Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0C014801.398ON3531769371e-125
ZYRO0E04598g1.398ON3571757499e-97
YNL007C (SIS1)1.398ON3521757351e-94
TDEL0B059601.398ON3691757361e-94
Smik_14.3211.398ON3661757351e-94
KNAG0H016801.398ON3631757299e-94
CAGL0H03707g1.398ON3491757271e-93
Suva_14.3411.398ON3591757254e-93
NCAS0G036101.398ON3271767207e-93
Skud_14.3201.398ON3681757202e-92
NDAI0C026101.398ON3401757182e-92
TPHA0B037601.398ON3551757123e-91
Kwal_0.2071.398ON3531757053e-90
KLTH0H12100g1.398ON3501757053e-90
KAFR0H031501.398ON3591757012e-89
SAKL0D08778g1.398ON3481756992e-89
NCAS0C048901.398ON3671767003e-89
Kpol_457.151.398ON3571746932e-88
AAL008W1.398ON3491756881e-87
NDAI0G042501.398ON3631766847e-87
Ecym_12921.398ON3471766774e-86
KLLA0D04818g1.398ON3541756699e-85
Kpol_1003.122.243ON408702584e-24
TBLA0E038102.243ON410702522e-23
CAGL0J09966g2.243ON407702514e-23
KAFR0J009402.243ON411732471e-22
Skud_14.2682.243ON410732471e-22
TPHA0C031102.243ON407692452e-22
Smik_14.2632.243ON409702443e-22
KLLA0F03333g2.243ON409732443e-22
Suva_14.2772.243ON409732425e-22
SAKL0E08734g2.243ON411682425e-22
NCAS0G030002.243ON410682391e-21
Ecym_32812.243ON409682372e-21
KNAG0I019002.243ON409732372e-21
YNL064C (YDJ1)2.243ON409732355e-21
TDEL0C046002.243ON411692345e-21
ZYRO0A01496g2.243ON412702321e-20
ADL257C2.243ON410682275e-20
KLTH0G09394g2.243ON411682251e-19
NDAI0D010302.243ON411692213e-19
Kwal_23.48302.243ON411682196e-19
TPHA0L007907.157ON446752082e-17
KLLA0E07899g2.218ON495712064e-17
TDEL0C043502.218ON462712038e-17
KAFR0A041608.730ON378772028e-17
Smik_14.2492.218ON533711985e-16
YNL077W (APJ1)2.218ON528711985e-16
TBLA0J018707.157ON470751969e-16
NDAI0B020008.264ON433741959e-16
Suva_14.2622.218ON536711951e-15
TDEL0H022907.217ON387751931e-15
Skud_14.2532.218ON532711932e-15
Kwal_26.90248.730ON375771912e-15
TBLA0A011007.157ON434751922e-15
YIR004W (DJP1)7.157ON432711913e-15
TDEL0B037908.730ON373701903e-15
AGR084C8.264ON427681913e-15
KNAG0G028808.730ON378701894e-15
Ecym_53842.218ON503731905e-15
NCAS0E029307.217ON387751886e-15
KLTH0D12496g8.730ON375701869e-15
ZYRO0C01606g8.264ON432681871e-14
Kpol_1002.1222.218ON503711871e-14
AER427W2.218ON470711862e-14
NDAI0A028207.157ON482711862e-14
Suva_9.2137.157ON431711852e-14
Skud_9.1817.157ON421711852e-14
SAKL0H16984g8.264ON435731842e-14
Ecym_56262.350ON243671792e-14
CAGL0J10296g2.218ON479711842e-14
NCAS0B050308.264ON433721842e-14
Ecym_43727.217ON579761853e-14
Kpol_1070.227.217ON380751833e-14
KNAG0M020202.218ON460651843e-14
TDEL0H032107.157ON411751833e-14
KNAG0L013307.217ON396751824e-14
TBLA0E036602.218ON448711834e-14
Smik_9.2037.157ON432711824e-14
ZYRO0D16390g7.217ON398751824e-14
TPHA0C012607.217ON380751806e-14
NCAS0B005308.730ON375701806e-14
ZYRO0A06226g8.730ON377701807e-14
KLTH0G08756g2.218ON462711817e-14
SAKL0H05258g8.730ON368701797e-14
KAFR0L007407.217ON364751797e-14
KLLA0E04423g7.217ON428731807e-14
CAGL0H04499g2.350ON232671741e-13
ZYRO0C15048g2.218ON491711791e-13
Kpol_499.307.157ON408751781e-13
Ecym_62368.730ON374701771e-13
NCAS0A132107.157ON414711781e-13
CAGL0F03729g8.730ON361701771e-13
CAGL0L00957g7.217ON373751762e-13
ZYRO0G03850g7.157ON418751772e-13
Ecym_43068.264ON434681762e-13
AER346W8.730ON367701752e-13
Suva_13.3978.730ON375701752e-13
Smik_12.1498.264ON460711763e-13
SAKL0E06050g2.350ON232671703e-13
Kpol_1064.408.730ON387701753e-13
TBLA0E024907.217ON366751743e-13
AFL190C2.350ON235671703e-13
KLTH0A03740g7.217ON395711744e-13
SAKL0E09306g2.218ON461701745e-13
YER048C (CAJ1)7.217ON391751735e-13
NDAI0E045607.217ON394751735e-13
Kwal_47.181337.217ON393711735e-13
Smik_13.4228.730ON378701726e-13
CAGL0J02750g7.217ON382751726e-13
Suva_5.1507.217ON391751726e-13
ADR015W7.157ON436751727e-13
TBLA0D042407.217ON389751727e-13
Smik_5.1737.217ON391751728e-13
Kwal_23.30612.218ON458661728e-13
KLLA0E01629g2.350ON231681678e-13
Skud_5.1587.217ON391751719e-13
KLLA0F19184g8.264ON512701729e-13
Suva_14.1162.15ON600671729e-13
TDEL0F039108.264ON429701711e-12
KNAG0I007407.157ON425711711e-12
SAKL0F04444g7.157ON429751701e-12
KLTH0F09944g2.350ON233671651e-12
TPHA0C029802.218ON554711702e-12
ABL194C2.15ON552671702e-12
KLLA0D13464g7.157ON433761692e-12
YMR214W (SCJ1)8.730ON377701682e-12
SAKL0F08052g7.217ON393751682e-12
TPHA0C045902.350ON233671632e-12
TPHA0G006308.730ON393701673e-12
Ecym_44697.157ON433751683e-12
Skud_13.3232.350ON224671623e-12
Suva_10.1748.264ON456681683e-12
KAFR0B047807.157ON423711673e-12
YLR090W (XDJ1)8.264ON459711673e-12
CAGL0J01936g7.157ON425711673e-12
KLLA0C07260g8.730ON368691664e-12
Kwal_23.3578singletonOFF85641524e-12
ZYRO0A07502g2.350ON238681624e-12
TDEL0G028002.350ON225671614e-12
Skud_14.1102.15ON596641675e-12
YMR161W (HLJ1)2.350ON224671606e-12
KLTH0F13398g7.157ON419751647e-12
KNAG0I008602.350ON219681598e-12
Smik_14.1062.15ON593641658e-12
Skud_13.3838.730ON375701621e-11
NDAI0F024502.218ON530671631e-11
TBLA0B093802.350ON227671581e-11
KAFR0C024507.217ON373751611e-11
KAFR0A079502.15ON551671622e-11
NCAS0D009602.350ON224671562e-11
NDAI0F038002.15ON638671622e-11
Smik_13.3612.350ON224671562e-11
Kwal_55.209657.157ON421741612e-11
YNL227C (JJJ1)2.15ON590671612e-11
Skud_12.1588.264ON455741603e-11
NDAI0H031802.350ON229671544e-11
ZYRO0F15400g2.15ON525671594e-11
TBLA0G001702.15ON659671594e-11
SAKL0E14234g2.15ON678671594e-11
KAFR0B048902.350ON220671535e-11
Suva_13.3402.350ON225681536e-11
Kpol_526.62.350ON228671527e-11
CAGL0J07370g2.15ON623671577e-11
KLLA0D19602g2.15ON620671578e-11
Kwal_56.237828.264ON414671551e-10
Kwal_23.44202.15ON592671561e-10
KNAG0G011308.61ON500611523e-10
KLTH0B08338g2.15ON590671523e-10
KLTH0G13640g8.264ON414671514e-10
NCAS0G013602.15ON616671514e-10
Kpol_529.212.15ON622671515e-10
Kpol_543.408.264ON414651496e-10
AFR507W8.61ON474621496e-10
KNAG0F008602.15ON626671498e-10
TPHA0O019402.15ON598671498e-10
Kpol_1072.48.698ON661701499e-10
CAGL0L12276g8.264ON452701461e-09
NDAI0E008708.730ON376641424e-09
SAKL0C02904g1.92ON281731404e-09
TPHA0D005508.61ON486661425e-09
ZYRO0D10934g8.698ON663701426e-09
KNAG0G020508.264ON432561391e-08
KNAG0J018408.698ON650701401e-08
CAGL0G07469g8.698ON668701391e-08
TPHA0A017908.264ON439701391e-08
TDEL0E005002.15ON581671391e-08
NCAS0C012208.698ON669701372e-08
KAFR0H023108.698ON655701372e-08
Ecym_10971.92ON270701333e-08
