNLSL  LR TGWIFP  E S  WY HY+YF+    HW LV KQIPTM 
Sbjct: 455  LILFHFVVAIAPNLSLHQLRKTGWIFPAPEVSSKWYDHYRYFDIGKAHWSLVVKQIPTML 514

Query: 601  ALTFFGILHVPINVPALAMSVQMDKYDVDKELIAHGYSNLISGLFGSVQNYLVYTNSVLF 660
            ALTFFGILHVPINVPALAMS+QMDKYDVDKELIAHGYSN  SGLFGSVQNYLVYTNSVLF
Sbjct: 515  ALTFFGILHVPINVPALAMSLQMDKYDVDKELIAHGYSNFFSGLFGSVQNYLVYTNSVLF 574

Query: 661  IRAGGNTASAGLVLAGFTAIILFIGPVIISFIPVCIVGSLIFLLGWELIVEALLDTWGKV 720
            IRAG ++A AG VL   T +++ IGPVIISFIP+CIVGSLIFLLG+EL+VEA++D +GKV
Sbjct: 575  IRAGADSAIAGYVLIVLTIMVMVIGPVIISFIPICIVGSLIFLLGYELLVEAMIDPFGKV 634

Query: 721  TKFEYITIMIIVFTMGIYDFVLGILVGILIACFSFLVDSTKLQTVNGEFNGTVAKSTVYR 780
            T FEY TI IIV TMGI+DFVLGI+VGILIACFSFLVDSTKLQTVNGEF+GTVAKSTVYR
Sbjct: 635  TTFEYATIGIIVLTMGIFDFVLGIVVGILIACFSFLVDSTKLQTVNGEFDGTVAKSTVYR 694

Query: 781  DYVQSQFLSGIAEQIYVLKLQNVLFFGTIISIEEKIDMLLEISDNDSSKRRIKYLILDLK 840
            D+ Q++FLS I EQIYVLKLQN+LFFGTIISIEEKI+ LLEISDND SK RIK+LILD K
Sbjct: 695  DFTQTRFLSQIGEQIYVLKLQNILFFGTIISIEEKIERLLEISDNDVSKHRIKFLILDFK 754

Query: 841  NVNSDNIDYSAAEGFNRIKRFTQSKRIQLIISSIKDTDKIYKMFXXXXXXXXXXXFSDLN 900
            N+N+DNIDYSAAEGFNRIKR+T++KRI+LIIS+I+++D+IY +F           F+DLN
Sbjct: 755  NINADNIDYSAAEGFNRIKRYTEAKRIKLIISTIRESDRIYHVFNQVGLLQDIELFNDLN 814

Query: 901  GALEWCENEFLYQYRQVKNXXXXXXXXXXTSRDVVRTGYLSTSVSNTLN--DRKSSGNLP 958
             ALEWCENEFLYQY++++                 R+  ++ ++ N L   D+ +    P
Sbjct: 815  SALEWCENEFLYQYKELREKARNKLQR--------RSKNINAAIGNQLRRYDQTNKNQGP 866

Query: 959  I------------NTPRNHQMVSVAKNIFQNIEQPVRSFSTNLNKSIPVLELLVFALKQY 1006
                         NTPRN+Q+VS A+  F N +Q      T L    P+L++L+FALK Y
Sbjct: 867  TSSLMQNLMSLSNNTPRNYQLVSAAQQAFSNEQQISTEIDTKLKIPDPLLKVLLFALKLY 926

Query: 1007 RSDIFSDDNKVRDKEVEFWSQLCPYFTKQPLANKTSLLHNNNVFFIVESGVLKMEFNLPQ 1066
            R +I S D + R  EVEFW QLCPYFT++     T+ LHNNN FF+V++G+LK+ +NLP 
Sbjct: 927  RPNIVSMDTEKRTDEVEFWKQLCPYFTRKVFTANTTFLHNNNFFFLVDAGILKVIYNLPA 986

Query: 1067 GSVYETMSNRTCYGRILGKGYLKKSTSPLNIKAETDCIIWLINSEGLDKMKAENXXXXXX 1126
            GSVYET+SN TCYG+IL K   +     L ++ ETD I+W+I+ + ++ MK +N      
Sbjct: 987  GSVYETLSNGTCYGKILSKRDNENINQNLRVQVETDTILWIIDEKSMEIMKMDNIVLYTE 1046

Query: 1127 XXXXVMSVKDDRFNNLLGYALISA 1150
                +++++D RF  LLGY L+SA
Sbjct: 1047 LVLLILAIRDTRFKELLGYTLVSA 1070

>KAFR0C01910 Chr3 (382140..385202) [3063 bp, 1020 aa] {ON} Anc_3.485
            YGR125W
          Length = 1020

 Score = 1050 bits (2715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 531/914 (58%), Positives = 655/914 (71%), Gaps = 38/914 (4%)

Query: 245  IVNRLPIQELDEDIIDNDEYSRLLPTPSPSIYDDENALFFSSSNNYDSTDLENNNYISSS 304
            +V   P  E++E     DE SRLL TPS             SSN   S+  E   +  SS
Sbjct: 135  VVLSTPADEVEE----QDESSRLLLTPS-------------SSNAEVSSIAEGLRHHYSS 177

Query: 305  IPTTTD----VTQSTSLSFKDMLTKHSLQILHDIPACIXXXXXXXXXXXSYGMILFPITD 360
            I +T D    + +    +  + L+      L   PA +           SYGMI+FPI++
Sbjct: 178  IESTKDNNMPIEEQQDNTINEKLSTFFYNTLQYFPASVLGLLLNILDALSYGMIIFPISE 237

Query: 361  SVFGHLGPTGLSMFYISTIISQLVYSGGFSAFPSGLGGEMIEIVPFFHTMALTVKNSIPS 420
             +F HLGPTG+SMFYISTII Q +YS G+S+FPS +G EMIEI PFFHTMA  +  S+P 
Sbjct: 238  PIFSHLGPTGMSMFYISTIICQFIYSSGWSSFPSCIGSEMIEITPFFHTMAFAIMRSLPG 297

Query: 421  KD-QNEIITTTIFCYVISCIFTGIVFFCLGKFKLGKLVGFFPRHILIGCIGGVGYFLIVT 479
            ++ Q+ IITTTIFCYVIS +FTG+ F  LGK +LGK+VGFFPRHILIGCIGGVGYFL++T
Sbjct: 298  EENQDAIITTTIFCYVISSMFTGLTFLTLGKLRLGKIVGFFPRHILIGCIGGVGYFLLIT 357

Query: 480  GIEVTTRVKKLEYSLEFLLSVITNMSTLFKLVLPISLSVLLNILQKIYSHSLLLPSFYII 539
            GIEVTTR+ K EYSL  +  + T+ S L+K + P  L+V+L + QK +  SL+LPSFYI 
Sbjct: 358  GIEVTTRIAKFEYSLPLIKELFTDTSMLWKWLTPTLLTVVLILTQKCFKRSLVLPSFYIA 417

Query: 540  TFIAFHFIVALVPNLSLDSLRATGWIFPVAESSDTWYSHYKYFNFFNCHWDLVFKQIPTM 599
            T I FHFIVA++P LSL  LR  GWIF     +  WY HYK F+F   HW LVFKQIPTM
Sbjct: 418  TLILFHFIVAIIPRLSLTQLREAGWIFSNTAPNSAWYDHYKLFDFHKVHWLLVFKQIPTM 477

Query: 600  FALTFFGILHVPINVPALAMSVQMDKYDVDKELIAHGYSNLISGLFGSVQNYLVYTNSVL 659
             ALTFFGILHVPINVPALAMSVQMDKYDVDKELIAHG SNL+SG+FGS+QNYLVYTNSVL
Sbjct: 478  LALTFFGILHVPINVPALAMSVQMDKYDVDKELIAHGLSNLVSGMFGSIQNYLVYTNSVL 537

Query: 660  FIRAGGNTASAGLVLAGFTAIILFIGPVIISFIPVCIVGSLIFLLGWELIVEALLDTWGK 719
            FIRAG ++  AG +L   T +++ IGPVIISFIP+CIVGSLIFLLG+EL+VEALLDTW K
Sbjct: 538  FIRAGADSPFAGYLLIFLTIVVMLIGPVIISFIPICIVGSLIFLLGYELLVEALLDTWDK 597

Query: 720  VTKFEYITIMIIVFTMGIYDFVLGILVGILIACFSFLVDSTKLQTVNGEFNGTVAKSTVY 779
            +T FEY+T+++IV TMGI DFVLGI+VGILIACF FL+DS+KLQT+NGEF+G VAKSTV 
Sbjct: 598  LTTFEYVTVVVIVLTMGIVDFVLGIIVGILIACFKFLIDSSKLQTINGEFSGKVAKSTVN 657

Query: 780  RDYVQSQFLSGIAEQIYVLKLQNVLFFGTIISIEEKIDMLLEISDNDSSKRRIKYLILDL 839
            RD +QS+FL+GI +QIYVLKLQN+LFFGTIISIEEKID LLE+SD +SSKR+IKYLILD 
Sbjct: 658  RDLIQSKFLNGIGDQIYVLKLQNLLFFGTIISIEEKIDKLLEMSDRNSSKRQIKYLILDF 717

Query: 840  KNVNSDNIDYSAAEGFNRIKRFTQSKRIQLIISSIKDTDKIYKMFXXXXXXXXXXXFSDL 899
            +N+N+DNIDYSAAEGFNRIKR T+SK IQLIISSIK  D+IY  F           F+DL
Sbjct: 718  RNINADNIDYSAAEGFNRIKRLTESKNIQLIISSIKVRDRIYNSFNKVGLLVGVELFNDL 777

Query: 900  NGALEWCENEFLYQYRQVKNXXXXXXXXXXTSRDVVRTGYLSTSVSNTLNDRKSSGNLPI 959
            NGALEWCENEFLYQY+ ++             R  ++    +T  S+    + S+  L I
Sbjct: 778  NGALEWCENEFLYQYKMIRE------------RIKIKNVKTATHSSDGNLSKPSAMTLSI 825

Query: 960  NTPRNHQMVSVAKNIFQNIEQPVRSFSTNLNKSIPVLELLVFALKQYRSDIFSDDNKVRD 1019
            NTPRN+Q+ SVA+NIF+N EQ V           PVL LL+FALKQYR DI S D   + 
Sbjct: 826  NTPRNYQIYSVAQNIFKNEEQTVDRLKNRFQDQTPVLPLLLFALKQYRPDIVSVDKVKKG 885

Query: 1020 KEVEFWSQLCPYFTKQPLANKTSLLHNNNVFFIVESGVLKMEFNLPQGSVYETMSNRTCY 1079
            KE+EFWSQL PYF+K+ +A+++ L H NN+FF+VE GVLK+ F+LPQG VYETMS R CY
Sbjct: 886  KEIEFWSQLAPYFSKKRIASQSILYHGNNIFFLVEIGVLKVTFDLPQGKVYETMSKRACY 945

Query: 1080 GRILGKGYLKKSTSP----LNIKAETDCIIWLINSEGLDKMKAENXXXXXXXXXXVMSVK 1135
            G+I+GK  + ++ +P    + IK E D +IW+I+S  L KMK EN          VM++K
Sbjct: 946  GKIMGKIPVSEADAPSSQAMIIKTEADTVIWIIDSSALKKMKDENIELYLELVLLVMTIK 1005

Query: 1136 DDRFNNLLGYALIS 1149
            D RF +LLG+AL+S
Sbjct: 1006 DIRFKSLLGHALVS 1019

 Score = 33.5 bits (75), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 57/149 (38%), Gaps = 54/149 (36%)

Query: 8   SDNNSNRERNKLSEAISISLGLQEQQGXXXXXXXXXXXXIHGT---LNNSRQRRKPSISL 64
           S++    +R  LS++IS SLGLQ+Q+             I GT   L+NS+         
Sbjct: 7   SNDARASKRLSLSDSISRSLGLQDQESN-----------IAGTDNELSNSKS-------- 47

Query: 65  DPTLSRNIGARSFNCGAFLSRSIDNNLPTTDMXXXXXXXXXXXXXXXTHGLNSNNDHLPV 124
                 N  +RS+  G   S +    L T                          + LP+
Sbjct: 48  ------NYLSRSYMYGLLPSATPVEELET--------------------------NTLPL 75

Query: 125 INPFPKSSIHGSDNLHKRTAEISNEFNNS 153
            N     SIH S  LHK+TA I  +FN S
Sbjct: 76  SNDLRNKSIHQSRILHKQTAAICEDFNES 104

>Kpol_480.18 s480 complement(36794..39967) [3174 bp, 1057 aa] {ON}
            complement(36794..39967) [3174 nt, 1058 aa]
          Length = 1057

 Score = 1048 bits (2709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/888 (58%), Positives = 661/888 (74%), Gaps = 18/888 (2%)

Query: 266  RLLPTPSPSIYDDENALFFSSSNNYDSTDLENNNYISSSIPTTTDVTQSTSLSFKDMLTK 325
            R L TPS SI  +E    F   + YD     NN+Y       +    QS  L+     TK
Sbjct: 185  RALLTPSSSIVGNE----FDLESTYDEI---NNDY------NSILRIQSRELTSSSFATK 231

Query: 326  HSLQILHDIPACIXXXXXXXXXXXSYGMILFPITDSVFGHLGPTGLSMFYISTIISQLVY 385
              L++L+ +PA I           SYGMI+FPIT+ +F  LGPTG+SMFYISTI+ QLV 
Sbjct: 232  -GLELLNYLPAAILGLLLNILDALSYGMIIFPITEPLFSGLGPTGISMFYISTIVCQLVL 290

Query: 386  SGGFSAFPSGLGGEMIEIVPFFHTMALTVKNSIPSKDQNEIITTTIFCYVISCIFTGIVF 445
            SGGFS+FP G+G EMIEI PF+HTMA  +K+++P++D NE+ITTTIFCYVIS + TG+VF
Sbjct: 291  SGGFSSFPCGIGSEMIEITPFYHTMAFAIKDALPNQD-NEVITTTIFCYVISSVVTGLVF 349

Query: 446  FCLGKFKLGKLVGFFPRHILIGCIGGVGYFLIVTGIEVTTRVKKLEYSLEFLLSVITNMS 505
            F LGK K+GK+VGFFPRHILIGCIGGVGYFLI+TGIEV+TR+ K EY+ EFLLS++TN+ 
Sbjct: 350  FMLGKLKMGKIVGFFPRHILIGCIGGVGYFLIITGIEVSTRIGKFEYNWEFLLSLLTNLD 409

Query: 506  TLFKLVLPISLSVLLNILQKIYSHSLLLPSFYIITFIAFHFIVALVPNLSLDSLRATGWI 565
            TL K +LP  L++ L ++Q+   +SL+LPSFYI+T I FHFIVA++PNLSLD LR  GWI
Sbjct: 410  TLGKWLLPTLLTLSLILIQRQVQNSLVLPSFYILTIILFHFIVAILPNLSLDHLRENGWI 469

Query: 566  FPVAESSDTWYSHYKYFNFFNCHWDLVFKQIPTMFALTFFGILHVPINVPALAMSVQMDK 625
            FPV +S ++WY HYKYFN  + HW LV KQIPTM ALTFFGILHVPINVPALAMS+ MDK
Sbjct: 470  FPVTDSKNSWYDHYKYFNLHDIHWGLVLKQIPTMLALTFFGILHVPINVPALAMSLHMDK 529

Query: 626  YDVDKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASAGLVLAGFTAIILFIG 685
            YDVD+ELIAHGYSNLISGL GSVQNYLVYTNSVLFIRAG +++SAG +L   T +++  G
Sbjct: 530  YDVDRELIAHGYSNLISGLLGSVQNYLVYTNSVLFIRAGADSSSAGFLLVALTVVVMVAG 589

Query: 686  PVIISFIPVCIVGSLIFLLGWELIVEALLDTWGKVTKFEYITIMIIVFTMGIYDFVLGIL 745
             VI+SFIPVCIVGSLIFLLG+EL+VEAL+DT G VT FEYITI+IIVF MGIYDFVLGI+
Sbjct: 590  SVIVSFIPVCIVGSLIFLLGYELMVEALVDTIGTVTSFEYITILIIVFIMGIYDFVLGII 649

Query: 746  VGILIACFSFLVDSTKLQTVNGEFNGTVAKSTVYRDYVQSQFLSGIAEQIYVLKLQNVLF 805
            VGILIAC SF+VD TKL+T+NGE++G VAKSTVYRDY+Q++FL+GI +QIY+LKLQNVLF
Sbjct: 650  VGILIACLSFMVDGTKLETINGEYDGQVAKSTVYRDYIQTKFLNGIRQQIYLLKLQNVLF 709

Query: 806  FGTIISIEEKIDMLLEISDNDSSKRRIKYLILDLKNVNSDNIDYSAAEGFNRIKRFTQSK 865
            FGTIISIEEKID LLEISD D SKRRIKYLILD KN+N+DNIDYSAAEGFNRIKRFTQ K
Sbjct: 710  FGTIISIEEKIDKLLEISDKDPSKRRIKYLILDFKNINADNIDYSAAEGFNRIKRFTQGK 769

Query: 866  RIQLIISSIKDTDKIYKMFXXXXXXXXXXXFSDLNGALEWCENEFLYQYRQVKNXXXXXX 925
            RIQLIISSIK+ DKIY +F           F DLN ALEWCENEFLYQY Q+        
Sbjct: 770  RIQLIISSIKEKDKIYSVFNMVRLLEDVELFDDLNSALEWCENEFLYQYMQLHEKAKDRI 829

Query: 926  XXXXTSRDVVRTGYLSTSVSN---TLNDRKSSGNLPINTPRNHQMVSVAKNIFQNIEQPV 982
                +      + Y S + S+   +  D++   +LPINTPRN+Q++SVA+ +F+N  Q  
Sbjct: 830  HKRISISKDSGSTYFSRNRSDSGLSAADQQMLMSLPINTPRNNQVLSVARKVFKNEAQTA 889

Query: 983  RSFSTNLNKSIPVLELLVFALKQYRSDIFSDDNKVRDKEVEFWSQLCPYFTKQPLANKTS 1042
              F T+     PVL LL+++++ +R D+FS+D  +R+KE+ FW QL PYF +      ++
Sbjct: 890  SKFKTHNETDKPVLSLLLYSIRLFRPDVFSEDVSIREKEINFWGQLSPYFRRSLFPTGST 949