KNAG0B018901.92ON370721344e-08
TBLA0B037308.698ON693701354e-08
TBLA0A055601.92ON312701335e-08
ADL111W7.217ON578761345e-08
TDEL0A064308.698ON666701346e-08
KNAG0A056502.350ON175661277e-08
SAKL0H00858g5.4ON432771328e-08
Smik_15.4378.698ON663761329e-08
Suva_8.3038.698ON664701329e-08
ZYRO0G18436g1.185ON503651321e-07
Skud_15.4208.698ON665761311e-07
AFR639W1.113ON156591231e-07
Kpol_1060.35.4ON432771292e-07
TBLA0B034908.730ON384711292e-07
YOR254C (SEC63)8.698ON663761302e-07
TDEL0C036801.185ON556681292e-07
Kwal_33.138601.185ON578671283e-07
KAFR0A015301.92ON277541263e-07
KLLA0C09823g8.698ON669701283e-07
YJL073W (JEM1)1.297ON645751274e-07
Ecym_14508.61ON492661264e-07
KLTH0F04906g1.185ON590671257e-07
AFR659W1.92ON273711227e-07
KLLA0D06402g1.297ON631661257e-07
TPHA0I011101.297ON666671241e-06
Kwal_26.94955.4ON428771231e-06
Skud_10.1691.297ON644751231e-06
Kwal_14.24521.297ON607661231e-06
Kwal_26.88798.698ON656701231e-06
TBLA0C071605.4ON430781212e-06
NDAI0B002001.185ON594671212e-06
YGR285C (ZUO1)5.4ON433721203e-06
Kpol_1027.131.297ON641661213e-06
KAFR0A016201.297ON665661203e-06
NCAS0G028502.218ON494721203e-06
Smik_10.1681.297ON649751203e-06
KLTH0D11770g8.698ON652701203e-06
Suva_12.1851.113ON168691143e-06
TPHA0G014808.698ON660701203e-06
TPHA0A056505.4ON433781193e-06
KLLA0F03124g5.4ON433781193e-06
SAKL0H05984g8.698ON658701194e-06
Kwal_47.179578.61ON478631194e-06
NDAI0G032808.61ON552661194e-06
Kwal_33.135331.113ON161691134e-06
TDEL0C008708.61ON470691184e-06
CAGL0H02827g1.297ON656671194e-06
SAKL0C05456g1.185ON583651184e-06
NCAS0I028301.185ON491641185e-06
KNAG0C024501.185ON544641185e-06
Smik_16.235.4ON433721175e-06
Ecym_23748.698ON661701186e-06
Skud_7.6185.4ON433721176e-06
ZYRO0F03652g8.61ON462601176e-06
KLTH0F02596g1.92ON282731157e-06
Suva_6.1481.297ON642661178e-06
NCAS0E041905.4ON431721168e-06
KNAG0E012205.4ON434711168e-06
SAKL0D06226g1.297ON615661168e-06
Smik_10.681.185ON560641168e-06
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0C01480
         (353 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa] {O...   365   e-125
ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa] {...   293   9e-97
YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON} ...   287   1e-94
TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa] ...   288   1e-94
Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa] {...   287   1e-94
KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa] {O...   285   9e-94
CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa] {...   284   1e-93
Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa] {...   283   4e-93
NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398     281   7e-93
Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa] {...   281   2e-92
NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON}              281   2e-92
TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON} Anc_1.3...   278   3e-91
Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON} ...   276   3e-90
KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]...   276   3e-90
KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON} Anc_1.3...   274   2e-89
SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} simila...   273   2e-89
NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON} Anc_1.398    274   3e-89
Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON} (41492..4...   271   2e-88
AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic ho...   269   1e-87
NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON} Anc_1...   268   7e-87
Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}...   265   4e-86
KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa] {...   262   9e-85
Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa] {O...   103   4e-24
TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa] {O...   101   2e-23
CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa] ...   101   4e-23
KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa] {...   100   1e-22
Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa] {...   100   1e-22
TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa] {O...    99   2e-22
Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa] {...    99   3e-22
KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa] {...    99   3e-22
Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa] {...    98   5e-22
SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} simila...    98   5e-22
NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa] {O...    97   1e-21
Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}...    96   2e-21
KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON} Anc_2.2...    96   2e-21
YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON} ...    95   5e-21
TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa] {O...    95   5e-21
ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa] {...    94   1e-20
ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON} S...    92   5e-20
KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa] {...    91   1e-19
NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa] {O...    90   3e-19
Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa] {O...    89   6e-19
TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON} Anc_7....    85   2e-17
KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa] {...    84   4e-17
TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON} Anc_2.2...    83   8e-17
KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON} Anc_8.7...    82   8e-17
Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077...    81   5e-16
YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}  APJ1Putat...    81   5e-16
TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa] {...    80   9e-16
NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON} Anc_8.264     80   9e-16
Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077...    80   1e-15
TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON} Anc_7.2...    79   1e-15
Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077...    79   2e-15
Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON} YMR21...    78   2e-15
TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON} Anc_7.1...    79   2e-15
YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}  DJP1Cytoso...    78   3e-15
TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa] {O...    78   3e-15
AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON} S...    78   3e-15
KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON} Anc_8.7...    77   4e-15
Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar t...    78   5e-15
NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON} Anc_7.217     77   6e-15
KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON} simi...    76   9e-15
ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa] {...    77   1e-14
Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON} (305...    77   1e-14
AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic ...    76   2e-14
NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa] {O...    76   2e-14
Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W ...    76   2e-14
Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W ...    76   2e-14
SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]...    75   2e-14
Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar ...    74   2e-14
CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa...    75   2e-14
NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON} Anc_8.264     75   2e-14
Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}...    76   3e-14
Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON} (52022....    75   3e-14
KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa] {...    75   3e-14
TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON} Anc_7.1...    75   3e-14
KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa] {...    75   4e-14
TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON} Anc_2.2...    75   4e-14
Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W ...    75   4e-14
ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]...    75   4e-14
TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON} Anc_7.2...    74   6e-14
NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730       74   6e-14
ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa] {...    74   7e-14
KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa] {...    74   7e-14
SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa] {...    74   7e-14
KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa] {...    74   7e-14
KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa] {...    74   7e-14
CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa] {O...    72   1e-13
ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]...    74   1e-13
Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON} (76723..7...    73   1e-13
Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar t...    73   1e-13
NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON} Anc_7...    73   1e-13
CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa] {...    73   1e-13
CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON} simil...    72   2e-13
ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa] {...    73   2e-13
Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}...    72   2e-13
AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic ...    72   2e-13
Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214...    72   2e-13
Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090...    72   3e-13
SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some si...    70   3e-13
Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON} (74841....    72   3e-13
TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa] {O...    72   3e-13
AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON} Synt...    70   3e-13
KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa] {...    72   4e-13
SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa] {...    72   5e-13
YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}  ...    71   5e-13
NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON}             71   5e-13
Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa] {...    71   5e-13
Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214...    71   6e-13
CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa] ...    71   6e-13
Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON...    71   6e-13
ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic ho...    71   7e-13
TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON} Anc_7...    71   7e-13
Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON...    71   8e-13
Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa] {O...    71   8e-13
KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar...    69   8e-13
Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON...    70   9e-13
KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} simi...    71   9e-13
Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa] {...    71   9e-13
TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON} Anc_8.2...    70   1e-12
KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON} Anc_7.1...    70   1e-12
SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa] {...    70   1e-12
KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa] {O...    68   1e-12
TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON} Anc_2.2...    70   2e-12
ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON} Syn...    70   2e-12
KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]...    70   2e-12
YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One o...    69   2e-12
SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa] {...    69   2e-12
TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.35...    67   2e-12
TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {O...    69   3e-12
Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}...    69   3e-12
Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W...    67   3e-12
Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090...    69   3e-12
KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON}               69   3e-12
YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}  XDJ1Putat...    69   3e-12
CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa] ...    69   3e-12
KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa] {...    69   4e-12
Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF...    63   4e-12
ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa] {O...    67   4e-12
TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON...    67   4e-12
Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa] {...    69   5e-12
YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}  HLJ1Co-cha...    66   6e-12
KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON} simi...    68   7e-12
KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON...    66   8e-12
Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa] {...    68   8e-12
Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214...    67   1e-11
NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa] {O...    67   1e-11
TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa] {...    65   1e-11
KAFR0C02450 Chr3 (477069..478190) [1122 bp, 373 aa] {ON} Anc_7.2...    67   1e-11
KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON} Anc_2...    67   2e-11
NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON...    65   2e-11
NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15      67   2e-11
Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W...    65   2e-11
Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004...    67   2e-11
YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON} ...    67   2e-11
Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090...    66   3e-11
NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350      64   4e-11
ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON} simi...    66   4e-11
TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}...    66   4e-11
SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON} simi...    66   4e-11
KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa] {...    64   5e-11
Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W...    64   6e-11
Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260) ...    63   7e-11
CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON} simil...    65   7e-11
KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON} simi...    65   8e-11
Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa] {...    64   1e-10
Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa] {O...    65   1e-10
KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.6...    63   3e-10
KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} simila...    63   3e-10
KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]...    63   4e-10
NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa] {O...    63   4e-10
Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON} (62384..6...    63   5e-10
Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON} (89534..9...    62   6e-10
AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic ...    62   6e-10
KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa] {O...    62   8e-10
TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON} Anc_2....    62   8e-10
Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON} (8361..10...    62   9e-10
CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON} sim...    61   1e-09
NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa] {O...    59   4e-09
SAKL0C02904g Chr3 complement(275106..275951) [846 bp, 281 aa] {O...    59   4e-09
TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}...    59   5e-09
ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {...    59   6e-09
KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON} Anc_8.2...    58   1e-08
KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {...    59   1e-08
CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {...    58   1e-08
TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa] {O...    58   1e-08
TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa] {O...    58   1e-08
NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698     57   2e-08
KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.6...    57   2e-08
Ecym_1097 Chr1 complement(203901..204713) [813 bp, 270 aa] {ON} ...    56   3e-08
KNAG0B01890 Chr2 (358819..359931) [1113 bp, 370 aa] {ON} Anc_1.9...    56   4e-08
TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.6...    57   4e-08
TBLA0A05560 Chr1 complement(1380366..1381304) [939 bp, 312 aa] {...    56   5e-08
ADL111W Chr4 (487949..489685) [1737 bp, 578 aa] {ON} Syntenic ho...    56   5e-08
TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa] ...    56   6e-08
KNAG0A05650 Chr1 complement(842844..843371) [528 bp, 175 aa] {ON...    54   7e-08
SAKL0H00858g Chr8 complement(101231..102529) [1299 bp, 432 aa] {...    55   8e-08
Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {...    55   9e-08
Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON...    55   9e-08
ZYRO0G18436g Chr7 (1520605..1522116) [1512 bp, 503 aa] {ON} simi...    55   1e-07
Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {...    55   1e-07
AFR639W Chr6 (1604427..1604897) [471 bp, 156 aa] {ON} Non-synten...    52   1e-07
Kpol_1060.3 s1060 (4445..5743) [1299 bp, 432 aa] {ON} (4445..574...    54   2e-07
TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa] {O...    54   2e-07
YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON} ...    55   2e-07
TDEL0C03680 Chr3 (646797..648467) [1671 bp, 556 aa] {ON} Anc_1.1...    54   2e-07
Kwal_33.13860 s33 complement(427243..428979) [1737 bp, 578 aa] {...    54   3e-07
KAFR0A01530 Chr1 (306299..307132) [834 bp, 277 aa] {ON} Anc_1.92...    53   3e-07
KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} simila...    54   3e-07
YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}  JEM1DnaJ-...    54   4e-07
Ecym_1450 Chr1 (930504..931982) [1479 bp, 492 aa] {ON} similar t...    53   4e-07
KLTH0F04906g Chr6 complement(434195..435967) [1773 bp, 590 aa] {...    53   7e-07
AFR659W Chr6 (1640624..1641445) [822 bp, 273 aa] {ON} Non-synten...    52   7e-07
KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly...    53   7e-07
TPHA0I01110 Chr9 (259489..261489) [2001 bp, 666 aa] {ON} Anc_1.2...    52   1e-06
Kwal_26.9495 s26 (1242662..1243948) [1287 bp, 428 aa] {ON} YGR28...    52   1e-06
Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {...    52   1e-06
Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W...    52   1e-06
Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {O...    52   1e-06
TBLA0C07160 Chr3 complement(1737406..1738698) [1293 bp, 430 aa] ...    51   2e-06
NDAI0B00200 Chr2 (25694..27478) [1785 bp, 594 aa] {ON} Anc_1.185       51   2e-06
YGR285C Chr7 complement(1061852..1063153) [1302 bp, 433 aa] {ON}...    51   3e-06
Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {O...    51   3e-06
KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.2...    51   3e-06
NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON} Anc_2.218     51   3e-06
Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073...    51   3e-06
KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {...    51   3e-06
Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W...    49   3e-06
TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.6...    51   3e-06
TPHA0A05650 Chr1 complement(1281376..1282677) [1302 bp, 433 aa] ...    50   3e-06
KLLA0F03124g Chr6 complement(289514..290815) [1302 bp, 433 aa] {...    50   3e-06
SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} simila...    50   4e-06
Kwal_47.17957 s47 (626415..627851) [1437 bp, 478 aa] {ON} YFL016...    50   4e-06
NDAI0G03280 Chr7 complement(769822..771480) [1659 bp, 552 aa] {O...    50   4e-06
Kwal_33.13533 s33 (271635..272120) [486 bp, 161 aa] {ON} YJR097W...    48   4e-06
TDEL0C00870 Chr3 complement(140420..141832) [1413 bp, 470 aa] {O...    50   4e-06
CAGL0H02827g Chr8 (261006..262976) [1971 bp, 656 aa] {ON} simila...    50   4e-06
SAKL0C05456g Chr3 complement(519700..521451) [1752 bp, 583 aa] {...    50   4e-06
NCAS0I02830 Chr9 (526309..527784) [1476 bp, 491 aa] {ON} Anc_1.1...    50   5e-06
KNAG0C02450 Chr3 complement(477576..479210) [1635 bp, 544 aa] {O...    50   5e-06
Smik_16.23 Chr16 (34403..35704) [1302 bp, 433 aa] {ON} YGR285C (...    50   5e-06
Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar t...    50   6e-06
Skud_7.618 Chr7 complement(1036280..1037581) [1302 bp, 433 aa] {...    50   6e-06
ZYRO0F03652g Chr6 complement(306692..308080) [1389 bp, 462 aa] {...    50   6e-06
KLTH0F02596g Chr6 complement(224401..225249) [849 bp, 282 aa] {O...    49   7e-06
Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON...    50   8e-06
NCAS0E04190 Chr5 complement(825586..826881) [1296 bp, 431 aa] {O...    49   8e-06
KNAG0E01220 Chr5 (236127..237431) [1305 bp, 434 aa] {ON} Anc_5.4...    49   8e-06
SAKL0D06226g Chr4 (510407..512254) [1848 bp, 615 aa] {ON} weakly...    49   8e-06
Smik_10.68 Chr10 complement(111694..113376) [1683 bp, 560 aa] {O...    49   8e-06
KLTH0G18546g Chr7 complement(1599892..1600743) [852 bp, 283 aa] ...    49   9e-06
AAL103W Chr1 (161385..163394) [2010 bp, 669 aa] {ON} Syntenic ho...    49   1e-05
KLTH0H10032g Chr8 (865827..867650) [1824 bp, 607 aa] {ON} weakly...    49   1e-05
Smik_6.63 Chr6 complement(118121..119653) [1533 bp, 510 aa] {ON}...    49   1e-05
KAFR0G00910 Chr7 complement(214974..215465) [492 bp, 163 aa] {ON...    47   1e-05
TDEL0G00270 Chr7 (49939..51240) [1302 bp, 433 aa] {ON} Anc_5.4 Y...    49   1e-05
KLTH0A02882g Chr1 (250221..251642) [1422 bp, 473 aa] {ON} simila...    49   1e-05
Smik_10.385 Chr10 (601299..601817) [519 bp, 172 aa] {ON} YJR097W...    47   1e-05
Kwal_14.1174 s14 (228078..228932) [855 bp, 284 aa] {ON} [contig ...    48   1e-05
KAFR0F01810 Chr6 complement(352130..353797) [1668 bp, 555 aa] {O...    49   2e-05
ZYRO0F16456g Chr6 (1353540..1354355) [816 bp, 271 aa] {ON} weakl...    48   2e-05
ADL327W Chr4 (123851..124768) [918 bp, 305 aa] {ON} Syntenic hom...    48   2e-05
KLTH0B09570g Chr2 (783747..785033) [1287 bp, 428 aa] {ON} highly...    48   2e-05
Kpol_2000.56 s2000 (110867..111739) [873 bp, 290 aa] {ON} (11086...    48   2e-05
Kpol_1011.9 s1011 (23785..25272) [1488 bp, 495 aa] {ON} (23785.....    48   2e-05
KAFR0C03160 Chr3 complement(633466..634962) [1497 bp, 498 aa] {O...    48   2e-05
NCAS0C03950 Chr3 complement(798535..800094) [1560 bp, 519 aa] {O...    48   2e-05
TPHA0A02810 Chr1 complement(606816..608294) [1479 bp, 492 aa] {O...    48   2e-05
Suva_7.582 Chr7 complement(1016872..1018296) [1425 bp, 474 aa] {...    48   3e-05
KNAG0B05240 Chr2 (1014877..1016883) [2007 bp, 668 aa] {ON} Anc_1...    48   3e-05
SAKL0B01276g Chr2 (119226..120104) [879 bp, 292 aa] {ON} conserv...    47   3e-05
SAKL0B02068g Chr2 complement(199274..200806) [1533 bp, 510 aa] {...    48   3e-05
KLLA0C02981g Chr3 (268669..269157) [489 bp, 162 aa] {ON} similar...    46   3e-05
TBLA0C02720 Chr3 complement(651693..653840) [2148 bp, 715 aa] {O...    48   3e-05
Skud_6.56 Chr6 complement(106964..108517) [1554 bp, 517 aa] {ON}...    48   3e-05
Suva_6.243 Chr6 (433682..435379) [1698 bp, 565 aa] {ON} YJL162C ...    48   3e-05
NCAS0A09320 Chr1 complement(1841541..1843448) [1908 bp, 635 aa] ...    48   3e-05
ADR124C Chr4 complement(926129..927964) [1836 bp, 611 aa] {ON} S...    48   3e-05
Smik_7.143 Chr7 complement(263235..264086) [852 bp, 283 aa] {ON}...    47   3e-05
TBLA0D02600 Chr4 complement(639981..641513) [1533 bp, 510 aa] {O...    47   3e-05
KAFR0J00260 Chr10 (41749..42543) [795 bp, 264 aa] {ON} Anc_3.548...    47   3e-05
SAKL0C03476g Chr3 (329030..329527) [498 bp, 165 aa] {ON} similar...    45   3e-05
TDEL0D01640 Chr4 (328124..329938) [1815 bp, 604 aa] {ON} Anc_1.2...    47   3e-05
TBLA0J00970 Chr10 (219487..221247) [1761 bp, 586 aa] {ON} Anc_1....    47   3e-05
TDEL0C05880 Chr3 complement(1059324..1059803) [480 bp, 159 aa] {...    45   4e-05
TDEL0C06100 Chr3 (1102385..1103242) [858 bp, 285 aa] {ON} Anc_1....    47   4e-05
AEL112C Chr5 complement(412116..413723) [1608 bp, 535 aa] {ON} S...    47   4e-05
YJL162C Chr10 complement(113878..115629) [1752 bp, 583 aa] {ON} ...    47   4e-05
CAGL0I06226g Chr9 (597520..598887) [1368 bp, 455 aa] {ON} some s...    47   5e-05