Query: 1043 LLHNNNVFFIVESGVLKMEFNLPQGSVYETMSNRTCYGRILGKGYLKKSTSPLNIKAETD 1102
            L++++N FF+VESGV+++  +LPQG V ETMSNRTCYG+++G      +   +  K ET+
Sbjct: 950  LVNSSNFFFVVESGVVRVTHDLPQGIVSETMSNRTCYGKVVGHRGTVTNLPKIIFKTETE 1009

Query: 1103 CIIWLINSEGLDKMKAENXXXXXXXXXXVMSVKDDRFNNLLGYALISA 1150
             IIW+I+ + + ++K EN          VM++++ R+  L+GY L+SA
Sbjct: 1010 SIIWMIDDDTMSRIKKENLNLYTELLLLVMTIREYRYKGLIGYTLVSA 1057

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 63/153 (41%), Gaps = 36/153 (23%)

Query: 3   YAQQDSDNNSNRERNKLSEAISISLGLQEQQ-GXXXXXXXXXXXXIHGTLNNSRQRRKPS 61
           Y+ QDS N   R R   SEA+S+SLGL EQ  G              G  +N+       
Sbjct: 7   YSGQDSSNR--RVRPSFSEALSVSLGLHEQGIGAGRTRSNLAPNSYSGYNDNT------- 57

Query: 62  ISLDPTLSRNIGARSF-NCGAFLSRSIDNNLPTTDMXXXXXXXXXXXXXXXTHGLNSNND 120
                  + ++  R F   G   + SI +N P+  +                    S  D
Sbjct: 58  -------TSSVSNREFGRIGRSYAGSISSNSPSLYLN------------------TSRTD 92

Query: 121 HLPVINPFPKSSIHGSDNLHKRTAEISNEFNNS 153
            L  I   P  SI G D LH++TAEISN+FN++
Sbjct: 93  ELLPIRKMPSKSILGPDALHRQTAEISNDFNDT 125

>KNAG0B00860 Chr2 complement(156225..159491) [3267 bp, 1088 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1088

 Score = 1046 bits (2706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/919 (57%), Positives = 659/919 (71%), Gaps = 31/919 (3%)

Query: 262  DEYSRLLPTPSPSI---YDDENALFFSSSNNYDSTDLEN-NNYISSSIPTTTDVTQSTS- 316
            DE SRLL TP  S+     D ++L     N    + L   N+   S IPT +  + +   
Sbjct: 171  DENSRLLLTPVSSLSVAISDASSLTPEDYNGRARSPLNGINSTYGSQIPTLSSYSSAGMK 230

Query: 317  -----LSFKDMLTKHSLQILHDIPACIXXXXXXXXXXXSYGMILFPITDSVFGHLGPTGL 371
                  S  D ++  S  I+H +PA I           SYGMI+FPIT+ +F  LGP+GL
Sbjct: 231  IGPPITSKWDYISALSHDIVHYLPASILGLLLNILDALSYGMIIFPITEPIFSQLGPSGL 290

Query: 372  SMFYISTIISQLVYSGGFSAFPSGLGGEMIEIVPFFHTMALTVKNSIPSKDQNEIITTTI 431
            SMFYIST+ISQ  YS G+S+FP G+G EMIE+ PFFHTMALT+  ++  + +NEIITTTI
Sbjct: 291  SMFYISTVISQFTYSSGWSSFPCGIGSEMIEVTPFFHTMALTIMKTLGEERKNEIITTTI 350

Query: 432  FCYVISCIFTGIVFFCLGKFKLGKLVGFFPRHILIGCIGGVGYFLIVTGIEVTTRVKKLE 491
            FCYVIS +FTG+ FF LGK KLGKLVGFFPRHILIGCIGGVGYFL++TGIEV TR+ K E
Sbjct: 351  FCYVISSMFTGLTFFTLGKLKLGKLVGFFPRHILIGCIGGVGYFLLITGIEVCTRIAKFE 410

Query: 492  YSLEFLLSVITNMSTLFKLVLPISLSVLLNILQKIYSHSLLLPSFYIITFIAFHFIVALV 551
            YS+ FLL++ T+  TLF+ +LP  L+++L   Q  + +SL+LPSFYI+T I FHFIVA+V
Sbjct: 411  YSIPFLLNLFTDEKTLFQWLLPTMLTIILIFTQNRFRNSLVLPSFYILTLILFHFIVAIV 470

Query: 552  PNLSLDSLRATGWIFPVAESSDTWYSHYKYFNFFNCHWDLVFKQIPTMFALTFFGILHVP 611
            PNLSL  LR +GWIFPVA S+ TWY HYKYFNF + HW LV KQIPTM ALTFFGILHVP
Sbjct: 471  PNLSLTKLRNSGWIFPVAASNVTWYDHYKYFNFSDVHWALVIKQIPTMMALTFFGILHVP 530

Query: 612  INVPALAMSVQMDKYDVDKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASAG 671
            INVPALAMS+QMDKYDVD+ELIAHGYSN  SGLFGS++NYLVYTNSVLFIRAG ++A AG
Sbjct: 531  INVPALAMSLQMDKYDVDRELIAHGYSNFFSGLFGSIENYLVYTNSVLFIRAGADSALAG 590

Query: 672  LVLAGFTAIILFIGPVIISFIPVCIVGSLIFLLGWELIVEALLDTWGKVTKFEYITIMII 731
             +L   T I++ IGPVIISFIP+CIVGSLIFLLG+EL++EAL+DTWGK+  FEY+T+ II
Sbjct: 591  YILIVLTIIVMLIGPVIISFIPICIVGSLIFLLGYELLMEALVDTWGKLNTFEYVTVGII 650

Query: 732  VFTMGIYDFVLGILVGILIACFSFLVDSTKLQTVNGEFNGTVAKSTVYRDYVQSQFLSGI 791
            + TMGI+DFVLGI+VGILIACF FL+DST LQTVNGEF+G VAKSTVYRD +Q+ FL G+
Sbjct: 651  ILTMGIFDFVLGIIVGILIACFKFLIDSTHLQTVNGEFSGEVAKSTVYRDPIQTTFLDGV 710

Query: 792  AEQIYVLKLQNVLFFGTIISIEEKIDMLLEISDNDSSKRRIKYLILDLKNVNSDNIDYSA 851
             EQIYVLKLQN+LFFGTIISIEEKID LLEIS+NDSSKRRIKYLILD KN+N+DNIDYSA
Sbjct: 711  GEQIYVLKLQNLLFFGTIISIEEKIDKLLEISNNDSSKRRIKYLILDFKNINTDNIDYSA 770

Query: 852  AEGFNRIKRFTQSKRIQLIISSIKDTDKIYKMFXXXXXXXXXXXFSDLNGALEWCENEFL 911
            AEGFNRI+RFTQ+K IQLIISSI++ D IY+ F           F DLN +LEWCENE L
Sbjct: 771  AEGFNRIRRFTQTKGIQLIISSIREKDGIYRAFNNVGLLEDVELFQDLNSSLEWCENELL 830

Query: 912  YQYRQVKNXXXXXXXXXXTSRDVVRTGYLSTSVSNTLNDRK-----SSG--------NLP 958
            + Y +++            + + V    L  S S  ++ R       SG        +LP
Sbjct: 831  HWYNELRTKAKARLRKLNNTANSV-VSRLPVSASKQMDSRAITSADQSGRAAISNLMSLP 889

Query: 959  INTPRNHQMVSVAKNIFQNIEQPVRSFSTNLNKSIPVLELLVFALKQYRSDIFSDDNKVR 1018
             NTPRNHQM++VA+++F+N EQ V S    L    P+L LL+  LKQYR DI S+D   R
Sbjct: 890  TNTPRNHQMLTVAQDVFKNDEQTVSSLRKQLKTKDPLLPLLLLTLKQYRPDIGSNDKLAR 949

Query: 1019 DKEVEFWSQLCPYFTKQPLANKTSLLHNNNVFFIVESGVLKMEFNLPQGSVYETMSNRTC 1078
            DKE+  WS+LCPYF K+ +  +T+L H N +FF+V++GVLK  F LPQG VYETM+NRTC
Sbjct: 950  DKEIAIWSRLCPYFAKKTMMAQTTLQHCNKIFFLVQTGVLKAVFKLPQGCVYETMANRTC 1009

Query: 1079 YGRILGKGYLKKST-------SPLNIKAETDCIIWLINSEGLDKMKAENXXXXXXXXXXV 1131
            YG+I+  G             S L I  ETD  +W+I++  + +++ E+          V
Sbjct: 1010 YGKIIDSGTTVDDADTSNPDFSKLFITTETDSELWVIDAAAMGRLEREDPELFIQLALLV 1069

Query: 1132 MSVKDDRFNNLLGYALISA 1150
            M +KD RF +LLG+ALISA
Sbjct: 1070 MLIKDKRFKDLLGHALISA 1088

>NDAI0G00990 Chr7 complement(205221..208385) [3165 bp, 1054 aa] {ON}
            Anc_3.485 YGR125W
          Length = 1054

 Score = 1045 bits (2702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/919 (57%), Positives = 669/919 (72%), Gaps = 12/919 (1%)

Query: 241  DNGGIVNRLPIQELDE--DIIDNDEYSRLL--PTPSPSIYDDENALFFSSSNNYDSTDLE 296
            DN   ++ +  +E +   D    DE SRLL  P PS S+   EN L   S    ++    
Sbjct: 139  DNEDRIDNILTEEAEPVTDFYPQDENSRLLLSPIPSDSLLAGENLLPSISEQEQETAQRR 198

Query: 297  NNNYISSSIPTTTDVTQSTSLSFKDMLTKHSLQILHDIPACIXXXXXXXXXXXSYGMILF 356
              +   S     ++ T+ +S+           +I+  +PA I           SYGMI+F
Sbjct: 199  RTSAYQSIRHRNSESTEYSSIPTWRKYIATPSEIIQYLPASILGLLLTILDALSYGMIIF 258

Query: 357  PITDSVFGHLGPTGLSMFYISTIISQLVYSGGFSAFPSGLGGEMIEIVPFFHTMALTVKN 416
            PIT+ +F HLGPTG+SMFYISTIISQ ++SGG+S+FP G+G EMIE+ PFFHTMA  +K+
Sbjct: 259  PITEPIFSHLGPTGISMFYISTIISQSIFSGGWSSFPCGIGSEMIEVTPFFHTMAFAIKD 318

Query: 417  SIPSKDQNEIITTTIFCYVISCIFTGIVFFCLGKFKLGKLVGFFPRHILIGCIGGVGYFL 476
            ++P    ++IITTT+FCYVIS + TG+ F+ LGK  LGK+VGFFPRHILIGCIGGVGYFL
Sbjct: 319  ALPEGSNDDIITTTLFCYVISSMLTGLTFYSLGKLHLGKIVGFFPRHILIGCIGGVGYFL 378

Query: 477  IVTGIEVTTRVKKLEYSLEFLLSVITNMSTLFKLVLPISLSVLLNILQKIYSHSLLLPSF 536
            I+TGIEV+TRV K +Y++ F+  + T++ TL++ +LP  L+V+L I QK   +SL+LPSF
Sbjct: 379  IITGIEVSTRVAKFQYTIPFITHLFTDVVTLWQWLLPTLLTVILIIAQKCAQNSLVLPSF 438

Query: 537  YIITFIAFHFIVALVPNLSLDSLRATGWIFPVAESSDTWYSHYKYFNFFNCHWDLVFKQI 596
            YI+T I FHF+VA++P+LSL+ LR +GWIFP A +   WY HYK FN    HW L+ KQI
Sbjct: 439  YILTLILFHFMVAIIPSLSLNQLRDSGWIFPQAATDSKWYDHYKLFNLHKVHWTLILKQI 498

Query: 597  PTMFALTFFGILHVPINVPALAMSVQMDKYDVDKELIAHGYSNLISGLFGSVQNYLVYTN 656
            PTM ALTFFGILHVPINVPALAMS+QMD+YDVDKELIAHG SN +SG+FGS+QNYLVYTN
Sbjct: 499  PTMLALTFFGILHVPINVPALAMSLQMDRYDVDKELIAHGVSNFVSGMFGSIQNYLVYTN 558

Query: 657  SVLFIRAGGNTASAGLVLAGFTAIILFIGPVIISFIPVCIVGSLIFLLGWELIVEALLDT 716
            SVLFIRAG ++A AG +L   T II+ IGPVIISFIP+CIVGSLIFLLG+EL+VEAL+D 
Sbjct: 559  SVLFIRAGADSALAGHILIVLTIIIMIIGPVIISFIPICIVGSLIFLLGYELLVEALVDP 618

Query: 717  WGKVTKFEYITIMIIVFTMGIYDFVLGILVGILIACFSFLVDSTKLQTVNGEFNGTVAKS 776
             GK++KFEYITI+IIVFTMGI+DFVLG++VGILIACFSFL+DSTKLQT+NGEF+GTVAKS
Sbjct: 619  LGKISKFEYITIVIIVFTMGIFDFVLGVIVGILIACFSFLIDSTKLQTINGEFDGTVAKS 678

Query: 777  TVYRDYVQSQFLSGIAEQIYVLKLQNVLFFGTIISIEEKIDMLLEISDNDSSKRRIKYLI 836
            TVYRD +Q++FL+GI EQIYVLKLQN+LFFGTIISIEEKID LLEISD DSSK RIKYLI
Sbjct: 679  TVYRDLIQTKFLNGIGEQIYVLKLQNLLFFGTIISIEEKIDKLLEISDMDSSKHRIKYLI 738

Query: 837  LDLKNVNSDNIDYSAAEGFNRIKRFTQSKRIQLIISSIKDTDKIYKMFXXXXXXXXXXXF 896
            LD KN+N+DNIDYSAAEGFNRIKRFTQ+KRI+LIISSI++ D IY  F           F
Sbjct: 739  LDFKNINADNIDYSAAEGFNRIKRFTQTKRIRLIISSIRERDHIYNAFNNVGLLEGVELF 798

Query: 897  SDLNGALEWCENEFLYQYRQVKNXXXXXXXXXXTSRDVVRTGYLSTSVSNTLNDRKSSGN 956
            +DLN ALEWCENEFL++Y+ ++                +  G  +   +  L   ++  +
Sbjct: 799  NDLNSALEWCENEFLFKYKTLREKTRQKRKNKIDINLAITNGNPTEERNMHLEIPRNIMS 858

Query: 957  LPINTPRNHQMVSVAKNIFQNIEQPVRSFSTNLNKSIPVLELLVFALKQYRSDIFSDDNK 1016
            LP+NTPRN+QM+SVA+N+F+N EQ  ++          VL LL+F LKQYR  I S+D  
Sbjct: 859  LPMNTPRNNQMLSVAQNVFRNEEQAAKALKQQFKNEPSVLPLLLFVLKQYRPRIVSNDKS 918

Query: 1017 VRDKEVEFWSQLCPYFTKQPLANKTSLLHNNNVFFIVESGVLKMEFNLPQGSVYETMSNR 1076
            + +KE++FWSQLCPY +++ L  +++L HNNN FFIVESG+LK  F LP G++YETMSNR
Sbjct: 919  IEEKEIKFWSQLCPYLSERFLVAQSTLKHNNNFFFIVESGILKATFTLPSGTLYETMSNR 978

Query: 1077 TCYGRILGKGYLKKSTSPLN-----IKAETDCIIWLINSEGLDKMKAENXXXXXXXXXXV 1131
            TCYG+ILG       T+ LN     IK ETDC +W+I+ + L +M+AEN          +
Sbjct: 979  TCYGKILGSN---NETTVLNEQDLTIKTETDCNLWVIDMDALTRMRAENLELYIELVLLI 1035

Query: 1132 MSVKDDRFNNLLGYALISA 1150
            MS++D RF  LLGY L+SA
Sbjct: 1036 MSIRDTRFKELLGYTLVSA 1054

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 26/37 (70%)

Query: 116 NSNNDHLPVINPFPKSSIHGSDNLHKRTAEISNEFNN 152
           ++NN+ LP+ N     SIH S NLH++TA IS +FNN
Sbjct: 68  DNNNNTLPIANQHLNKSIHASQNLHRQTAAISEDFNN 104

>ZYRO0C07986g Chr3 complement(609503..612577) [3075 bp, 1024 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1024

 Score = 1025 bits (2650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/901 (57%), Positives = 648/901 (71%), Gaps = 29/901 (3%)

Query: 276  YDDENALFFSSSNNYDSTDLEN---NNYIS----SSIPTTTDV------TQSTSLSFKDM 322
            + D+        N YD+ + EN   ++Y++     ++P  TD          T+ +    
Sbjct: 127  FSDDTTGMEEVRNRYDAMEDENSSLHHYMTHQDYQTLPGGTDEDWTNNNNSQTARASGSS 186

Query: 323  LTKHSLQILHDIPACIXXXXXXXXXXXSYGMILFPITDSVFGHLGPTGLSMFYISTIISQ 382
            + +    +LH  P+ +           SYGMI+FPIT+ +F HLG TGLSMFYISTIISQ
Sbjct: 187  IVQFGQDVLHYFPSAVLGLLLNILDGLSYGMIIFPITEPIFSHLGSTGLSMFYISTIISQ 246

Query: 383  LVYSGGFSAFPSGLGGEMIEIVPFFHTMALTVKNSIPSKDQNEIITTTIFCYVISCIFTG 442
             +YSGG S+F SG+G EMIE+ PFFHTMA  ++++IP +D ++IITTTIFCY IS + TG
Sbjct: 247  CLYSGGLSSFTSGIGSEMIEVTPFFHTMAFAIRDAIPGQD-DDIITTTIFCYAISSVVTG 305

Query: 443  IVFFCLGKFKLGKLVGFFPRHILIGCIGGVGYFLIVTGIEVTTRVKKLEYSLEFLLSVIT 502
            I F+ LGK +LGK+VGFFPRHILIGCIGGVGYFL++TG+ VTTR+ K+EY+ EFL  +  
Sbjct: 306  ITFYLLGKLRLGKIVGFFPRHILIGCIGGVGYFLLITGLGVTTRLAKIEYTWEFLKKLFL 365

Query: 503  NMSTLFKLVLPISLSVLLNILQKIYSHSLLLPSFYIITFIAFHFIVALVPNLSLDSLRAT 562
            +   L+K +LP+ L++LL   QK + +SL+LPSFYI+T I FHF+VA+VP++SLD LR  
Sbjct: 366  DTDILWKWLLPVVLTILLVNTQKCFQNSLVLPSFYIVTLILFHFVVAIVPSISLDQLRDL 425

Query: 563  GWIFPVAESSDTWYSHYKYFNFFNCHWDLVFKQIPTMFALTFFGILHVPINVPALAMSVQ 622
            GWIFP A S D W+ HYK F++   HW+LV  QIPTM ALTFFGILHVPINVPALA+S+ 
Sbjct: 426  GWIFPAATSKDRWFDHYKLFDWHKVHWNLVLAQIPTMLALTFFGILHVPINVPALAISLH 485

Query: 623  MDKYDVDKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASAGLVLAGFTAIIL 682
            MDK+DVDKELIAHGYSN ISG+ GS+QNYLVYTNSVLFIRAG ++  AG +LA  T  ++
Sbjct: 486  MDKFDVDKELIAHGYSNFISGMVGSIQNYLVYTNSVLFIRAGADSPFAGYMLAILTFAVM 545

Query: 683  FIGPVIISFIPVCIVGSLIFLLGWELIVEALLDTWGKVTKFEYITIMIIVFTMGIYDFVL 742
             IGPVI+SFIP+CIVGSLIFLLG+EL+VEALLDT GKVT FEYITI+IIV TMGIYDFVL
Sbjct: 546  VIGPVIVSFIPICIVGSLIFLLGYELLVEALLDTRGKVTNFEYITIVIIVLTMGIYDFVL 605

Query: 743  GILVGILIACFSFLVDSTKLQTVNGEFNGTVAKSTVYRDYVQSQFLSGIAEQIYVLKLQN 802
            G++VGILIACFSFLVDSTKLQT+NGEF+G VA+STV RDYVQS FL+G+ EQIYVLKLQN
Sbjct: 606  GVIVGILIACFSFLVDSTKLQTINGEFDGKVARSTVNRDYVQSNFLNGVGEQIYVLKLQN 665

Query: 803  VLFFGTIISIEEKIDMLLEISDND-SSKRRIKYLILDLKNVNSDNIDYSAAEGFNRIKRF 861
            VLFFGTIISIEEKID LLEI+D+  SSKRRIKYLILD KN+N+DNIDYSAAEGFNRIKRF
Sbjct: 666  VLFFGTIISIEEKIDKLLEITDSKSSSKRRIKYLILDFKNINADNIDYSAAEGFNRIKRF 725

Query: 862  TQSKRIQLIISSIKDTDKIYKMFXXXXXXXXXXXFSDLNGALEWCENEFLYQYRQVKNXX 921
            TQ+KRI+LIISSIK+ D IY +F           F+DLNGALEWCENEFL +Y+++++  
Sbjct: 726  TQTKRIKLIISSIKERDHIYNVFSNVGLLDDVELFNDLNGALEWCENEFLGEYKKLRDRA 785

Query: 922  XXXXXXXXTSRDVVRTG----------YLSTSVSNTLNDRKSSGNLPINTPRNHQMVSVA 971
                         +              +S    + LN R  S +LP+NTPRNHQM+SVA
Sbjct: 786  REKMQHSYNVTSAIEAAAAKKVPTDNNQISKKNLSLLNFRNLS-SLPMNTPRNHQMLSVA 844

Query: 972  KNIFQNIE--QPVRSFSTNLNKSIPVLELLVFALKQYRSDIFSDDNKVRDKEVEFWSQLC 1029
            +N+F + E    +   S N  +  PVL LL+FALK YR +I S D  +R++E + WSQL 
Sbjct: 845  QNMFNDEEDVDALEDESCNDGQQ-PVLPLLLFALKSYRKNITSTDPHLRERETQLWSQLV 903

Query: 1030 PYFTKQPLANKTSLLHNNNVFFIVESGVLKMEFNLPQGSVYETMSNRTCYGRILGKGYLK 1089
            PYF K+ L  ++ LLHN + FF+VESG+LK+  +LPQG VYETMSNRTC G I+G  Y  
Sbjct: 904  PYFVKRRLTTQSILLHNQDFFFVVESGLLKIALDLPQGVVYETMSNRTCCGNIVGSDYKS 963

Query: 1090 KSTSPLNIKAETDCIIWLINSEGLDKMKAENXXXXXXXXXXVMSVKDDRFNNLLGYALIS 1149
                 + I  ETD  +WLI+ +GL K++AEN           + +K  RF  LLGY L+S
Sbjct: 964  SEEHKVTIVTETDTCLWLIDVDGLQKLRAENLQLYTELVLLCLLIKSRRFEQLLGYTLVS 1023

Query: 1150 A 1150
            A
Sbjct: 1024 A 1024

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 58/146 (39%), Gaps = 25/146 (17%)

Query: 10  NNSNRERNKLSEAISISLGLQEQQGXXXXXXXXXXXXIHGTLNNSRQRRKPSISL-DPTL 68
           +  +R R  +S AIS+SLGL  Q               +       Q    SI +  P  
Sbjct: 6   DRPSRNRQSISGAISVSLGLNRQVHRNSDGEFTNYNNTNNNGGRINQNDSSSIEIVSPPF 65

Query: 69  --SRNIGARSFNCGAFLSRSIDNNLPTTDMXXXXXXXXXXXXXXXTHGLNSNNDHLPVIN 126
             S N   RS+  G FLS S   NL                        N ++  LP+  
Sbjct: 66  YNSNNYAGRSYLGGGFLSASPKMNLQQR---------------------NDDSSVLPIDR 104

Query: 127 PFPKSSIHGSDNLHKRTAEISNEFNN 152
              KS IHGS  +H++TAE+SN F++
Sbjct: 105 SRSKS-IHGSQIIHRQTAELSNNFSD 129

>SAKL0F02926g Chr6 complement(245957..249109) [3153 bp, 1050 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1050

 Score = 1015 bits (2624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 574/1146 (50%), Positives = 730/1146 (63%), Gaps = 109/1146 (9%)

Query: 14   RERNKLSEAISISLGLQEQQGXXXXXXXXXXXXIHGTLNNSRQRRKPSISLDPTLSRNIG 73
            + R  +SEAI+ISLGL                    +  N R    P  S +  L R+  
Sbjct: 5    KNRKSISEAITISLGLHSDN------------IKQPSQANRRSSMNPENSSNYYLGRSY- 51

Query: 74   ARSFNCGAFLSRSIDNNLPTTDMXXXXXXXXXXXXXXXTHGLNSNNDHLPVINPFPKSSI 133
              SF+  +FL R                              +++  H+  ++     SI
Sbjct: 52   VGSFSSPSFLQRES----------------------------SADTGHILSLHKDASKSI 83

Query: 134  HGSDNLHKRTAEISNEFNNSXXXXXXXXXXXXXXXIPSTAQSSNNLNDSNDFMIELDGXX 193
            H S  LH++TA +SN F++                      SS+  +D      E+D   
Sbjct: 84   HESVKLHRQTAALSNNFDD----------------------SSDGKSD------EIDVAA 115

Query: 194  XXXXXXXIVSSELPPTATSMFNNTNSTATSVQSLKIGNNEILKTISGDNGGI--VNRL-- 249
                    +  EL     S  N+ N+   + Q   I  +E    I+ +N G+    RL  
Sbjct: 116  SQEFQNEALQRELSLENGSYSNSNNNNNNNNQ---IAYSE--DAITQENNGLNECTRLLS 170

Query: 250  PIQELDEDIIDNDEYSRLLPTPSPSIYDDEN-----ALFFSSSNNYDSTDLENNNYISSS 304
            P      D+      + L  +P  S Y+ E      A    SS  YD    + +N    +
Sbjct: 171  PTSAAATDLEYGTSPTNL--SPPSSQYEQEQYVSLVADHSPSSAVYDQATGDGDN----A 224

Query: 305  IPTTTDVTQSTSLSFKDMLTKHSLQILHDIPACIXXXXXXXXXXXSYGMILFPITDSVFG 364
              T   + Q    S+ D     S++ L+ +PA I           SYGMI+FPIT+ VF 
Sbjct: 225  FNTYHSLRQPVVRSYYDYAKGWSIKTLNYMPAVILGLLLNVLDALSYGMIIFPITEPVFS 284

Query: 365  HLGPTGLSMFYISTIISQLVYSGGFSAFPSGLGGEMIEIVPFFHTMALTVKNSIPSKDQN 424
            HLGPTGLSMFY+STI+SQLVYS GFSAF +G+G EMIEI PFFHTMAL++ NS+P  D +
Sbjct: 285  HLGPTGLSMFYVSTILSQLVYSCGFSAFGNGIGSEMIEITPFFHTMALSIMNSLPGHD-D 343

Query: 425  EIITTTIFCYVISCIFTGIVFFCLGKFKLGKLVGFFPRHILIGCIGGVGYFLIVTGIEVT 484
            EII+TTI CY +S IFTG+ FF LGK +LGK+VGFFPRHILIGC+GGVGYFL++TGIEV 
Sbjct: 344  EIISTTIVCYALSSIFTGLAFFLLGKLRLGKIVGFFPRHILIGCVGGVGYFLLITGIEVC 403

Query: 485  TRVKKLEYSLEFLLSVITNMSTLFKLVLPISLSVLLNILQKIYSHSLLLPSFYIITFIAF 544
            TRV K EYS  FL  +  N   L K +LP+ L++ L + Q  +++SL+LPSFYIIT   F
Sbjct: 404  TRVSKFEYSWPFLRELFYNTEVLGKWMLPLILTLSLIVTQHYFNNSLVLPSFYIITLALF 463

Query: 545  HFIVALVPNLSLDSLRATGWIFPVAESSDTWYSHYKYFNFFNCHWDLVFKQIPTMFALTF 604
            HF+VA+VPNLSL+SLR +GWIFP+A SS+ WY  YK ++F N HW LV KQ+PTM ALTF
Sbjct: 464  HFVVAIVPNLSLNSLRESGWIFPMAGSSNHWYDFYKLYDFQNVHWTLVLKQVPTMLALTF 523

Query: 605  FGILHVPINVPALAMSVQMDKYDVDKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAG 664
            FGILHVPINVPALAMS+ MDK+DVDKELIAHGYSNL+SG  GS+QNYLVYTNS LFIRAG
Sbjct: 524  FGILHVPINVPALAMSIGMDKFDVDKELIAHGYSNLLSGFSGSIQNYLVYTNSFLFIRAG 583

Query: 665  GNTASAGLVLAGFTAIILFIGPVIISFIPVCIVGSLIFLLGWELIVEALLDTWGKVTKFE 724
             +++ AG +LA  T +++ IGPVIISFIP+CIVGSLIFLLG+ELI EAL DTWGK+ +FE
Sbjct: 584  SDSSWAGFLLALGTFVVMIIGPVIISFIPICIVGSLIFLLGYELIKEALFDTWGKLNRFE 643

Query: 725  YITIMIIVFTMGIYDFVLGILVGILIACFSFLVDSTKLQTVNGEFNGTVAKSTVYRDYVQ 784
            YITI+IIVFTMG++DFVLGI+VGILIACFSFLVDSTKLQT+NGEFNG VA+STVYRDY+Q
Sbjct: 644  YITIVIIVFTMGVFDFVLGIIVGILIACFSFLVDSTKLQTINGEFNGQVARSTVYRDYIQ 703

Query: 785  SQFLSGIAEQIYVLKLQNVLFFGTIISIEEKIDMLLEISDNDSSKRRIKYLILDLKNVNS 844
            ++FL+ + EQI+VLKLQN+LFFGTIISIEEKID LLEISD DSS++RIKYLILD KN+N+
Sbjct: 704  TKFLNKVGEQIHVLKLQNLLFFGTIISIEEKIDGLLEISDKDSSRQRIKYLILDFKNINA 763

Query: 845  DNIDYSAAEGFNRIKRFTQSKRIQLIISSIKDTDKIYKMFXXXXXXXXXXXFSDLNGALE 904
            DNIDYSAAEGFNRIKRFT++KRIQLIISSI + D+IY  F           F+DLN ALE
Sbjct: 764  DNIDYSAAEGFNRIKRFTETKRIQLIISSITEKDRIYNAFNKVGLLQDVELFADLNSALE 823

Query: 905  WCENEFLYQYRQVKNXXXXXXXXXXTSRDVVRTGYLSTSVSNTLNDRKSSGNLPINTPRN 964
            WCENEFL QY+Q++                    +LS S+            LPINTPRN
Sbjct: 824  WCENEFLLQYKQIRTRTKAKLQAQKKQEK-----HLSKSL------------LPINTPRN 866

Query: 965  HQMVSVAKNIFQNIEQPVRSFSTNLNKSIPVLELLVFALKQYRSDIFSDDNKVRDKEVEF 1024
            +Q+V+VA+ IF + EQ V    T   K  PVL LL+ ALK++R  I S D  V+  E +F
Sbjct: 867  NQIVTVAQKIFPD-EQNVTHLRTQYQKREPVLPLLLVALKKFRPQIMSYDKDVKQAEEDF 925

Query: 1025 WSQLCPYFTKQPLANKTSLLHNNNVFFIVESGVLKMEFNLPQGSVYETMSNRTCYGRILG 1084
            WS+LCPYF ++  A  + LLHNNN+FF+VESG+LK+ ++L QG  YETMS++TCYGRI G
Sbjct: 926  WSKLCPYFVRKRFAPGSLLLHNNNLFFLVESGMLKITYDLHQGQFYETMSSKTCYGRISG 985

Query: 1085 KGYLKKSTSPLNIKAETDCIIWLINSEGLDKMKAENXXXXXXXXXXVMSVKDDRFNNLLG 1144
                  +   +NIK ETDC +W+I++  L  +K +N          VMS+   R   LLG
Sbjct: 986  NAEFTTNLY-VNIKTETDCAVWIIDATNLANLKEKNLALYAELLLVVMSINQYRSKELLG 1044

Query: 1145 YALISA 1150
            Y+L+S+
Sbjct: 1045 YSLVSS 1050

>TDEL0D05530 Chr4 (999021..1002116) [3096 bp, 1031 aa] {ON} Anc_3.485
            YGR125W
          Length = 1031

 Score = 1014 bits (2623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/862 (58%), Positives = 654/862 (75%), Gaps = 27/862 (3%)

Query: 304  SIPTTTD---VTQSTSLSFKDMLTKHSLQILHDIPACIXXXXXXXXXXXSYGMILFPITD 360
            +IPT+      T S S  ++  ++  S +++H +PA I           SYGMI+FPIT+
Sbjct: 182  AIPTSPGGGLRTSSRSALWRQFMSSSS-KLVHYLPATILGLLLNVLDGLSYGMIIFPITE 240

Query: 361  SVFGHLGPTGLSMFYISTIISQLVYSGGFSAFPSGLGGEMIEIVPFFHTMALTVKNSIPS 420
             +F HLGP+GLSMFY+STIISQ++YS GFS FP+G+G EMIE+ PFFH+MAL +K+++P 
Sbjct: 241  PIFSHLGPSGLSMFYVSTIISQVIYSSGFSNFPTGVGSEMIEVTPFFHSMALAIKDALPG 300

Query: 421  KDQNEIITTTIFCYVISCIFTGIVFFCLGKFKLGKLVGFFPRHILIGCIGGVGYFLIVTG 480
            +D +EI+TTTIFCYVIS + TG+ F+ LGK KLGK+VGFFPRHILIGCIGGVGYFL+VTG
Sbjct: 301  RD-DEILTTTIFCYVISSLVTGLTFYVLGKMKLGKIVGFFPRHILIGCIGGVGYFLVVTG 359

Query: 481  IEVTTRVKKLEYSLEFLLSVITNMSTLFKLVLPISLSVLLNILQKIYSHSLLLPSFYIIT 540
            +EVTTRV KLEY+  F+  + T++STL K VLP+ L+VLL + Q+ + +SL+LP+FYI T
Sbjct: 360  LEVTTRVAKLEYTWPFISHMFTDVSTLVKWVLPVLLTVLLIVTQRHFQNSLVLPTFYIAT 419

Query: 541  FIAFHFIVALVPNLSLDSLRATGWIFPVAESSDTWYSHYKYFNFFNCHWDLVFKQIPTMF 600
             +AFHF+VA++PN+SL  LR  GWIFPVA S D WY HYK F     HW L+ KQ PTM 
Sbjct: 420  LVAFHFVVAIIPNVSLGKLRNMGWIFPVAASKDQWYDHYKLFQPHRVHWGLIAKQAPTML 479

Query: 601  ALTFFGILHVPINVPALAMSVQMDKYDVDKELIAHGYSNLISGLFGSVQNYLVYTNSVLF 660
            AL+FFGILHVPINVPALA+S+QMDKYDVDKELIAHGYSNL+SG  GS+QNYLVYTNS+LF
Sbjct: 480  ALSFFGILHVPINVPALAISLQMDKYDVDKELIAHGYSNLLSGALGSIQNYLVYTNSLLF 539

Query: 661  IRAGGNTASAGLVLAGFTAIILFIGPVIISFIPVCIVGSLIFLLGWELIVEALLDTWGKV 720
            IRAG ++A AG +LA  T I++ IGPVIIS+IP+CIVGSLIFLLG+EL+ EAL++T GKV
Sbjct: 540  IRAGADSAMAGYLLAFLTFIMMVIGPVIISYIPICIVGSLIFLLGYELLYEALIETRGKV 599

Query: 721  TKFEYITIMIIVFTMGIYDFVLGILVGILIACFSFLVDSTKLQTVNGEFNGTVAKSTVYR 780
            T FEYITI IIV TMGI+DFVLG++VGILIACFSFLVDSTKLQT+NGE++G +AKSTVYR
Sbjct: 600  TNFEYITICIIVLTMGIFDFVLGVIVGILIACFSFLVDSTKLQTINGEYDGKIAKSTVYR 659