NDAI0B00670 Chr2 complement(150183..151478) [1296 bp, 431 aa] {O...    47   5e-05
Ecym_6318 Chr6 complement(605055..606929) [1875 bp, 624 aa] {ON}...    47   6e-05
Skud_7.144 Chr7 complement(273716..274567) [852 bp, 283 aa] {ON}...    46   6e-05
KLLA0D07656g Chr4 (658179..659594) [1416 bp, 471 aa] {ON} simila...    47   6e-05
KLTH0F03124g Chr6 (271947..272435) [489 bp, 162 aa] {ON} similar...    45   7e-05
AGL339C Chr7 complement(77330..78622) [1293 bp, 430 aa] {ON} Syn...    46   7e-05
CAGL0J04224g Chr10 (395856..397424) [1569 bp, 522 aa] {ON} simil...    46   8e-05
CAGL0C04565g Chr3 (435373..435900) [528 bp, 175 aa] {ON} similar...    45   8e-05
YFL016C Chr6 complement(104701..106236) [1536 bp, 511 aa] {ON}  ...    46   1e-04
TPHA0B04190 Chr2 complement(984952..985458) [507 bp, 168 aa] {ON...    44   1e-04
NDAI0K01230 Chr11 (280525..282567) [2043 bp, 680 aa] {ON} Anc_8....    46   1e-04
Skud_10.52 Chr10 complement(88516..90195) [1680 bp, 559 aa] {ON}...    45   1e-04
ZYRO0G21230g Chr7 complement(1742750..1744504) [1755 bp, 584 aa]...    45   1e-04
NDAI0C00200 Chr3 (32604..33434) [831 bp, 276 aa] {ON} Anc_1.92         45   2e-04
Suva_7.135 Chr7 complement(265536..266393) [858 bp, 285 aa] {ON}...    45   2e-04
CAGL0I09526g Chr9 (911397..912287) [891 bp, 296 aa] {ON} weakly ...    45   2e-04
KLLA0B07271g Chr2 complement(633724..635685) [1962 bp, 653 aa] {...    45   2e-04
KAFR0I02680 Chr9 complement(545638..546939) [1302 bp, 433 aa] {O...    45   2e-04
Kpol_2001.27 s2001 (79675..81237) [1563 bp, 520 aa] {ON} (79675....    45   3e-04
Suva_6.44 Chr6 complement(77690..79213) [1524 bp, 507 aa] {ON} Y...    44   3e-04
TBLA0A05740 Chr1 (1424068..1424580) [513 bp, 170 aa] {ON} Anc_1....    42   4e-04
Ecym_1110 Chr1 (231686..232156) [471 bp, 156 aa] {ON} similar to...    42   5e-04
CAGL0G00154g Chr7 (14591..15892) [1302 bp, 433 aa] {ON} highly s...    44   5e-04
NDAI0G05640 Chr7 (1400380..1402251) [1872 bp, 623 aa] {ON} Anc_1...    44   5e-04
YGL128C Chr7 complement(269293..270144) [852 bp, 283 aa] {ON}  C...    43   5e-04
NDAI0D00500 Chr4 complement(103935..104507) [573 bp, 190 aa] {ON...    42   7e-04
YJR097W Chr10 (612413..612931) [519 bp, 172 aa] {ON}  JJJ3Protei...    42   8e-04
Smik_7.361 Chr7 complement(598202..599089) [888 bp, 295 aa] {ON}...    42   9e-04
TDEL0D06160 Chr4 complement(1111817..1112701) [885 bp, 294 aa] {...    42   0.001
ZYRO0F15972g Chr6 complement(1311698..1312186) [489 bp, 162 aa] ...    41   0.001
Ecym_8093 Chr8 (198912..200543) [1632 bp, 543 aa] {ON} similar t...    42   0.001
Ecym_2578 Chr2 complement(1130625..1131521) [897 bp, 298 aa] {ON...    42   0.002
YFR041C Chr6 complement(237368..238255) [888 bp, 295 aa] {ON}  E...    42   0.002
Skud_6.132 Chr6 complement(232394..233278) [885 bp, 295 aa] {ON}...    41   0.002
Skud_10.319 Chr10 (569772..570278) [507 bp, 168 aa] {ON} YJR097W...    40   0.002
Kwal_47.19198 s47 complement(1131232..1132134) [903 bp, 300 aa] ...    41   0.002
KNAG0D01360 Chr4 complement(229325..229882) [558 bp, 185 aa] {ON...    40   0.004
TBLA0I03430 Chr9 complement(828607..829449) [843 bp, 280 aa] {ON...    40   0.005
KLTH0G01122g Chr7 (80433..81317) [885 bp, 294 aa] {ON} similar t...    40   0.006
KLLA0A01133g Chr1 (103746..104579) [834 bp, 277 aa] {ON} similar...    40   0.006
NCAS0H03480 Chr8 complement(656664..657506) [843 bp, 280 aa] {ON...    39   0.010
SAKL0B07568g Chr2 complement(649545..650396) [852 bp, 283 aa] {O...    38   0.019
Suva_12.16 Chr12 (21243..22130) [888 bp, 295 aa] {ON} YFR041C (R...    38   0.019
KLTH0E15268g Chr5 complement(1353439..1354302) [864 bp, 287 aa] ...    38   0.019
Kwal_33.13451 s33 complement(229605..230468) [864 bp, 287 aa] {O...    38   0.020
CAGL0C02123g Chr3 (215564..216457) [894 bp, 297 aa] {ON} similar...    38   0.020
ZYRO0C01210g Chr3 (81965..83266) [1302 bp, 433 aa] {ON} highly s...    39   0.022
AFR246C Chr6 complement(883072..883938) [867 bp, 288 aa] {ON} Sy...    38   0.025
ZYRO0E09108g Chr5 complement(728771..729667) [897 bp, 298 aa] {O...    38   0.025
KNAG0D01780 Chr4 (297877..299016) [1140 bp, 379 aa] {ON} Anc_7.2...    38   0.031
KNAG0D02880 Chr4 complement(522593..523372) [780 bp, 259 aa] {ON...    37   0.032
Kpol_460.8 s460 complement(16879..17742) [864 bp, 287 aa] {ON} c...    37   0.036
Suva_16.388 Chr16 complement(682753..683655) [903 bp, 300 aa] {O...    37   0.036
NCAS0F03900 Chr6 complement(783960..784901) [942 bp, 313 aa] {ON...    37   0.070
Kwal_14.1136 s14 complement(211335..212195) [861 bp, 286 aa] {ON...    36   0.086
SAKL0F01298g Chr6 (108332..109231) [900 bp, 299 aa] {ON} similar...    36   0.11 
Kpol_2000.32 s2000 complement(60585..61088) [504 bp, 167 aa] {ON...    35   0.11 
Skud_16.346 Chr16 complement(640855..641760) [906 bp, 301 aa] {O...    35   0.24 
Skud_7.269 Chr7 complement(462239..462793) [555 bp, 184 aa] {ON}...    34   0.27 
Suva_7.261 Chr7 complement(449983..450537) [555 bp, 184 aa] {ON}...    34   0.32 
YGL018C Chr7 complement(459110..459664) [555 bp, 184 aa] {ON}  J...    33   0.44 
Smik_7.272 Chr7 complement(451118..451672) [555 bp, 184 aa] {ON}...    33   0.54 
NCAS0H00550 Chr8 complement(95349..95873) [525 bp, 174 aa] {ON} ...    33   0.64 
NDAI0B06200 Chr2 complement(1506799..1507749) [951 bp, 316 aa] {...    33   0.66 
Kpol_376.12 s376 complement(19211..20083) [873 bp, 290 aa] {ON} ...    33   0.71 
Smik_16.302 Chr16 complement(552646..553554) [909 bp, 302 aa] {O...    33   0.94 
KLLA0B08459g Chr2 (751178..752065) [888 bp, 295 aa] {ON} similar...    33   1.3  
Ecym_3476 Chr3 (892436..893311) [876 bp, 291 aa] {ON} similar to...    32   1.4  
KAFR0H00980 Chr8 (180369..181181) [813 bp, 270 aa] {ON} Anc_3.35...    32   2.1  
Kwal_47.16709 s47 (73985..79051) [5067 bp, 1688 aa] {ON} YJR138W...    32   2.2  
KNAG0C01680 Chr3 (335056..337689) [2634 bp, 877 aa] {ON} Anc_1.3...    32   2.3  
ADL128C Chr4 complement(464142..467390) [3249 bp, 1082 aa] {ON} ...    32   2.5  
ZYRO0C16126g Chr3 complement(1261370..1262215) [846 bp, 281 aa] ...    31   4.3  
KNAG0H02690 Chr8 (497172..498431) [1260 bp, 419 aa] {ON} Anc_7.1...    30   7.3  
NDAI0A05220 Chr1 (1180958..1181935) [978 bp, 325 aa] {ON} Anc_3....    30   7.3  

>TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa] {ON}
           Anc_1.398 YNL007C
          Length = 353

 Score =  365 bits (937), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 176/176 (100%), Positives = 176/176 (100%)

Query: 178 HEEEVVSVDIPVSLEDLFTGKKKSFKIGRKGMRGEPEKVQIDINLKPGWKEGTKLTYKNH 237
           HEEEVVSVDIPVSLEDLFTGKKKSFKIGRKGMRGEPEKVQIDINLKPGWKEGTKLTYKNH
Sbjct: 178 HEEEVVSVDIPVSLEDLFTGKKKSFKIGRKGMRGEPEKVQIDINLKPGWKEGTKLTYKNH 237

Query: 238 GDYNPSTGGRKTLQFIIKEKKHPLYKRDGDNIIYTLPLTFKESLLGFSKTLQTLDGRTLP 297
           GDYNPSTGGRKTLQFIIKEKKHPLYKRDGDNIIYTLPLTFKESLLGFSKTLQTLDGRTLP
Sbjct: 238 GDYNPSTGGRKTLQFIIKEKKHPLYKRDGDNIIYTLPLTFKESLLGFSKTLQTLDGRTLP 297

Query: 298 LSRSQPVQPTEENTYPGQGMPISKNPGQRGNLIIKYKINYPISLTDSQRRAIADNF 353
           LSRSQPVQPTEENTYPGQGMPISKNPGQRGNLIIKYKINYPISLTDSQRRAIADNF
Sbjct: 298 LSRSQPVQPTEENTYPGQGMPISKNPGQRGNLIIKYKINYPISLTDSQRRAIADNF 353