Query: 781  DYVQSQFLSGIAEQIYVLKLQNVLFFGTIISIEEKIDMLLEISDND-SSKRRIKYLILDL 839
            DYVQS+FL GI EQIYVLKLQ++LFFGTIISIEEKI+ LLEISD+  +SKRRIK LILDL
Sbjct: 660  DYVQSRFLDGIGEQIYVLKLQSLLFFGTIISIEEKINKLLEISDDQKNSKRRIKCLILDL 719

Query: 840  KNVNSDNIDYSAAEGFNRIKRFTQSKRIQLIISSIKDTDKIYKMFXXXXXXXXXXXFSDL 899
            KN+N+DNIDYSAAEGFNRIKRFTQSK IQLIISSI +TD IY  F           F DL
Sbjct: 720  KNINADNIDYSAAEGFNRIKRFTQSKHIQLIISSISETDHIYTAFSKVKLLDDVELFGDL 779

Query: 900  NGALEWCENEFLYQYRQVKNXXXXXXXXXXTSRDVVRTGYLSTSVSNTLNDRKSSG---- 955
            NGALEWCENE L++Y++++            +RD ++      +++   + +   G    
Sbjct: 780  NGALEWCENELLFKYKELR----------AKARDRLQNKMQMANLAANNDTKAIDGVPKS 829

Query: 956  -------NLPINTPRNHQMVSVAKNIFQNIEQPVRSFSTNLNKSIPVLELLVFALKQYRS 1008
                   +LP NTPRN QM+SVA+ +F+N ++ V S   N  +  PVL LL+FALK YR 
Sbjct: 830  HHMQNLMSLPFNTPRNDQMLSVAQRVFKNEQKTVDSLKVNYKELPPVLPLLLFALKPYRP 889

Query: 1009 DIFSDDNKVRDKEVEFWSQLCPYFTKQPLANKTSLLHNNNVFFIVESGVLKMEFNLPQGS 1068
             I S+D  V++ E+E WS+LCPYFT++ LA+++ LLHN+++FF++E+G+LK+ ++LPQG 
Sbjct: 890  GILSEDTNVKNSELELWSKLCPYFTRRRLASQSILLHNSDIFFVMETGILKIVYDLPQGI 949

Query: 1069 VYETMSNRTCYGRILGKGYLKKSTSPLNIKAETDCIIWLINSEGLDKMKAENXXXXXXXX 1128
            VYE++SNRTCYG +L  G    S S + IK ET+ ++W+I+S  L ++K EN        
Sbjct: 950  VYESLSNRTCYGIVLNPGTRPCSESKVTIKTETEVVLWVIDSSILARLKQENLSLYTELI 1009

Query: 1129 XXVMSVKDDRFNNLLGYALISA 1150
              + +VK+ R+  +LGY L+SA
Sbjct: 1010 LLIATVKEQRYRQILGYTLVSA 1031

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 58/140 (41%), Gaps = 39/140 (27%)

Query: 13  NRERNKLSEAISISLGLQEQQGXXXXXXXXXXXXIHGTLNNSRQRRKPSISLDPTLSRNI 72
           NR R+ +SEAIS+SLGLQ                 H   N+S      +       +  +
Sbjct: 12  NRGRHSISEAISVSLGLQNTNTPRD----------HHDGNHSNPYDSQNDQFMSPRNNYL 61

Query: 73  GARSFNCGAFLSRSIDNNLPTTDMXXXXXXXXXXXXXXXTHGLNS-NNDHLPVINPFPKS 131
           G RS+  G FLS S                          +G NS  +D LP+     KS
Sbjct: 62  G-RSYVSG-FLSCS-------------------------PYGSNSLESDRLPIARMRTKS 94

Query: 132 SIHGSDNLHKRTAEISNEFN 151
            IH + NLH++TA++  +FN
Sbjct: 95  -IHAAKNLHRQTAKLCEDFN 113

>TPHA0D04210 Chr4 (908861..912010) [3150 bp, 1049 aa] {ON} Anc_3.485
            YGR125W
          Length = 1049

 Score =  991 bits (2563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/897 (55%), Positives = 642/897 (71%), Gaps = 12/897 (1%)

Query: 262  DEYSR----LLPTPSPSIYDDENALFFSSSNNYDSTDLENNNYISSSIPTTTDVTQSTSL 317
            DEY +    +    SP+I DDE +   + S++    +L+   +     P   D + S + 
Sbjct: 157  DEYDQHRLAIRTQKSPNIADDEQSRLLTPSSSIIGAELDLEAHYDEFEPVRMDAS-SINR 215

Query: 318  SFKDMLTKHSLQILHDIPACIXXXXXXXXXXXSYGMILFPITDSVFGHLGPTGLSMFYIS 377
              +  L   S QILH  PA +           SYGMI+FPIT+ +F ++G  G+SMFYIS
Sbjct: 216  QNESKLIDFS-QILHYFPAAVLGLLLNILDALSYGMIIFPITEPIFANMGTAGISMFYIS 274

Query: 378  TIISQLVYSGGFSAFPSGLGGEMIEIVPFFHTMALTVKNSIPSKDQNEIITTTIFCYVIS 437
            +II Q + SGGFS+FP+G+G EMIEI PF+HTMAL +KNS+    Q EII+TTIFCYVIS
Sbjct: 275  SIICQYILSGGFSSFPTGIGSEMIEITPFYHTMALAIKNSLDV--QEEIISTTIFCYVIS 332

Query: 438  CIFTGIVFFCLGKFKLGKLVGFFPRHILIGCIGGVGYFLIVTGIEVTTRVKKLEYSLEFL 497
             + TG+VF+ LGK KLGK+V FFPRHILIGCIGGVGYFL+VTG+EVTTRV K+EYS EFL
Sbjct: 333  SLVTGLVFYSLGKLKLGKIVAFFPRHILIGCIGGVGYFLVVTGLEVTTRVAKVEYSWEFL 392

Query: 498  LSVITNMSTLFKLVLPISLSVLLNILQKIYSHSLLLPSFYIITFIAFHFIVALVPNLSLD 557
              ++++ + + K + PI L+ +L   Q  + +SL+LPSFYIIT I FHFIVALVP LSL+
Sbjct: 393  SYLLSDFNIIGKWLTPILLTTILIFTQHHFQNSLVLPSFYIITIILFHFIVALVPMLSLN 452

Query: 558  SLRATGWIFPVAESSDTWYSHYKYFNFFNCHWDLVFKQIPTMFALTFFGILHVPINVPAL 617
             LR +GWIFP+  S+D W+ HYKYFN +N  W L+ KQ+PTM ALTFFGILHVPINVPAL
Sbjct: 453  KLRDSGWIFPLTNSNDKWFDHYKYFNVYNVSWVLILKQMPTMLALTFFGILHVPINVPAL 512

Query: 618  AMSVQMDKYDVDKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASAGLVLAGF 677
            AMS+ +DK+DVD+E IAHGYSN +SGLFGSVQNYLVYTNSVLFIRAG ++  AG +L   
Sbjct: 513  AMSLNIDKFDVDREFIAHGYSNFLSGLFGSVQNYLVYTNSVLFIRAGADSPIAGYLLIVL 572

Query: 678  TAIILFIGPVIISFIPVCIVGSLIFLLGWELIVEALLDTWGKVTKFEYITIMIIVFTMGI 737
            TAI++ IGPVIISFIP+CIVGSLIFLLG+EL++EALLDT GKVT FEY TI+IIVFTMGI
Sbjct: 573  TAIVMLIGPVIISFIPICIVGSLIFLLGYELLIEALLDTVGKVTFFEYTTIIIIVFTMGI 632

Query: 738  YDFVLGILVGILIACFSFLVDSTKLQTVNGEFNGTVAKSTVYRDYVQSQFLSGIAEQIYV 797
            YDFVLGI+VGIL+AC  F+VD TKLQT+N E++GT+AKSTVYRD++QS+FL GI EQIY+
Sbjct: 633  YDFVLGIIVGILLACIKFMVDGTKLQTINTEYDGTIAKSTVYRDFIQSKFLDGIGEQIYL 692

Query: 798  LKLQNVLFFGTIISIEEKIDMLLEISDNDSSKRRIKYLILDLKNVNSDNIDYSAAEGFNR 857
            +KLQNVLFFGTIISIEEKID LL++SD+DSSK RI+YLILD KN+N DNIDYSAAEGFNR
Sbjct: 693  IKLQNVLFFGTIISIEEKIDTLLQLSDSDSSKHRIRYLILDFKNINDDNIDYSAAEGFNR 752

Query: 858  IKRFTQSKRIQLIISSIKDTDKIYKMFXXXXXXXXXXXFSDLNGALEWCENEFLYQYRQV 917
            IKRFT  + I+LIISSI  TDKIYK F           FSDLN  LEWCEN++L +YR++
Sbjct: 753  IKRFTHGRHIKLIISSITHTDKIYKAFNKIGLLQDIELFSDLNNGLEWCENKYLEKYREL 812

Query: 918  KNXXXXXXXXXXT-SRDVVRTGYLSTSVSNTLNDRKSSG---NLPINTPRNHQMVSVAKN 973
                        +  +D   +     S S+  N+ +SS    +LP+NTPRNHQ++SVA+N
Sbjct: 813  HEKAKKRLHSRMSILQDKNISSRQINSTSSDGNEYQSSQRLMSLPLNTPRNHQLLSVARN 872

Query: 974  IFQNIEQPVRSFSTNLNKSIPVLELLVFALKQYRSDIFSDDNKVRDKEVEFWSQLCPYFT 1033
            +F+N  Q V  F    N      +LL+ +++++R D+FS+   +R +E++FW+QL PYF 
Sbjct: 873  VFKNETQAVSRFKNLDNGEDAFTQLLLQSIRRFRPDVFSESKDIRAQEIKFWTQLAPYFN 932

Query: 1034 KQPLANKTSLLHNNNVFFIVESGVLKMEFNLPQGSVYETMSNRTCYGRILGKGYLKKSTS 1093
            K  +   ++ L+ NN FF+++SGV+K+  +L  G + ETM +RT YG +  K      T 
Sbjct: 933  KIFVETNSTFLNENNFFFLLDSGVIKVTHDLAPGKLSETMLSRTSYGILSSKNNRTYKTH 992

Query: 1094 PLNIKAETDCIIWLINSEGLDKMKAENXXXXXXXXXXVMSVKDDRFNNLLGYALISA 1150
             +    ET  +IWLI+SEGL KM+ EN          +MS+ D RF  LLGY L++A
Sbjct: 993  KVTFIPETKSVIWLIDSEGLKKMEKENLKLYSELTLLIMSISDYRFKALLGYTLVNA 1049

>KLTH0F14674g Chr6 (1201874..1204906) [3033 bp, 1010 aa] {ON} similar
            to uniprot|P53273 Saccharomyces cerevisiae YGR125W
            Hypothetical ORF
          Length = 1010

 Score =  967 bits (2500), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/907 (53%), Positives = 634/907 (69%), Gaps = 35/907 (3%)

Query: 255  DEDIIDNDEYSRLLPTPSPSIYDD---ENALFFSSSNN---YDSTDLENNNYIS----SS 304
            DE ++     S     P PS+ D+    N L   ++     Y S D  ++ Y+S     +
Sbjct: 128  DESVMAGSAISPTSSGPEPSVLDNTDVSNLLLPPNTQRDLEYGSIDEFDHQYVSLQSQRA 187

Query: 305  IPTTTDVTQSTSLSFKDMLTKHSLQILHDIPACIXXXXXXXXXXXSYGMILFPITDSVFG 364
               +  +  + S+  K + T   L   + +PA I           SYGMI+FPIT+ +F 
Sbjct: 188  GSNSRAIDPNASMRDKTLFTFRRLG--NYVPAVILGLLLNILDALSYGMIIFPITEPLFS 245

Query: 365  HLGPTGLSMFYISTIISQLVYSGGFSAFPSGLGGEMIEIVPFFHTMALTVKNSIPSKDQN 424
            HLGP+GLSMFY+S+++SQLVYS GFSAF + +G EMIEI PF+H+MA ++  S+P  +++
Sbjct: 246  HLGPSGLSMFYMSSVVSQLVYSCGFSAFGNAVGSEMIEITPFYHSMAASIMASMPG-EKD 304

Query: 425  EIITTTIFCYVISCIFTGIVFFCLGKFKLGKLVGFFPRHILIGCIGGVGYFLIVTGIEVT 484
             ++TTTI CY +S I TG+VFF LG+ KLGK+VGFFPRHILIGCIGGVGYFL++TG EVT
Sbjct: 305  RVLTTTIVCYAMSSIMTGLVFFLLGRLKLGKIVGFFPRHILIGCIGGVGYFLVITGFEVT 364

Query: 485  TRVKKLEYSLEFLLSVITNMSTLFKLVLPISLSVLLNILQKIYSHSLLLPSFYIITFIAF 544
            TR  K EYS EFL S++T+   L K  LP  ++VLL ++Q+   +SL+LP+FYI   + F
Sbjct: 365  TRASKFEYSFEFLSSLLTDPEILGKWGLPALMAVLLVVIQRACKNSLVLPTFYIAALLLF 424

Query: 545  HFIVALVPNLSLDSLRATGWIFPVAESSDTWYSHYKYFNFFNCHWDLVFKQIPTMFALTF 604
            HFIVAL+P+LSL SLR +GW+FP   +++ W+  YK +NF    W LV KQ+PTM ALTF
Sbjct: 425  HFIVALIPSLSLHSLRDSGWVFPATTTTEHWFDFYKLYNFKLVSWPLVLKQVPTMLALTF 484

Query: 605  FGILHVPINVPALAMSVQMDKYDVDKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAG 664
            FGILHVPINVPALAMS+ +DK DVDKELIAHGYSN +SG+ GSVQNYLVYTNS+LFI+AG
Sbjct: 485  FGILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFLSGMIGSVQNYLVYTNSLLFIKAG 544

Query: 665  GNTASAGLVLAGFTAIILFIGPVIISFIPVCIVGSLIFLLGWELIVEALLDTWGKVTKFE 724
             + + AGL+LA  T  I+ IGPVI+++IPVCIVGSLIFLLG+EL+ EAL+DTWGK+  FE
Sbjct: 545  ADDSLAGLMLAAATFGIMVIGPVIVAYIPVCIVGSLIFLLGYELLKEALVDTWGKLNNFE 604

Query: 725  YITIMIIVFTMGIYDFVLGILVGILIACFSFLVDSTKLQTVNGEFNGTVAKSTVYRDYVQ 784
            Y T++ IVFTMG +DFVLGI+VGILIACFSFLVDSTKLQT+NGEF+G VA+STV RDY+Q
Sbjct: 605  YATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQTINGEFDGQVARSTVRRDYIQ 664

Query: 785  SQFLSGIAEQIYVLKLQNVLFFGTIISIEEKIDMLLEISDNDSSKRRIKYLILDLKNVNS 844
            +QFL+ I EQI+VLKLQN+LFFGTIISIEEKID LLE+SD D+SK+RIKYLILD KN+N+
Sbjct: 665  TQFLNKIGEQIHVLKLQNLLFFGTIISIEEKIDKLLELSDKDASKKRIKYLILDFKNINA 724

Query: 845  DNIDYSAAEGFNRIKRFTQSKRIQLIISSIKDTDKIYKMFXXXXXXXXXXXFSDLNGALE 904
            DNIDYSAAEGFNRIKRFT SKRI LIISSIK TD+IY+ F           F DLN ALE
Sbjct: 725  DNIDYSAAEGFNRIKRFTFSKRIHLIISSIKTTDRIYRAFNKVGTLDGVELFDDLNSALE 784

Query: 905  WCENEFLYQYRQVKNXXXXXXXXXXTSRDVVRTGYLSTSVSNTLNDRK-SSGNLPINTPR 963
            WCENEFL Q+R ++N          T    VR             +R+ S G LP NTPR
Sbjct: 785  WCENEFLRQFRDLRN---------KTKLKAVRK-----------QERQLSKGALPFNTPR 824

Query: 964  NHQMVSVAKNIFQNIEQPVRSFSTNLNKSIPVLELLVFALKQYRSDIFSDDNKVRDKEVE 1023
            N+  VSVA+ +F + EQ +    T+  +  PVL LL+ AL++YR +I S +  V++ E +
Sbjct: 825  NNHFVSVAQKLFTD-EQSMPHLKTHYKEKTPVLHLLLSALQRYRPEIMSPEKPVKETEEK 883

Query: 1024 FWSQLCPYFTKQPLANKTSLLHNNNVFFIVESGVLKMEFNLPQGSVYETMSNRTCYGRIL 1083
             WS+L  +F K+ LA ++ L H NN+F +VESG++K+ +NL QG +YE +S +TCYGRI 
Sbjct: 884  MWSELGKFFFKRRLAAQSLLPHKNNIFLVVESGMVKVTYNLRQGQLYEILSGKTCYGRIT 943

Query: 1084 GKGYLKKSTSPLNIKAETDCIIWLINSEGLDKMKAENXXXXXXXXXXVMSVKDDRFNNLL 1143
                 +   S + IK ETDC +W+++   L K+K EN           + +  DR   LL
Sbjct: 944  APNSSEVPISSVEIKMETDCALWILDEANLAKLKKENLALYTELLLVTLCMNQDRLKELL 1003

Query: 1144 GYALISA 1150
            G+ L+S+
Sbjct: 1004 GHCLVSS 1010

>Kwal_55.21201 s55 (727206..730241) [3036 bp, 1011 aa] {ON} YGR125W -
            Hypothetical ORF [contig 295] FULL
          Length = 1011

 Score =  966 bits (2498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/913 (53%), Positives = 643/913 (70%), Gaps = 40/913 (4%)

Query: 242  NGGIVNRLPIQELDEDIIDNDEYSRLLPTPSPSIYDDENALFFSSSNNYDSTDLENNNYI 301
            NG +++  P+  + +  ID +E S  L  P     + E+ L + S + Y+      + Y+
Sbjct: 135  NGTLIS--PVSSVPDTPIDINEPSNALLPP-----NAEHDLEYGSIDGYE------HQYV 181

Query: 302  S----SSIPTTTDVTQSTSLSFKDMLTKHSLQILHDIPACIXXXXXXXXXXXSYGMILFP 357
            S     S   T ++    SL  K M T    ++++ +PA I           SYGMI+FP
Sbjct: 182  SLQSRRSGANTHNIGPDASLREKMMFTAR--RMVNYMPAVILGLLLNILDALSYGMIIFP 239

Query: 358  ITDSVFGHLGPTGLSMFYISTIISQLVYSGGFSAFPSGLGGEMIEIVPFFHTMALTVKNS 417
            IT+ +F HLGPTG+SMFY+S+IISQL+YSGGFSAF + +G EMIEI PF+H MA ++   
Sbjct: 240  ITEPLFSHLGPTGMSMFYVSSIISQLIYSGGFSAFGNAVGSEMIEITPFYHAMAASIVAG 299

Query: 418  IPSKDQNEIITTTIFCYVISCIFTGIVFFCLGKFKLGKLVGFFPRHILIGCIGGVGYFLI 477
            +P  +++ +++TTI CY +S I TG+VFF LG+ +LGK+VGFFPRHILIGCIGGVGYFL+
Sbjct: 300  LPG-EKDRVLSTTIVCYALSSIITGLVFFLLGRLRLGKIVGFFPRHILIGCIGGVGYFLL 358

Query: 478  VTGIEVTTRVKKLEYSLEFLLSVITNMSTLFKLVLPISLSVLLNILQKIYSHSLLLPSFY 537
            +TG+EVTTRV K EYS EFL S+ TN+  L K  LP  ++VLL ++Q  + +SL+LP+FY
Sbjct: 359  ITGLEVTTRVAKFEYSFEFLSSLFTNIEVLGKWGLPALMAVLLVVVQHAFGNSLVLPAFY 418

Query: 538  IITFIAFHFIVALVPNLSLDSLRATGWIFPVAESSDTWYSHYKYFNFFNCHWDLVFKQIP 597
            I   + FHFIVAL+P+LSLD LR +GWIFP  +S++ W+  Y  +NF    W ++ KQIP
Sbjct: 419  IAALLLFHFIVALIPSLSLDILRDSGWIFPATDSTEHWFDFYTLYNFKLVSWPMILKQIP 478

Query: 598  TMFALTFFGILHVPINVPALAMSVQMDKYDVDKELIAHGYSNLISGLFGSVQNYLVYTNS 657
            TM ALTFFGILHVPINVPALAMS+ +DK DVDKELIAHGYSN +SG+ GSVQNYLVYTNS
Sbjct: 479  TMLALTFFGILHVPINVPALAMSIGLDKLDVDKELIAHGYSNFLSGIMGSVQNYLVYTNS 538

Query: 658  VLFIRAGGNTASAGLVLAGFTAIILFIGPVIISFIPVCIVGSLIFLLGWELIVEALLDTW 717
            VLFIRAGG+ A AGL+LA  T  I+ +GPVI+++IPVCIVGSLIFLLG+EL+ EAL DTW
Sbjct: 539  VLFIRAGGDDALAGLMLAAATFGIMIVGPVIVAYIPVCIVGSLIFLLGYELLKEALYDTW 598

Query: 718  GKVTKFEYITIMIIVFTMGIYDFVLGILVGILIACFSFLVDSTKLQTVNGEFNGTVAKST 777
            GK+  FEY T++ IVFTMG +DFVLGI+VGILIACFSFLVDSTKLQTVNGEF+G VA+ST
Sbjct: 599  GKLNNFEYATVVAIVFTMGAFDFVLGIIVGILIACFSFLVDSTKLQTVNGEFDGQVARST 658

Query: 778  VYRDYVQSQFLSGIAEQIYVLKLQNVLFFGTIISIEEKIDMLLEISDNDSSKRRIKYLIL 837
            V RDY+Q+QFL+ I EQI+VLKLQN+LFFGTI+SIEEKID LLE+SD DSSK+RIKYLIL
Sbjct: 659  VSRDYIQTQFLNKIGEQIHVLKLQNLLFFGTILSIEEKIDKLLELSDKDSSKKRIKYLIL 718

Query: 838  DLKNVNSDNIDYSAAEGFNRIKRFTQSKRIQLIISSIKDTDKIYKMFXXXXXXXXXXXFS 897
            D KN+N+DNIDYSAAEGFNRIKRFT SKRI LIISSIK +D+IY+ F           F 
Sbjct: 719  DFKNINADNIDYSAAEGFNRIKRFTSSKRIHLIISSIKTSDRIYRAFNKVGMLEGVELFD 778

Query: 898  DLNGALEWCENEFLYQYRQVKNXXXXXXXXXXTSRDVVRTGYLSTSVSNTLNDRKSSGNL 957
            DLN ALEWCENEFL Q++ ++N            +  ++ G          + R S   L
Sbjct: 779  DLNSALEWCENEFLIQFKDLRN------------KTKLKAG-------KKQDRRMSKVPL 819

Query: 958  PINTPRNHQMVSVAKNIFQNIEQPVRSFSTNLNKSIPVLELLVFALKQYRSDIFSDDNKV 1017
            P NTPRN+Q VSVA+ +F + EQ +    ++  +  PVL LL+ AL+++R  I S D  V
Sbjct: 820  PFNTPRNNQFVSVAQKLFTD-EQSMTHLKSSYRERPPVLPLLLSALQRFRPQIMSSDKSV 878

Query: 1018 RDKEVEFWSQLCPYFTKQPLANKTSLLHNNNVFFIVESGVLKMEFNLPQGSVYETMSNRT 1077
            ++ E   WS LC YF K+ LA  + LLH +N+FF++E+G++K+ +NL QG +YETMS +T
Sbjct: 879  KEGEERLWSDLCKYFYKKRLAAHSLLLHKDNIFFVIETGMVKVTYNLRQGQLYETMSGKT 938

Query: 1078 CYGRILGKGYLKKSTSPLNIKAETDCIIWLINSEGLDKMKAENXXXXXXXXXXVMSVKDD 1137
            CYGR+          S + ++ ETDC +W+I+  GL K+K EN           + +  D
Sbjct: 939  CYGRMSIPNNNNNPISCVEVEMETDCSLWIIDDAGLAKLKRENLNLYTEVLLVTLCINQD 998

Query: 1138 RFNNLLGYALISA 1150
            R   LLG+ L+S+
Sbjct: 999  RLKELLGHCLVSS 1011

>KLLA0E04731g Chr5 complement(418094..421276) [3183 bp, 1060 aa] {ON}
            similar to uniprot|P53273 Saccharomyces cerevisiae
            YGR125W Hypothetical ORF
          Length = 1060

 Score =  920 bits (2379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 470/899 (52%), Positives = 611/899 (67%), Gaps = 36/899 (4%)

Query: 257  DIIDNDEYSRLLPTPSPSIYDDENALFFSSSNNYDSTDLENNNYISSSIPTTTDVTQSTS 316
            D+ D+ E   LLPT S       N+++      +D  +     YIS  +P        TS
Sbjct: 191  DVSDSTENLALLPTNS------HNSMYVEY-GTFDEENQPATQYISL-LPDGASSGGFTS 242

Query: 317  LSFKDMLTKHS------LQILHDIPACIXXXXXXXXXXXSYGMILFPITDSVFGHLGPTG 370
              F+  ++ +       L+I    PA             SYGMI+FPIT+ +F HLGPTG
Sbjct: 243  QGFRSSMSHYDKARDLMLRIFQYTPAVGLGLLLNILDALSYGMIIFPITEPLFSHLGPTG 302

Query: 371  LSMFYISTIISQLVYSGGFSAFPSGLGGEMIEIVPFFHTMALTVKNSIPSKDQNEIITTT 430
            LSMFY+ST+I QL +S G S+FPS +G EMIEI PFFHTMAL++ NSIP  + N++I+TT
Sbjct: 303  LSMFYVSTVICQLCFSLGLSSFPSAIGSEMIEITPFFHTMALSIMNSIPEGNDNKVISTT 362

Query: 431  IFCYVISCIFTGIVFFCLGKFKLGKLVGFFPRHILIGCIGGVGYFLIVTGIEVTTRVKKL 490
            I CY +S I TG+ FF LGK +LGK+VGFFPRHILIGCIGGVGYFLI+TG+EV TRV + 
Sbjct: 363  IVCYALSSIITGLTFFLLGKMRLGKIVGFFPRHILIGCIGGVGYFLIITGLEVCTRVPEF 422

Query: 491  EYSLEFLLSVITNMSTLFKLVLPISLSVLLNILQKIYSHSLLLPSFYIITFIAFHFIVAL 550
            +YS +FL S+ T+   L K + P+ L+++L  +Q    +SL+LPSFYIIT + FHF+VAL
Sbjct: 423  KYSWQFLSSLFTDFDILLKWLTPVILTLILISVQSRIHNSLVLPSFYIITLLLFHFVVAL 482

Query: 551  VPNLSLDSLRATGWIFPVAESSDTWYSHYKYFNFFNCHWDLVFKQIPTMFALTFFGILHV 610
            VP+LSLD LR  GWIF    + + WY  YK ++F N  W L+ KQ+PTM ALTFFGILHV
Sbjct: 483  VPSLSLDKLRDFGWIFAKVNAKENWYDFYKLYDFKNVQWSLIPKQVPTMLALTFFGILHV 542

Query: 611  PINVPALAMSVQMDKYDVDKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASA 670
            PINVPALAMS+ +DKYDVDKELIAHGYSNLISG  GS+QNYLVYTNSVLFIRAG ++  A
Sbjct: 543  PINVPALAMSLNVDKYDVDKELIAHGYSNLISGFLGSIQNYLVYTNSVLFIRAGADSPIA 602

Query: 671  GLVLAGFTAIILFIGPVIISFIPVCIVGSLIFLLGWELIVEALLDTWGKVTKFEYITIMI 730
            G++L   T I++ IGPVIISFIP+CIVGSLIFLLG+ELI EA++DTWGK+  FEY+TI I
Sbjct: 603  GIMLTIGTFIVMVIGPVIISFIPICIVGSLIFLLGYELIQEAVIDTWGKLQPFEYLTIWI 662

Query: 731  IVFTMGIYDFVLGILVGILIACFSFLVDSTKLQTVNGEFNGTVAKSTVYRDYVQSQFLSG 790
            IV TMG+ DFV+GI+VGIL+ACFSFLV+ST+LQT+NGE++G VAKSTVYRDY+QS+FL  
Sbjct: 663  IVITMGVVDFVIGIIVGILLACFSFLVNSTQLQTINGEYDGKVAKSTVYRDYIQSKFLRN 722

Query: 791  IAEQIYVLKLQNVLFFGTIISIEEKIDMLLEISDNDSSKRRIKYLILDLKNVNSDNIDYS 850
            I EQIYVLKLQN+LFFGTIISIEEK++ LLEI ++DSSK+RIKYLILD KN+ + +IDYS
Sbjct: 723  IGEQIYVLKLQNILFFGTIISIEEKVNSLLEICESDSSKKRIKYLILDFKNIRAKSIDYS 782

Query: 851  AAEGFNRIKRFTQSKRIQLIISSIKDTDKIYKMFXXXXXXXXXXXFSDLNGALEWCENEF 910
            AAEGFNRIKRF + +RI LIISSI   D+IY  F           FSDLNGALEWCENEF
Sbjct: 783  AAEGFNRIKRFLEKERIHLIISSIDKEDQIYLAFDKVRLFENVELFSDLNGALEWCENEF 842

Query: 911  LYQYRQVKNXXXXXXXXXXTSRDVVRTGYLSTSVSNTLNDRKSSGNLPINTPRNHQMVSV 970
            L +Y++                  +RT   +  ++     +     LP+NTPRNHQ VS 
Sbjct: 843  LMRYKR------------------IRTKTRARKLAQLKKSQNRMSKLPVNTPRNHQFVSE 884

Query: 971  AKNIFQNIEQPVRSFSTNLNKSIPVLELLVFALKQYRSDIFSDDNKVRDKEVEFWSQLCP 1030
             +NI+   E  ++  S  L +    L + + +++++R+ I S +   R  E++ W +L  
Sbjct: 885  VRNIYTE-EMEIQKLSNELKERQQFLPIFLMSIRKFRNAIQSPNELKRTNELDLWKRLIS 943

Query: 1031 YFTKQPLANKTSLLHNNNVFFIVESGVLKMEFNLPQGSVYETMSNRTCYGRILGKGYLKK 1090
            YF ++     T + H NN+F +VESGVL +  +L QG  YETMS +T YG I     +  
Sbjct: 944  YFQQKKFPPNTEIRHRNNMFIVVESGVLNLTHHLIQGEFYETMSPKTAYGVI---SNVNS 1000

Query: 1091 STSPLNIKAETDCIIWLINSEGLDKMKAENXXXXXXXXXXVMSVKDDRFNNLLGYALIS 1149
                ++I  +T+C++  I++E L  +K  +          VM++  DRF  LLGY+LIS
Sbjct: 1001 DPLAVSITTDTECVLRYIDAESLADLKLTDPELFTELLILVMAIHRDRFRELLGYSLIS 1059

>AFR304W Chr6 (991645..994692) [3048 bp, 1015 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YGR125W
          Length = 1015

 Score =  852 bits (2200), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/818 (53%), Positives = 566/818 (69%), Gaps = 28/818 (3%)

Query: 334  IPACIXXXXXXXXXXXSYGMILFPITDSVFGHLGPTGLSMFYISTIISQLVYSGGFSAFP 393
            IPA I           SYGMI+FPI + +F HLGP GLSMFY+STIISQLVYSGGFS+F 
Sbjct: 225  IPAVILGLLLNILDALSYGMIIFPIAEPIFSHLGPHGLSMFYVSTIISQLVYSGGFSSFG 284

Query: 394  SGLGGEMIEIVPFFHTMALTVKNSIPSKDQNEIITTTIFCYVISCIFTGIVFFCLGKFKL 453
             G G EMIE+ PFFHTMAL++KNS+ ++  ++IITTTI CY +S I TG VF  LGK +L
Sbjct: 285  YGTGSEMIEVTPFFHTMALSIKNSLSAEKSDDIITTTIVCYALSTIITGAVFLTLGKLRL 344

Query: 454  GKLVGFFPRHILIGCIGGVGYFLIVTGIEVTTRVKKLEYSLEFLLSVITNMSTLFKLVLP 513
            GKLV FFP HILIGCIGGV YFLI+TGIEV+TRV K EYSL FL ++  +   L K ++P
Sbjct: 345  GKLVSFFPLHILIGCIGGVAYFLIITGIEVSTRVTKFEYSLAFLRNLFMDPDILAKWLIP 404

Query: 514  ISLSVLLNILQKIYSHSLLLPSFYIITFIAFHFIVALVPNLSLDSLRATGWIFPVAESSD 573
              L+V + +LQ+   +S+LLP FY+  F  FHFIVAL+P+LSLD+LR  GWIFP+ ES  
Sbjct: 405  ALLAVSIILLQRRIHNSMLLPLFYLSAFALFHFIVALIPSLSLDTLRDKGWIFPLTESGG 464

Query: 574  TWYSHYKYFNFFNCHWDLVFKQIPTMFALTFFGILHVPINVPALAMSVQMDKYDVDKELI 633
             WY + + +N    HW+LV  +IPTM ALTFFGILHVPINVPALA+S  +DK DVDKELI
Sbjct: 465  RWYDYLELYNPQRIHWELVLGEIPTMLALTFFGILHVPINVPALAISCGIDKIDVDKELI 524

Query: 634  AHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASAGLVLAGFTAIILFIGPVIISFIP 693
            AHGYSN+ SG  GS+QNYLVYTNSVLFIRAG ++  AG +LA  T + +  GP IIS IP
Sbjct: 525  AHGYSNIFSGCAGSIQNYLVYTNSVLFIRAGADSRYAGFLLAIATFMTMTAGPWIISIIP 584

Query: 694  VCIVGSLIFLLGWELIVEALLDTWGKVTKFEYITIMIIVFTMGIYDFVLGILVGILIACF 753
            VCIV SLIFLLG+EL+ E L D++ +++ FEYIT++II+ TMGI+DFVLGI+VG+L+ACF
Sbjct: 585  VCIVSSLIFLLGYELLKEVLYDSYNRLSNFEYITVVIIILTMGIFDFVLGIIVGVLVACF 644

Query: 754  SFLVDSTKLQTVNGEFNGTVAKSTVYRDYVQSQFLSGIAEQIYVLKLQNVLFFGTIISIE 813
            SFLV+ST+ +T++ EF+G VAKS  +RDY+QS FL  +AEQIYVLKLQN LFFGTIISIE
Sbjct: 645  SFLVESTRAKTISSEFDGKVAKSACHRDYLQSNFLEKVAEQIYVLKLQNNLFFGTIISIE 704

Query: 814  EKIDMLLEISDNDSSKRRIKYLILDLKNVNSDNIDYSAAEGFNRIKRFTQSKRIQLIISS 873
            EKI  LLE  +    K+ IKYLILD K++N DNIDYSAAEGFNRIKR  + KRI+LI+SS
Sbjct: 705  EKIGNLLE-PNGSEYKKIIKYLILDFKHINIDNIDYSAAEGFNRIKRVMEIKRIKLIVSS 763

Query: 874  IKDTDKIYKMFXXXXXXXXXXXFSDLNGALEWCENEFLYQYRQVKNXXXXXXXXXXTSRD 933
            I + DKIY +F           F DLN ALEWCENE L +YR + +           S+D
Sbjct: 764  ISECDKIYTIFSKIGLLQDVELFQDLNSALEWCENELLCEYRSLLS-RAHRVKVRRRSKD 822

Query: 934  VVRTGYLSTSVSNTLNDRKSSGNLPI-NTPRNHQMVSVAKNIFQNIEQPVRSFSTNLNKS 992
            +V                     +P+ NTPRN Q+++ A+ ++   EQ +    +    S
Sbjct: 823  IV-----------------PKAQIPLENTPRNAQIMTAAQAVYSG-EQQLNKTLSKYKAS 864

Query: 993  IPVLELLVFALKQYRSDIFSDDNKVRDKEVEFWSQLCPYFTKQPLANKTSLLHNNNVFFI 1052
             P L LL+ ALK YRS     +     KE+  W  LCPYF ++  + +TS+    ++FF+
Sbjct: 865  HPALALLLVALKTYRSGHAYKET----KEIRLWKHLCPYFVRKSFSPQTSISDEGDMFFV 920

Query: 1053 VESGVLKMEFNLPQGSVYETMSNRTCYGRILGKGYLKKSTSPLNIKAETDCIIWLINSEG 1112
            VESG+LK+ + LPQGS+ E ++++TCYG I G G L  S+    ++ ET+C++W+I++ G
Sbjct: 921  VESGLLKITYMLPQGSLQEAIASKTCYGNISGPGSLSYSSV---VRTETECVLWMIDAPG 977

Query: 1113 LDKMKAENXXXXXXXXXXVMSVKDDRFNNLLGYALISA 1150
            L K++ EN           +SV   RF  LLG++LI+ 
Sbjct: 978  LQKLQEENLPLYTELLVVYISVIQHRFKELLGHSLING 1015

>Smik_16.241 Chr16 complement(438048..440282) [2235 bp, 744 aa] {ON}
           YPR003C (REAL)
          Length = 744

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 56/271 (20%), Positives = 123/271 (45%), Gaps = 22/271 (8%)

Query: 629 DKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASAGLVLAGFTAIILFIGPVI 688
           ++EL+A G+ N++  LFG++ ++  Y  S +   +G  +  +G+ +   T I + +    
Sbjct: 398 NRELVALGFMNIVISLFGALPSFGGYGRSKINALSGAQSVISGVFVGVITLITMNLLLQF 457

Query: 689 ISFIPVCIVGSLIFLLGWELIVEALLDTWGKVTKFEYITIMIIVFTMGI---YDFVLGIL 745
           + +IP C++  +  ++G  L+ E   D    +    Y  + +   T G+   Y    GI 
Sbjct: 458 VHYIPNCVLSVITTVIGISLLEEVPSDIKFHLRCGGYSELFVFAVTFGVTIFYSIEAGIC 517

Query: 746 VGILIACFSFLVDSTKLQ-TVNGEFNGTVAKSTVYRDYVQSQFLSGIA-------EQIYV 797
           +G + +  + +  S K +  +     GT +  T   DY+ +   + ++       E   +
Sbjct: 518 IGCVYSILNIIKHSAKSRIQILARVAGT-SNFTNLDDYLMNMKRNPLSIENTEEIEGCMI 576

Query: 798 LKLQNVLFFGTIISIEEKIDMLLEISDND--------SSKRRIKYLILDLKNVNSDNIDY 849
           +++   L F     +++++D +     +          SK  IKY+I DL  + S  +D 
Sbjct: 577 VRIPEPLTFTNSEDLKQRLDRIERFGSSKIHPGRKSFRSKDSIKYVIFDLGGMTS--LDS 634

Query: 850 SAAEGFNRIKRFTQSKRIQLIISSIKDTDKI 880
           SAA+  + I    + + + + ++++   DKI
Sbjct: 635 SAAQVLDEIITSYKRRNVFIYLANVSINDKI 665

>Kpol_467.11 s467 (26194..28428) [2235 bp, 744 aa] {ON}
           (26194..28428) [2235 nt, 745 aa]
          Length = 744

 Score = 53.1 bits (126), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 66/279 (23%), Positives = 124/279 (44%), Gaps = 36/279 (12%)

Query: 629 DKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASAGLVLAGFTAI-ILFIGPV 687
           ++EL+A G  N+I+ LFG++ ++  Y  S +   +G  T  +G+ +   T I I ++ P 
Sbjct: 392 NRELVALGSMNVIASLFGALPSFGGYGRSKINAFSGSKTVMSGVFMGSVTLITIRYLLP- 450

Query: 688 IISFIPVCIVGSLIFLLGWELIVEALLDTWGKVTKF--------EYITIMIIVFTMGIYD 739
           +I +IP+CI+  +  ++G  L+ EA  +      KF        E     I V    +Y 
Sbjct: 451 LIHYIPLCILSVITSIVGISLLEEAPSE-----LKFHFRCKGYDELFVFAITVLATLLYS 505

Query: 740 FVLGILVGILIACFSFLVDSTKLQ-TVNGEFNGTVAKSTVYRDYVQSQFLSGIAEQIYVL 798
             +GI +G   +  S +  S K +  + G   GT   + +  +Y+ S  +  I    +VL
Sbjct: 506 VEMGICIGCGYSIISIVKHSAKSRIQILGRVQGTREFANI-DEYLDSDPIGDIETNKFVL 564

Query: 799 ---------KLQNVLFFGTIISIEEKIDMLLEISD--------NDSSKRRIKYLILDLKN 841
                    K+   L F     ++E+++ L                SK   K +I DL  
Sbjct: 565 EEIEGCLIVKIPEPLTFTNTDDLKERLNRLERFGSVKAHPGGPGGRSKDYTKCVIFDLHG 624

Query: 842 VNSDNIDYSAAEGFNRIKRFTQSKRIQLIISSIKDTDKI 880
           + S  ID SA + F  I    + +++++ ++ +  + +I
Sbjct: 625 MTS--IDSSATQIFFDIVATYKKRKVKVFLARVLQSKQI 661

>Skud_16.286 Chr16 complement(525800..528037) [2238 bp, 745 aa] {ON}
           YPR003C (REAL)
          Length = 745

 Score = 53.1 bits (126), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 60/274 (21%), Positives = 119/274 (43%), Gaps = 27/274 (9%)

Query: 629 DKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASAGLVLAGFTAIILFIGPVI 688
           ++EL+A G+ N++  LFG++ ++  Y  S +   +G  +  +G+ +   T I + +    
Sbjct: 398 NRELVALGFMNIVISLFGALPSFGGYGRSKINALSGAQSVMSGVFVGIITLITMNLLLQF 457

Query: 689 ISFIPVCIVGSLIFLLGWELIVEALLDTWGKVTKFEYITIMIIVFTMGIYDFVLGILVGI 748
           + +IP C++  +  ++G  L+ E   D    +    Y  + +   T G+   +  I  GI
Sbjct: 458 VHYIPNCVLSVITTVIGISLLEEVPGDIKFHLRCGGYSELFVFAVTFGV-TILCSIEAGI 516

Query: 749 LIACFSFLVDSTK---------LQTVNGEFNGTVAKSTVYRDYVQSQFLSG-----IAEQ 794
            I C   +++  K         L  V G  N T      Y   ++   L G       E 
Sbjct: 517 CIGCVYSILNIIKHSAKSRIQILARVAGTSNFTNLDD--YLRTMKKNPLGGENRLEEVEG 574

Query: 795 IYVLKLQNVLFFGTIISIEEKIDMLLEISDND--------SSKRRIKYLILDLKNVNSDN 846
             ++++   L F     +++++D +     +          SK  IKY+I DL  + S  
Sbjct: 575 CMIVRIPEPLTFTNSEDLKQRLDRIERFGSSKIHPGRKSFRSKDSIKYVIFDLGGMTS-- 632

Query: 847 IDYSAAEGFNRIKRFTQSKRIQLIISSIKDTDKI 880
           ID SAA+  + I    + + + + ++++   DKI
Sbjct: 633 IDSSAAQVLDEIITSYKRRNVFIYVANVSINDKI 666

>SAKL0B03124g Chr2 complement(288006..290240) [2235 bp, 744 aa] {ON}
           similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 744

 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 61/277 (22%), Positives = 112/277 (40%), Gaps = 25/277 (9%)

Query: 629 DKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASAGLVLAGFTAIILFIGPVI 688
           ++EL+A G  NLI  LFG++ ++  Y  S +   +G  T  +G  +   T   +      
Sbjct: 400 NRELVALGSLNLIGSLFGALPSFGGYGRSKINAYSGAQTVVSGACMGTITMFTIKFLLKF 459

Query: 689 ISFIPVCIVGSLIFLLGWELIVEALLDTWGKVTKFEY---ITIMIIVFTMGIYDFVLGIL 745
           I +IPVC++  +  ++G  L+ EA  D    +    Y   I+ +I V T   Y    GI 
Sbjct: 460 IRYIPVCVLSVITTVVGLSLLEEAPADLRFHIRCRGYNELISFIITVLTTFFYSVEAGIT 519

Query: 746 VGILIACFSFLVDSTKLQ-TVNGEFNGT---------VAKSTVYRDYVQSQFLSGIAEQI 795
           VG   +    +  STK +  + G+  GT           K++     V  Q      E  
Sbjct: 520 VGCGYSIIRVIKHSTKSRIQILGKLAGTNKFVNADEYEGKNSTSERRVNPQLEE--IEGC 577

Query: 796 YVLKLQNVLFFGTIISIEEKIDML--------LEISDNDSSKRRIKYLILDLKNVNSDNI 847
            ++++   L F     ++ +++ L           +     +   KY+I DL  + +  I
Sbjct: 578 LIVRIPEPLTFTNTDDLKTRLNRLELYGSTKTHPAAPRSRDQEMTKYVIFDLHGMTT--I 635

Query: 848 DYSAAEGFNRIKRFTQSKRIQLIISSIKDTDKIYKMF 884
           D SA +    I    + + + + +  +    K+   F
Sbjct: 636 DSSAIQILQEIISSYKRRHVHVFLVRVPSARKVRNRF 672

>Suva_16.322 Chr16 complement(565605..567833) [2229 bp, 742 aa] {ON}
           YPR003C (REAL)
          Length = 742

 Score = 52.0 bits (123), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 58/271 (21%), Positives = 118/271 (43%), Gaps = 21/271 (7%)

Query: 629 DKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASAGLVLAGFTAIILFIGPVI 688
           ++EL+A G  N+   LFG++ ++  Y  S +   +G  +  +G+ +   T I + +    
Sbjct: 398 NRELVALGCINMFISLFGALPSFGGYGRSKINALSGAQSVMSGVFVGIITLITMKLLLQF 457

Query: 689 ISFIPVCIVGSLIFLLGWELIVEALLDTWGKVTKFEYITIMIIVFTMGI---YDFVLGIL 745
           + +IP C++  +  ++G  L+ E   D    +    Y  + +   T G+   Y    GI 
Sbjct: 458 VHYIPNCVLSVITTVIGISLLEEVPGDIKFHLQCGGYSELFVFAVTFGVTIFYSIESGIC 517

Query: 746 VGILIACFSFLVDSTK-----LQTVNGEFNGTVAKSTVYRDYVQSQFLSGIAEQI---YV 797
           +G + +  + +  S K     L  + G  N T     +         + G  E+I    +
Sbjct: 518 IGCVYSILNIIKHSAKSRIQILARIAGTSNFTNLDDYLRTTKKNPPAVEGRIEEIEGCMI 577

Query: 798 LKLQNVLFFGTIISIEEKIDMLLEISDND--------SSKRRIKYLILDLKNVNSDNIDY 849
           +++   L F     +++++D +     +          SK  IKY+I DL  + S  ID 
Sbjct: 578 VRIPEPLTFTNSEDLKQRLDRIERFGSSKIHPGRKSFRSKDSIKYVIFDLGGMTS--IDS 635

Query: 850 SAAEGFNRIKRFTQSKRIQLIISSIKDTDKI 880
           SAA+  + I    + + + + ++++   DKI
Sbjct: 636 SAAQVLDEIISCYKRRNVFIYLANVSINDKI 666

>TPHA0H00720 Chr8 complement(143103..145466) [2364 bp, 787 aa] {ON}
           Anc_8.99 YPR003C
          Length = 787

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 71/159 (44%), Gaps = 10/159 (6%)

Query: 598 TMFALTFFGILHVPINVPALAMSVQMDKYDVDKELIAHGYSNLISGLFGSVQNYLVYTNS 657
           T FA+   G         +L    ++     ++EL+A G  NL + L G + ++  Y  S
Sbjct: 398 TGFAIAALGFFESTTASKSLGTKFELS-ISSNRELVALGVMNLTASLLGGLPSFGGYGRS 456

Query: 658 VLFIRAGGNTASAGLVLAGFTAIILFIGPVIISFIPVCIVGSLIFLLGWELIVEALLDTW 717
            +   +G  T  +G+V+ G T + +      I FIP C++  +  ++G  LI EA     
Sbjct: 457 KINAFSGAKTVMSGVVMGGITVLTIKFLLNYIHFIPTCVLSVITTIVGLSLIEEA----P 512

Query: 718 GKVTKFEY----ITIMIIVFTMGIYDFVLGILVGILIAC 752
           G+V KF +       +II F          + VGI+I C
Sbjct: 513 GEV-KFHWRCKGYNELIIFFMTACGTIFFSVEVGIIIGC 550

>NCAS0B04800 Chr2 complement(873061..875235) [2175 bp, 724 aa] {ON}
           Anc_8.99
          Length = 724

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 67/264 (25%), Positives = 116/264 (43%), Gaps = 35/264 (13%)

Query: 629 DKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASAGLVLAGFTAI-ILFIGPV 687
           ++EL+A G  NL+  LFG++ ++  Y  S +   +G  T  +G  +   T   I F+ PV
Sbjct: 384 NRELVALGSMNLVGSLFGALPSFGGYGRSKINALSGAQTVMSGACMGLITLFTIKFLLPV 443

Query: 688 IISFIPVCIVGSLIFLLGWELIVEALLDTWGKVTKFEY---ITIMIIVFTMGIYDFVLGI 744
            I + P+CI+  +  ++G  L+ EA  D    +    Y   I   +I  T  I+    GI
Sbjct: 444 -IHYTPLCILSVITTVVGLSLLEEAPSDIRFHIRCHGYNELIIFTLIFVTTIIHSVEAGI 502

Query: 745 LVGIL--------------IACFSFLVDSTKLQTVNGEFNGTVAKSTVYRDYVQSQFLSG 790
            VG +              I   + ++ + +   V+G + G     T+  D  +S  L  
Sbjct: 503 SVGCIYSIGSIIKHSAQSRIQILTRVIGTNQFVPVDGYYPGL---KTI--DLRESSALEE 557

Query: 791 IAEQIYVLKLQNVLFFGTIISIEEKIDMLLEI-SDNDSSKRR-------IKYLILDLKNV 842
           + +   ++K+   L F     ++E+++ L    S      RR       IKY+I +L  +
Sbjct: 558 LDDSTLIVKIPEPLTFTNTEDLKERLNRLERFRSVRIHPGRRPLHNRENIKYVIFELGGM 617

Query: 843 NSDNIDYSAAEGFNRIKRFTQSKR 866
            S  +D SAA+    I + T  KR
Sbjct: 618 TS--MDSSAAQILKEIIK-TYKKR 638

>NDAI0B02210 Chr2 complement(546721..548841) [2121 bp, 706 aa] {ON}
           Anc_8.99
          Length = 706

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 119/532 (22%), Positives = 210/532 (39%), Gaps = 105/532 (19%)

Query: 409 TMALTVKNSI-PSKDQNEIITTTIFCYVISCIFTGIVFFCLGKFKLGKLVGFFPRHILIG 467
            ++L V  ++ P  + +E I+T     V++ I +G     LG F+LG L     R +L G
Sbjct: 134 AISLVVGQAVEPMVNHDERISTISISIVVTFI-SGSFLLFLGIFRLGFLGNILSRALLRG 192

Query: 468 CIGGVGYFLIVTGIEVTTRVKKLEYSLEFLLSVITNMSTLFKLVLPISLSVLLNILQKIY 527
            I  VG+ +I+  +    ++ K+      L +   +  T F+ +L          L K  
Sbjct: 193 FICSVGFVMIINSLISELKLDKV------LATSPEHYHTPFEKIL---------FLIKYG 237

Query: 528 SHSLLLPSFYIITFIAFHFIVALVPNLSLDSLRATGWIFPVAESSDTWYSHYKYFNFFNC 587
            H+   P+  I++  +F  I+ L+  +    ++   W+  V E              F+ 
Sbjct: 238 QHNYHAPT-AILSLYSF-IILMLMKVMKKRLMKRFKWVIFVPEILIVIVGTI----MFSF 291

Query: 588 HWDLVFK---QIPTMFALTFFGILHVPINV-------PAL----------------AMSV 621
           H+D+  K    I   F +  F  LH P++        P L                A   
Sbjct: 292 HFDIKHKFDISIIGDFKVNGFDSLHNPLDKTNRLLLKPLLDAGIVCAVLGFFESTTASKA 351

Query: 622 QMDKYDV----DKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASAGLVLAGF 677
               YD+    ++EL+A G  N++  LFG++  +  Y  S +   +GG T  +G+ L   
Sbjct: 352 LGTTYDLTVSSNRELVALGSMNIVGSLFGALPAFGGYGRSKINALSGGQTVMSGVCLGSV 411

Query: 678 TAI-ILFIGPVIISFIPVCIVGSLIFLLGWELIVEALLDTWGKVTKF--------EYITI 728
           T   I F  PV+ +  P C++  +  ++G  L+ EA  D      KF        E I +
Sbjct: 412 TLFTIKFFLPVVHN-TPTCVLSVVTSVVGLTLLEEAPTD-----LKFYFQSHGYNELIVL 465

Query: 729 MIIVFTMGIYDFVLGILVGILIACFSFLVDS--TKLQTVN--------------GEFNGT 772
            +   T   Y   +GI VG   +  S +  S  +++Q +               G F+G 
Sbjct: 466 GLTFITTIFYSVEVGICVGCCYSIISIIKHSAQSRIQILAKRKGDNRFSNADELGIFDGE 525

Query: 773 VAKSTVYRDYVQSQFLSGIAEQIYVLKLQNVLFFGTIISIEEKIDMLLEISD-------- 824
              +  + +      L  + E   V+K+   L F     ++E++  L             
Sbjct: 526 NNNNNTFFE----PLLEDLDEDRLVVKIPEPLTFTNTEDLKERLSRLERFGSVRVHPGRR 581

Query: 825 NDSSKRRIKYLILDLKNVNSDNIDYSAAE-------GFNRIKRFTQSKRIQL 869
           +  S+ + KY+I DL  +    ID SAA+        +NR + F    R+ +
Sbjct: 582 DLRSRDKTKYIIFDLHGMT--YIDASAAQILLEIILAYNRRQVFVFFVRVPM 631

>YPR003C Chr16 complement(561504..563768) [2265 bp, 754 aa] {ON}
           Putative sulfate permease; physically interacts with
           Hsp82p; green fluorescent protein (GFP)-fusion protein
           localizes to the ER; YPR003C is not an essential gene
          Length = 754

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 58/272 (21%), Positives = 117/272 (43%), Gaps = 20/272 (7%)

Query: 629 DKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASAGLVLAGFTAIILFIGPVI 688
           ++EL+A G+ N++  LFG++  +  Y  S +   +G  +  +G+ +   T I + +    
Sbjct: 408 NRELVALGFMNIVISLFGALPAFGGYGRSKINALSGAQSVMSGVFMGVITLITMNLLLQF 467

Query: 689 ISFIPVCIVGSLIFLLGWELIVEALLDT--WGKVTKFEYITIMIIVFTMGI-YDFVLGIL 745
           + +IP C++  +  ++G  L+ E   D     +   F  + +  + F   I Y    GI 
Sbjct: 468 VHYIPNCVLSVITTIIGISLLEEVPGDIKFHLRCGGFSELFVFAVTFCTTIFYSIEAGIC 527

Query: 746 VGILIACFSFLVDSTK-----LQTVNGEFNGTVAKSTVYRDYVQSQFLSGIA--EQIYVL 798
           +G + +  + +  S K     L  V G  N T     +      S  + G    E   ++
Sbjct: 528 IGCVYSIINIIKHSAKSRIQILARVAGTSNFTNLDDYMMNMKRNSLDVEGTEEIEGCMIV 587

Query: 799 KLQNVLFFGTIISIEEKIDMLLEISDND--------SSKRRIKYLILDLKNVNSDNIDYS 850
           ++   L F     +++++D +     +          SK  IKY+I DL  + S  ID S
Sbjct: 588 RIPEPLTFTNSEDLKQRLDRIERYGSSKIHPGRKSLRSKDSIKYVIFDLGGMTS--IDSS 645

Query: 851 AAEGFNRIKRFTQSKRIQLIISSIKDTDKIYK 882
           AA+    I    + + + + + ++   DK+ +
Sbjct: 646 AAQVLEEIITSYKRRNVFIYLVNVSINDKVRR 677

>KLLA0E14059g Chr5 (1245694..1247814) [2121 bp, 706 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 706

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 100/456 (21%), Positives = 184/456 (40%), Gaps = 50/456 (10%)

Query: 462 RHILIGCIGGVGYFLIVTGIEVT--------TRVKKLEYSLEFLLSVI----------TN 503
           R +L G I GVG  +++T + V         TR +      E +L ++          T 
Sbjct: 201 RALLRGFISGVGVIMVITSLVVELKLNHVTPTRQEHYHSPFEKVLFIMKYGPENYHKPTA 260

Query: 504 MSTLFKLVLPISLSVLLNILQKIYSHSLLLPSFYIITFIAFHFIVALVPNLSLDSLRATG 563
           + +L   V+ +SL +      K +   +LLP   I+  +A    V+    + L S     
Sbjct: 261 ILSLVAFVILMSLRIFKKRYGKKFKWLVLLPD--ILVVVALSIFVSY--KMHLKSRYGIE 316

Query: 564 WIFPVAESSDTWYSHYKYFNFFNCHWDLVFKQI-PTMFALTFFGILHVPINVPALAMSVQ 622
            I  + + S     H K  N F+      FK +  T F +   G         +L  S  
Sbjct: 317 IINDIPKDS---MKHLK--NPFSNVNVATFKDLFSTGFMVAMLGFFESATASKSLGTSYN 371

Query: 623 MDKYDVDKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASAGLVLAGFTAI-I 681
           +     ++ELIA G  N++  +F  +  +  Y  S +   +G  T  +G  +   T   I
Sbjct: 372 L-AISSNRELIALGSMNVVGSMFAILPAFGGYGRSKINAYSGAQTTMSGFFMGLVTLFTI 430

Query: 682 LFIGPVIISFIPVCIVGSLIFLLGWELIVEALLDT---WGKVTKFEYITIMIIVFTMGIY 738
            F+ P II +IPVCI+  +  ++G  L+ EA  D    W      E     + +     Y
Sbjct: 431 QFLLP-IIRYIPVCILSVITTVVGLTLLEEAPHDLKFHWRCKGYSELTVFTVTLLATLFY 489

Query: 739 DFVLGILVGILIACFSFLVDSTKLQ-TVNGEFNGTVA--KSTVYRDYVQSQFLSGIAEQI 795
               GI +G   +  + +  S K +  + G   GT     +  Y+      F++   E+I
Sbjct: 490 SLEAGIYIGCACSIINVIKHSAKSRIQILGRVPGTETFINADDYQANAAGYFINPQIEEI 549

Query: 796 ---YVLKLQNVLFFGTIISIEEKIDMLLE----ISDNDSSKRRIKYL----ILDLKNVNS 844
               ++K+   L F     ++ ++  L +    ++   + + R K +    I D+K +  
Sbjct: 550 EGFLIVKIAEPLTFTNADDLKMRLHRLEKHGSAVTHPAAPRSRRKEMTENVIFDMKGMT- 608

Query: 845 DNIDYSAAEGFNRIKRFTQSKRIQLIISSIKDTDKI 880
            +ID SAA+    I      + + + ++++  T+K+
Sbjct: 609 -HIDSSAAQTLEEILSAYNRRDVHVFLTNVPLTEKV 643

>TDEL0C01280 Chr3 complement(218824..221007) [2184 bp, 727 aa] {ON}
           Anc_8.99 YPR003C
          Length = 727

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 57/269 (21%), Positives = 111/269 (41%), Gaps = 19/269 (7%)

Query: 629 DKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASAGLVLAGFTAIILFIGPVI 688
           ++EL+A G  NL + + G++  +  Y  S +   +G  T  +G+ +     + +      
Sbjct: 385 NRELVALGSMNLCASVLGALPAFGGYGRSKINSFSGAQTVMSGVCMGVIVLLTVKFFLSQ 444

Query: 689 ISFIPVCIVGSLIFLLGWELIVEALLDT---WGKVTKFEYITIMIIVFTMGIYDFVLGIL 745
           I +IPVCI+  +  ++G  L+ EA  D    +      E +   + V T   Y   +G+ 
Sbjct: 445 IRYIPVCILSVITTIVGISLLEEAPADLRFHFNSRGYDELLVFAVTVLTTFFYSLEMGVC 504

Query: 746 VGILIACFSFLVDSTKLQT---VNGEFNGTVAKSTVY-RDYVQSQFLSGIA--EQIYVLK 799
           +G   +  S +  S K +       E  G    S  Y         L  I   E   V+K
Sbjct: 505 IGCGYSVISIIKHSAKSRIQILARVESTGQFINSDEYLSSATHPDDLPNIEELEGCLVVK 564

Query: 800 LQNVLFFGTIISIEEKIDMLLEI--------SDNDSSKRRIKYLILDLKNVNSDNIDYSA 851
           +   L F  +  ++E++  L           +     +  IKYL+ DL  +    +D SA
Sbjct: 565 IPEPLTFTNMEDLKERLTRLERFGSAIVHPGAKGSRERESIKYLVFDLNGMTF--MDSSA 622

Query: 852 AEGFNRIKRFTQSKRIQLIISSIKDTDKI 880
           A+    I +    +R+++ ++ +   +++
Sbjct: 623 AQIMLEIVKSYNRRRVKVFLARVPLDEQV 651

>KLTH0G16764g Chr7 complement(1454815..1456947) [2133 bp, 710 aa]
           {ON} similar to uniprot|P53394 Saccharomyces cerevisiae
           YPR003C Hypothetical ORF
          Length = 710

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 77/344 (22%), Positives = 141/344 (40%), Gaps = 39/344 (11%)

Query: 432 FCYVISCIFTGIVFFCLGKFKLGKLVGFFPRHILIGCIGGVGYFLIVTGIEVTTRVKKL- 490
            C +++ I +G + FC G  + G L     R +L G I  VG  +++  +    ++KK+ 
Sbjct: 168 LCLILTFI-SGAILFCFGIMRFGYLDSVLSRALLRGFISAVGLVMVLNSLITELKLKKVF 226

Query: 491 -----EY-----SLEFLLS-------VITNMSTLFKLVLPISLSVLLNILQKIYSHSLLL 533
                 Y      L FL         V T + +L    + +SL ++   L ++Y   + +
Sbjct: 227 NDAPGHYHAPFQKLIFLFHYAPGNYHVPTALLSLSSFSILMSLRLVKKRLSRVYKKVIFV 286

Query: 534 PSFYII----TFIAFHFIVALVPNLSLDSLRATGWIFPVAESSDTWYSHYKYFNFFNCHW 589
           P   I+    T  ++HF   L  N+ +      G I    E  DT     K+ N  +   
Sbjct: 287 PEILIVVALVTLGSYHFSFKLRYNIDI-----VGDI----EVGDT----SKFRNPLSKKN 333

Query: 590 DLVFKQI-PTMFALTFFGILHVPINVPALAMSVQMDKYDVDKELIAHGYSNLISGLFGSV 648
             +F ++    F +   G         +L  S ++     ++EL+A G  NL+  +FG++
Sbjct: 334 LSLFSELFHAGFMVALLGFFESTTASKSLGSSYELS-VSSNRELVALGSLNLVGSIFGAL 392

Query: 649 QNYLVYTNSVLFIRAGGNTASAGLVLAGFTAIILFIGPVIISFIPVCIVGSLIFLLGWEL 708
            ++  Y  S +   +G  T  +G+ +   T +        I  IPVC++  +  ++G  L
Sbjct: 393 PSFGGYGRSKINAYSGAATVMSGVFMGLITCVTSMFLLNAIHHIPVCVLSVITTMVGITL 452

Query: 709 IVEALLDTWGKVTKFEYITIMIIVFTMGIYDFVLGILVGILIAC 752
             EA  D         Y  ++I   T+ +  F   +  GI + C
Sbjct: 453 FEEAPADLRYHFRCRGYNELLIFALTV-LTTFFYSVEAGITLGC 495

>TBLA0C05270 Chr3 complement(1273901..1276231) [2331 bp, 776 aa]
           {ON} Anc_8.99 YPR003C
          Length = 776

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 51/85 (60%), Gaps = 4/85 (4%)

Query: 629 DKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASAGLVLAGFTAI--ILFIGP 686
           ++EL+A G SN++    G++ ++  Y  S +   +GG T  +G V  G T I  ILF+ P
Sbjct: 413 NRELVALGLSNIVISTLGALPSFGGYGRSKINALSGGKTLLSG-VFMGLTTILAILFLMP 471

Query: 687 VIISFIPVCIVGSLIFLLGWELIVE 711
           VI  +IPVCI+  +  ++G+ L+ E
Sbjct: 472 VI-HYIPVCILSVITTVIGFTLLEE 495

>ZYRO0F04796g Chr6 (399222..401429) [2208 bp, 735 aa] {ON} similar
           to uniprot|P53394 Saccharomyces cerevisiae YPR003C
           Hypothetical ORF
          Length = 735

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/137 (27%), Positives = 65/137 (47%), Gaps = 5/137 (3%)

Query: 629 DKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASAGLVLAGFTAI-ILFIGPV 687
           ++EL+A G  NL S + GS+  +  Y  S +   +G  T  +G  +     + I F+ P 
Sbjct: 393 NRELVALGSMNLFSSILGSLPAFGGYGRSKINAFSGAQTVMSGAFMGLLVLLTIKFLLP- 451

Query: 688 IISFIPVCIVGSLIFLLGWELIVEALLDTWGKVTKFEYITIMII---VFTMGIYDFVLGI 744
           +I +IP+C++  +  ++G  L+ EA  D       F Y  +++    V T   Y   +GI
Sbjct: 452 MIHYIPICVLSVVTTMVGISLLEEAPADLMFHFRCFGYDELLVFTLTVLTTMFYSVEVGI 511

Query: 745 LVGILIACFSFLVDSTK 761
            +G   +  S +  S K
Sbjct: 512 CIGCGYSVISIIKHSAK 528

>SAKL0H08800g Chr8 (753145..755007) [1863 bp, 620 aa] {ON} similar
           to uniprot|Q74ZI9 Ashbya gossypii AGR213C AGR213Cp and
           weakly similar to YPR003C uniprot|P53394 Saccharomyces
           cerevisiae YPR003C Hypothetical ORF
          Length = 620

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 59/275 (21%), Positives = 113/275 (41%), Gaps = 24/275 (8%)

Query: 629 DKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASAGLVLAGFTAIILFIGPVI 688
           ++EL++ G  NL+S +F ++  +  Y  S + I  G  T  +G+ ++    I +      
Sbjct: 272 NRELVSLGVVNLVSSIFSALPAFGGYGRSKMNISCGAQTQFSGVFVSLLAIICMNFLMNA 331

Query: 689 ISFIPVCIVGSLIFLLGWELIVEALLDT---WGKVTKFEYITIMIIVFTMGIYDFVLGIL 745
              +P+CI+  +I  + + L+ EA  D    W      E    +IIV T  ++    G+ 
Sbjct: 332 FHHLPICILAVIISTVAFSLLEEAPADLMFYWSVGGYQELFIFIIIVVTTLVWSPQFGVT 391

Query: 746 VGILIACFSFLVDSTKLQT-VNGEFNGTVAKSTVYRDYVQSQFLSGIAEQIYVLKLQNVL 804
           +G+ +     L  ST+ +  + G    T     +  D      L  I E++ V+K+   L
Sbjct: 392 MGMCLTMIRLLKHSTRSRVQILGRDPITYTFKNIDDDENSDIPLEEI-EKVMVVKIPEPL 450

Query: 805 FFGTIISIEEKIDMLLE-----------------ISDNDSSKRRIKYLILDLKNVNSDNI 847
            F  +  +   +  + +                 +S   S +  +KYL++DL  +    I
Sbjct: 451 IFSNVSDLRTSLKRMEKYGSLKVHPSYPLPLRQMLSPTTSGQVSLKYLVIDLFGMT--YI 508

Query: 848 DYSAAEGFNRIKRFTQSKRIQLIISSIKDTDKIYK 882
           D SA +    I      + I ++ +  K  D  +K
Sbjct: 509 DISALQALREIVDAYSRRNICVMFTRPKIPDLRHK 543

>AGR213C Chr7 complement(1156110..1158179) [2070 bp, 689 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPR003C
          Length = 689

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 64/281 (22%), Positives = 123/281 (43%), Gaps = 35/281 (12%)

Query: 626 YDVD----KELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASAGLV--LAGFTA 679
           +D+D    +EL++ G  N++  +F S+  +  Y  S L I  G  T  AG+   L+    
Sbjct: 343 FDIDVSSNRELVSLGLINIVGSVFSSLPAFGGYGRSKLNIFCGAQTPMAGIFVSLSAIFC 402

Query: 680 IILFIGPVIISFIPVCIVGSLIFLLGWELIVEALLDT---WGKVTKFEYITIMIIVFTMG 736
           +   +G  +  ++P+CI+  +I  + + L+ E   D    W      E IT   +V +  
Sbjct: 403 MRFLMG--VFHYLPLCILAVIISFIAYNLLEEVPGDMFFYWSVSGYQELITFSAVVLSTL 460

Query: 737 IYDFVLGILVGILIACFSFLVDSTKLQ-TVNGEFNGTVAKSTVYRDYVQSQFLSGIAEQI 795
           I+    G+++G+ +     L  +T+ +  + G+   T     +Y ++ +   L  I E+ 
Sbjct: 461 IWSPQFGLVMGLGLTMIRLLKHTTQSRIQILGKDPITKKFRNIYSEHNEEIPLEEI-EKT 519

Query: 796 YVLKLQNVLFFGTIISIEEKIDML-----LEISDNDSSKRR-------------IKYLIL 837
            V+K+   L F  +  + +K+  L     L +  +  +  R             +KY+I+
Sbjct: 520 MVIKVPEPLVFWNVPDLMKKVKRLEKYGSLYVHPSYPTSLRPVSGVTTLKDNVYVKYIIM 579

Query: 838 DLKNVNSDNIDYSAAEGFNRIKRFTQSKRIQLII--SSIKD 876
           DL  +    ID SA +    +      + I +I   SSI+D
Sbjct: 580 DLLGMT--YIDMSALQALVDMVVNYHKRGIYVIFCRSSIRD 618

>CAGL0L09207g Chr12 complement(999571..1001748) [2178 bp, 725 aa]
           {ON} some similarities with uniprot|P53394 Saccharomyces
           cerevisiae YPR003c
          Length = 725

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 60/270 (22%), Positives = 120/270 (44%), Gaps = 26/270 (9%)

Query: 626 YDVDKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASAGLVLAGFTAIILFIG 685
           Y  ++ELIA G+ N++  LFG++ ++  Y  S + + +GG T  +G ++   T +   + 
Sbjct: 374 YSSNRELIALGFMNIVGSLFGALPSFGGYGRSKVNVFSGGKTVMSGAMVGLITLLTAKLL 433

Query: 686 PVIISFIPVCIVGSLIFLLGWELIVEALLDTWGKV--TKFEYITIMIIVFTMGIYDFV-L 742
             +I + P C++  +  ++G  L+ E   D    +  + +  +T+  + F   +   V L
Sbjct: 434 LPMIHYTPTCVLSVITTVIGISLLEEVPSDIKFHIHCSGYSELTVFTLTFIATLSQSVEL 493

Query: 743 GILVG-----ILIACFSFLVDSTKLQTVNG--EFNGTVAKSTVYRDYVQSQFLSGIAEQI 795
           G+ VG     ILI   S L     L  + G  EF   V      ++Y    F +   EQ 
Sbjct: 494 GVTVGCIYSLILIVKHSALSRIQILAKLEGSDEF---VNVDDYIKNYNGRDFENITLEQF 550

Query: 796 ---YVLKLQNVLFFGTIISIEEKIDMLLEISDND--------SSKRRIKYLILDLKNVNS 844
              Y++K+   L F     +  ++  L      +         S+  ++Y+I DL+ + S
Sbjct: 551 EHCYIVKIPEPLTFTNGEDLRSRLSRLERFGSTNVHPGSTSIVSQDDMEYIIFDLEGMTS 610

Query: 845 DNIDYSAAEGFNRIKRFTQSKRIQLIISSI 874
             +D  +A+    I R    + +++ ++ +
Sbjct: 611 --MDSGSAQILLEIIRSYVHRDVRVYLTRV 638

>KNAG0D02390 Chr4 (420952..423102) [2151 bp, 716 aa] {ON} Anc_8.99
           YPR003C
          Length = 716

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 61/137 (44%), Gaps = 5/137 (3%)

Query: 629 DKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASAGLVLAGFTAI-ILFIGPV 687
           ++EL+A G  N I   FG +  +  Y  S +   +G  T  AG+ +   T   I F+ PV
Sbjct: 375 NRELVALGLMNTIGSAFGIIPAFGGYGRSKINAFSGAQTVMAGVFMGSVTLFTIKFLLPV 434

Query: 688 IISFIPVCIVGSLIFLLGWELIVEALLDTWGKVTKFEYITIMIIVFTM---GIYDFVLGI 744
           I  +IP C++  +   +G  L+ EA  D    +    Y  +++ V T      Y    GI
Sbjct: 435 I-HYIPTCVLSVITTFVGVSLLEEAPHDIKFHIRCKGYDELIMFVLTFLCTCFYSIEFGI 493

Query: 745 LVGILIACFSFLVDSTK 761
           L G   +  S +  S +
Sbjct: 494 LAGCTYSLISIVKHSAQ 510

>Kwal_27.11039 s27 complement(614861..617041) [2181 bp, 726 aa] {ON}
           YPR003C - Hypothetical ORF [contig 31] FULL
          Length = 726

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 57/127 (44%), Gaps = 13/127 (10%)

Query: 629 DKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASAGLVLAGFTAIILFIGPVI 688
           ++EL+A G  NL+  LFG++ ++  Y  S +   +G  T  +G+ +   T I        
Sbjct: 388 NRELVALGSLNLVGSLFGALPSFGGYGRSKINAYSGAATVMSGVFMGLITLITSKFLLNA 447

Query: 689 ISFIPVCIVGSLIFLLGWELIVEALLDTWGKVTKF--------EYITIMIIVFTMGIYDF 740
           I  IP+C++  +  ++G  L  EA  D      KF        E +T  I V T   Y  
Sbjct: 448 IRHIPICVLSVITTMVGISLFEEAPAD-----LKFHFRCRGYNELLTFAITVLTTFFYSV 502

Query: 741 VLGILVG 747
             GI +G
Sbjct: 503 EAGITLG 509

>Skud_12.160 Chr12 (306715..309396) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 36.6 bits (83), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 46/204 (22%), Positives = 82/204 (40%), Gaps = 28/204 (13%)

Query: 606 GILHVPINV-----PALAMSV---------------QMDKYDV--DKELIAHGYSNLISG 643
           G+ HVP  +     P+L  S+               +++ Y V  D+ELIA G SNL+  
Sbjct: 396 GVFHVPSGLMSKLGPSLPSSIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGT 455

Query: 644 LFGSVQNYLVYTNSVLFIRAGGNTASAGLVLAGFTAIILFIGPVIISFIPVCIVGSLIFL 703
            F +      ++ S L  +    T  +GL       + L+       +IP   + ++I  
Sbjct: 456 FFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIH 515

Query: 704 LGWELIVEALLDTWG--KVTKFEYITIMIIVFTMGIYDFVLGILVGILIACFSFLVDSTK 761
              +L+  +   TW   K+   ++I  ++ V          GI   +  +C   L+   K
Sbjct: 516 AVSDLLA-SYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLLL---K 571

Query: 762 LQTVNGEFNGTVAKSTVYRDYVQS 785
           +    G+F G V  + V   YV++
Sbjct: 572 VAFPAGKFLGRVEIAEVTDAYVKA 595

>Suva_10.176 Chr10 (328373..331054) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 36.6 bits (83), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 48/204 (23%), Positives = 85/204 (41%), Gaps = 28/204 (13%)

Query: 606 GILHVPI--------NVPA---------LAMSV---QMDKYDV--DKELIAHGYSNLISG 643
           G+ HVP         N+PA         +A+S    +++ Y V  D+ELIA G SNL+  
Sbjct: 396 GVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRVNDYKVVPDQELIAIGVSNLLGT 455

Query: 644 LFGSVQNYLVYTNSVLFIRAGGNTASAGLVLAGFTAIILFIGPVIISFIPVCIVGSLIFL 703
            F +      ++ S L  +    T  +GL       + L+       +IP   + ++I  
Sbjct: 456 FFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIH 515

Query: 704 LGWELIVEALLDTWG--KVTKFEYITIMIIVFTMGIYDFVLGILVGILIACFSFLVDSTK 761
              +L+  +   TW   K+   ++I  ++ V          GI   +  +C  F++   K
Sbjct: 516 AVSDLLA-SYQTTWNFWKMNPLDFICFIVTVLITVFSSIENGIYFAMCWSCAIFIL---K 571

Query: 762 LQTVNGEFNGTVAKSTVYRDYVQS 785
           +    G+F G V  + V   YV++
Sbjct: 572 VAFPAGKFLGRVEIAEVTDAYVRA 595

>Smik_12.151 Chr12 (303440..306121) [2682 bp, 893 aa] {ON} YLR092W
           (REAL)
          Length = 893

 Score = 36.2 bits (82), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 47/204 (23%), Positives = 84/204 (41%), Gaps = 28/204 (13%)

Query: 606 GILHVP--------INVPA---------LAMSV---QMDKYDV--DKELIAHGYSNLISG 643
           G+ HVP         N+PA         +A+S    +++ Y V  D+ELIA G SNL+  
Sbjct: 396 GVFHVPSGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGT 455

Query: 644 LFGSVQNYLVYTNSVLFIRAGGNTASAGLVLAGFTAIILFIGPVIISFIPVCIVGSLIFL 703
            F +      ++ S L  +    T  +GL       + L+       +IP   + ++I  
Sbjct: 456 FFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIH 515

Query: 704 LGWELIVEALLDTWG--KVTKFEYITIMIIVFTMGIYDFVLGILVGILIACFSFLVDSTK 761
              +L+  +   TW   K+   ++I  ++ V          GI   +  +C   L+   K
Sbjct: 516 AVSDLLA-SYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLLL---K 571

Query: 762 LQTVNGEFNGTVAKSTVYRDYVQS 785
           +    G+F G V  + V   Y+++
Sbjct: 572 MAFPAGKFLGRVEIAEVTDAYIKA 595

>YBR294W Chr2 (789235..791814) [2580 bp, 859 aa] {ON}  SUL1High
           affinity sulfate permease of the SulP anion transporter
           family; sulfate uptake is mediated by specific sulfate
           transporters Sul1p and Sul2p, which control the
           concentration of endogenous activated sulfate
           intermediates
          Length = 859

 Score = 35.8 bits (81), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 42/167 (25%), Positives = 69/167 (41%), Gaps = 8/167 (4%)

Query: 622 QMDKYDV--DKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASAGLVLAGFTA 679
           +++ Y V  D+ELIA G +NLI   F S      ++ S L  +    T  +G+   G   
Sbjct: 416 RINDYKVVPDQELIAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGVFTGGCVL 475

Query: 680 IILFIGPVIISFIPVCIVGSLIFLLGWELIVEALLDTW--GKVTKFEYITIMIIVFTMGI 737
           + L+       FIP   + ++I     +L+  +   TW   K    + I+ ++ VF    
Sbjct: 476 LALYCLTDAFFFIPKATLSAVIIHAVSDLLT-SYKTTWTFWKTNPLDCISFIVTVFITVF 534

Query: 738 YDFVLGILVGILIACFSFLVDSTKLQTVNGEFNGTVAKSTVYRDYVQ 784
                GI   +  +C   L+   K     G+F G V  + V    VQ
Sbjct: 535 SSIENGIYFAMCWSCAMLLL---KQAFPAGKFLGRVEVAEVLNPTVQ 578

>NCAS0B05050 Chr2 (937285..940056) [2772 bp, 923 aa] {ON} Anc_8.271
          Length = 923

 Score = 35.8 bits (81), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 42/184 (22%), Positives = 76/184 (41%), Gaps = 9/184 (4%)

Query: 616 ALAMSV-QMDKYDV--DKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASAGL 672
           A+A S  +++ Y V  D+ELIA G +NLI   F +      ++ S L  +    T  +G+
Sbjct: 451 AIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCKVRTPLSGI 510

Query: 673 VLAGFTAIILFIGPVIISFIPVCIVGSLIFLLGWELIVEALLDTWG--KVTKFEYITIMI 730
                  + L+       +IP   + ++I     +LI    + TW   K+   + +  ++
Sbjct: 511 FTGACVLLALYCLTGAFFYIPKATLSAVIIQAVSDLIASYKI-TWNFWKMNPLDCLCFLV 569

Query: 731 IVFTMGIYDFVLGILVGILIACFSFLVDSTKLQTVNGEFNGTVAKSTVYRDYVQSQFLSG 790
            VF         GI   +  +C   L+   K+    G+F G +  + V   YV +   S 
Sbjct: 570 TVFITVFSSIENGIYFAVCWSCAILLL---KVCFPAGKFLGRIEVAEVIDGYVDNSIESA 626

Query: 791 IAEQ 794
              +
Sbjct: 627 TTAE 630

>YLR092W Chr12 (323544..326225) [2682 bp, 893 aa] {ON}  SUL2High
           affinity sulfate permease; sulfate uptake is mediated by
           specific sulfate transporters Sul1p and Sul2p, which
           control the concentration of endogenous activated
           sulfate intermediates
          Length = 893

 Score = 35.4 bits (80), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 50/214 (23%), Positives = 89/214 (41%), Gaps = 30/214 (14%)

Query: 606 GILHVPI--------NVPA---------LAMSV---QMDKYDV--DKELIAHGYSNLISG 643
           G+ HVP         N+PA         +A+S    +++ Y V  D+ELIA G SNL+  
Sbjct: 396 GVFHVPPGLMSKLGPNLPASIIVLLLEHIAISKSFGRINDYKVVPDQELIAIGVSNLLGT 455

Query: 644 LFGSVQNYLVYTNSVLFIRAGGNTASAGLVLAGFTAIILFIGPVIISFIPVCIVGSLIFL 703
            F +      ++ S L  +    T  +GL       + L+       +IP   + ++I  
Sbjct: 456 FFNAYPATGSFSRSALKAKCNVRTPLSGLFSGSCVLLALYCLTGAFFYIPKATLSAVIIH 515

Query: 704 LGWELIVEALLDTWG--KVTKFEYITIMIIVFTMGIYDFVLGILVGILIACFSFLVDSTK 761
              +L+  +   TW   K+   ++I  ++ V          GI   +  +C   ++   K
Sbjct: 516 AVSDLLA-SYQTTWNFWKMNPLDFICFIVTVLITVFASIEDGIYFAMCWSCAMLIL---K 571

Query: 762 LQTVNGEFNGTVAKSTVYRDYVQ--SQFLSGIAE 793
           +    G+F G V  + V   YV+  S  +S ++E
Sbjct: 572 VAFPAGKFLGRVEVAEVTDAYVRPDSDVVSYVSE 605

>SAKL0H16830g Chr8 complement(1479446..1482034) [2589 bp, 862 aa]
           {ON} similar to uniprot|Q12325 Saccharomyces cerevisiae
           YLR092W SUL2 High affinity sulfate permease sulfate
           uptake is mediated by specific sulfate transporters
           Sul1p and Sul2p which control the concentration of
           endogenous activated sulfate intermediates and
           uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
          Length = 862

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 41/176 (23%), Positives = 72/176 (40%), Gaps = 10/176 (5%)

Query: 622 QMDKYDV--DKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASAGLVLAGFTA 679
           +++ Y V  D+ELIA G +NL+   F +      ++ S L  +    T  +G+       
Sbjct: 427 RINDYKVVPDQELIAIGVTNLVGTFFNAYPATGSFSRSALKAKCNVRTPLSGVFTGACVL 486

Query: 680 IILFIGPVIISFIPVCIVGSLIFLLGWELIV--EALLDTWGKVTKFEYITIMIIVFTMGI 737
           + L+       +IP   + ++I     +LI   E   + W K+   + +  ++ VF    
Sbjct: 487 LALYCLTEAFYYIPKATLSAVIIHAVSDLIASYETTWNFW-KMNPLDCLCFLVTVFITIF 545

Query: 738 YDFVLGILVGILIACFSFLVDSTKLQTVNGEFNGTVAKSTVYRDYVQSQFLSGIAE 793
                GI   I  +C   L    K+   +G+F G V  S V    V+     G+ E
Sbjct: 546 SSIENGIYFAICWSCAILLF---KIAFPSGKFLGRVEVSEVINPTVREDL--GVVE 596

>NDAI0B02020 Chr2 (501062..503779) [2718 bp, 905 aa] {ON} Anc_8.271
          Length = 905

 Score = 34.3 bits (77), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 74/177 (41%), Gaps = 9/177 (5%)

Query: 616 ALAMSV-QMDKYDV--DKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASAGL 672
           A+A S  +++ Y V  D+ELIA G +NLI   F +      ++ S L  +    T  +GL
Sbjct: 437 AIAKSFGRINDYKVVPDQELIAIGVTNLIGTFFNAYPATGSFSRSALKAKCEVRTPLSGL 496

Query: 673 VLAGFTAIILFIGPVIISFIPVCIVGSLIFLLGWELIVEALLDTWG--KVTKFEYITIMI 730
                  + L+    +  +IP   + ++I     +LI  +   TW   K+   +  + ++
Sbjct: 497 FTGSCVLLALYCLTGVFLYIPKATLSAVIIHAVSDLIA-SYHTTWNFWKMNPLDCFSFIV 555

Query: 731 IVFTMGIYDFVLGILVGILIACFSFLVDSTKLQTVNGEFNGTVAKSTVYRDYVQSQF 787
            VF         GI   +   C+S  +   K+    G+F G V  + V    V   F
Sbjct: 556 TVFITVFSSIENGIYFAM---CWSCAILVLKVAFPAGKFLGRVEIAEVVNGCVDDSF 609

>Suva_4.554 Chr4 (962125..964677) [2553 bp, 850 aa] {ON} YBR294W
           (REAL)
          Length = 850

 Score = 33.9 bits (76), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 67/167 (40%), Gaps = 8/167 (4%)

Query: 622 QMDKYDV--DKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASAGLVLAGFTA 679
           +++ Y V  D+ELIA G +NL+   F S      ++ S L  +    T  +GL   G   
Sbjct: 410 RINDYKVVPDQELIAIGVTNLVGTFFHSYPATGSFSRSALKAKCNVRTPFSGLFTGGCVL 469

Query: 680 IILFIGPVIISFIPVCIVGSLIFLLGWELIV--EALLDTWGKVTKFEYITIMIIVFTMGI 737
           + L+       FIP   + ++I     +L+   E     W K    + ++ ++ VF    
Sbjct: 470 LALYCLTDAFFFIPKATLSAVIIHAVSDLLTSYETTWTFW-KTNPLDCVSFIVTVFITVF 528

Query: 738 YDFVLGILVGILIACFSFLVDSTKLQTVNGEFNGTVAKSTVYRDYVQ 784
                GI   +  +C   L+   K     G F G V  + +    +Q
Sbjct: 529 SSIENGIYFAMCWSCAILLL---KQAFPAGRFLGRVEVAEILNPTLQ 572

>NDAI0E01400 Chr5 complement(279960..280937) [978 bp, 325 aa] {ON}
           Anc_8.644
          Length = 325

 Score = 32.7 bits (73), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 39/74 (52%), Gaps = 5/74 (6%)

Query: 743 GILVGILIACFSFLVDSTKLQTVNGEFNGT--VAKSTVYRDYVQSQFLSGIAEQIYVLKL 800
           GI+  I+I  F  +    KLQ VN +FNG   V K TV ++ ++  + +G+   I+   +
Sbjct: 148 GIIESIVIVPFELV--KIKLQDVNCKFNGPVDVLKDTVKKNGIKGLY-NGLESTIWRNGV 204

Query: 801 QNVLFFGTIISIEE 814
            N  +FG I  + E
Sbjct: 205 WNAGYFGIIFQVRE 218

>Skud_2.424 Chr2 (758785..761376) [2592 bp, 863 aa] {ON} YBR294W
           (REAL)
          Length = 863

 Score = 33.1 bits (74), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 67/167 (40%), Gaps = 8/167 (4%)

Query: 622 QMDKYDV--DKELIAHGYSNLISGLFGSVQNYLVYTNSVLFIRAGGNTASAGLVLAGFTA 679
           +++ Y V  D+ELIA G +NLI   F S      ++ S L  +    T  +G+       
Sbjct: 420 RINDYKVIPDQELIAIGVTNLIGTFFHSYPATGSFSRSALKAKCNVRTPFSGIFTGACVL 479

Query: 680 IILFIGPVIISFIPVCIVGSLIFLLGWELIVEALLDTW--GKVTKFEYITIMIIVFTMGI 737
           + L+       FIP   + ++I     +L+  +   TW   K    + I+ +  VF    
Sbjct: 480 LALYCLTSAFFFIPKATLSAVIIHAVSDLLT-SYKTTWIFWKTNPLDCISFIATVFITVF 538

Query: 738 YDFVLGILVGILIACFSFLVDSTKLQTVNGEFNGTVAKSTVYRDYVQ 784
                GI   +  +C   L+   K     G+F G V  + V    VQ
Sbjct: 539 SSIENGIYFAMCWSCAMLLL---KQAFPAGKFLGRVEVAEVLNPTVQ 582

>Smik_13.32 Chr13 (64435..65841) [1407 bp, 468 aa] {ON} YML102W
           (REAL)
          Length = 468

 Score = 32.0 bits (71), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 30/63 (47%), Gaps = 1/63 (1%)

Query: 209 TATSMFNNTNSTATSVQSLKIGNNEILKTISGDNGGIVNRLPIQELDEDIIDNDEYSRLL 268
           T T         A   + L+  ++ +      D+GGI+N LP +++  D  DN +  R+ 
Sbjct: 404 TETQFGTRIEPPALRTEQLETNDSTVAAKNQSDSGGIINMLPAKKVTGDSNDNKK-RRIQ 462

Query: 269 PTP 271
           PTP
Sbjct: 463 PTP 465

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.137    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 114,971,477
Number of extensions: 5168038
Number of successful extensions: 20223
Number of sequences better than 10.0: 121
Number of HSP's gapped: 20861
Number of HSP's successfully gapped: 138
Length of query: 1150
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1029
Effective length of database: 39,606,813
Effective search space: 40755410577
Effective search space used: 40755410577
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)