 Score =  167 bits (423), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 87/103 (84%)

Query: 1   MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDSNK 60
           MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDSNK
Sbjct: 1   MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDSNK 60

Query: 61  RSVYDQYGLDAARNXXXXXXXXXXXXXXXXSTHSFSNDDAFNI 103
           RSVYDQYGLDAARN                STHSFSNDDAFNI
Sbjct: 61  RSVYDQYGLDAARNGGPSFQGQSGFPGGGGSTHSFSNDDAFNI 103

>ZYRO0E04598g Chr5 complement(346758..347831) [1074 bp, 357 aa] {ON}
           some similarities with uniprot|P25294 Saccharomyces
           cerevisiae YNL007C SIS1 HSP40 family chaperone sit4
           suppressor dnaJ homolog
          Length = 357

 Score =  293 bits (749), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 158/175 (90%)

Query: 179 EEEVVSVDIPVSLEDLFTGKKKSFKIGRKGMRGEPEKVQIDINLKPGWKEGTKLTYKNHG 238
           EEE+V V++PVSLEDLF G+KKSFKIGRK   G  EK QIDI LKPGWK GTK+TYKN G
Sbjct: 183 EEEIVPVNLPVSLEDLFAGRKKSFKIGRKNRGGSFEKTQIDIQLKPGWKAGTKITYKNEG 242

Query: 239 DYNPSTGGRKTLQFIIKEKKHPLYKRDGDNIIYTLPLTFKESLLGFSKTLQTLDGRTLPL 298
           DYNP TGGRKTLQF+++EK HPLYKRDGDN+IY+LPL+FKESLLGFSKT+QT+DGRTLP+
Sbjct: 243 DYNPQTGGRKTLQFVLQEKSHPLYKRDGDNLIYSLPLSFKESLLGFSKTIQTIDGRTLPI 302

Query: 299 SRSQPVQPTEENTYPGQGMPISKNPGQRGNLIIKYKINYPISLTDSQRRAIADNF 353
           S+ QPVQPTE ++YPGQGMP+SK PGQRG+L++KYKI+YP+SLT+ Q+RAIA+NF
Sbjct: 303 SKIQPVQPTEVSSYPGQGMPVSKRPGQRGDLVVKYKIDYPLSLTEDQKRAIAENF 357

 Score =  140 bits (353), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 71/110 (64%), Positives = 83/110 (75%), Gaps = 7/110 (6%)

Query: 1   MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDSNK 60
           MVKETKLYD+LGVS SA++ E+KKGY+KAALKYHPDKP GDTEKFKEISEA+EILSDS+K
Sbjct: 1   MVKETKLYDMLGVSPSANEQELKKGYKKAALKYHPDKPAGDTEKFKEISEAYEILSDSSK 60

Query: 61  RSVYDQYGLDAARN-------XXXXXXXXXXXXXXXXSTHSFSNDDAFNI 103
           R +YDQYGL+AARN                       S+H+FSN+DAFNI
Sbjct: 61  REIYDQYGLEAARNGGPAFGGASPGAGGFPAGGAGGFSSHAFSNEDAFNI 110

>YNL007C Chr14 complement(618507..619565) [1059 bp, 352 aa] {ON}
           SIS1Type II HSP40 co-chaperone that interacts with the
           HSP70 protein Ssa1p; not functionally redundant with
           Ydj1p due to due to substrate specificity; shares
           similarity with bacterial DnaJ proteins
          Length = 352

 Score =  287 bits (735), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 153/175 (87%)

Query: 179 EEEVVSVDIPVSLEDLFTGKKKSFKIGRKGMRGEPEKVQIDINLKPGWKEGTKLTYKNHG 238
           EEE V V++PVSLEDLF GKKKSFKIGRKG  G  EK QIDI LKPGWK GTK+TYKN G
Sbjct: 178 EEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGASEKTQIDIQLKPGWKAGTKITYKNQG 237

Query: 239 DYNPSTGGRKTLQFIIKEKKHPLYKRDGDNIIYTLPLTFKESLLGFSKTLQTLDGRTLPL 298
           DYNP TG RKTLQF+I+EK HP +KRDGD++IYTLPL+FKESLLGFSKT+QT+DGRTLPL
Sbjct: 238 DYNPQTGRRKTLQFVIQEKSHPNFKRDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPL 297

Query: 299 SRSQPVQPTEENTYPGQGMPISKNPGQRGNLIIKYKINYPISLTDSQRRAIADNF 353
           SR QPVQP++ +TYPGQGMP  KNP QRGNLI+KYK++YPISL D+Q+RAI +NF
Sbjct: 298 SRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNDAQKRAIDENF 352

 Score =  135 bits (340), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 79/114 (69%), Gaps = 11/114 (9%)

Query: 1   MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDSNK 60
           MVKETKLYDLLGVS SA++ E+KKGYRKAALKYHPDKPTGDTEKFKEISEAFEIL+D  K
Sbjct: 1   MVKETKLYDLLGVSPSANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPQK 60

Query: 61  RSVYDQYGLDAAR-----------NXXXXXXXXXXXXXXXXSTHSFSNDDAFNI 103
           R +YDQYGL+AAR                              H+FSN+DAFNI
Sbjct: 61  REIYDQYGLEAARSGGPSFGPGGPGGAGGAGGFPGGAGGFSGGHAFSNEDAFNI 114

>TDEL0B05960 Chr2 complement(1053955..1055064) [1110 bp, 369 aa]
           {ON} Anc_1.398 YNL007C
          Length = 369

 Score =  288 bits (736), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 154/175 (88%)

Query: 179 EEEVVSVDIPVSLEDLFTGKKKSFKIGRKGMRGEPEKVQIDINLKPGWKEGTKLTYKNHG 238
           EEEVVSV++PVSLEDL  GKKKSFKIGRKG  G  EK QIDI LK GWK GTK+TYKN G
Sbjct: 195 EEEVVSVNLPVSLEDLCAGKKKSFKIGRKGPNGTSEKTQIDIQLKQGWKAGTKITYKNEG 254

Query: 239 DYNPSTGGRKTLQFIIKEKKHPLYKRDGDNIIYTLPLTFKESLLGFSKTLQTLDGRTLPL 298
           DYNP TGGRKTLQF+++EK HPL+KRDGDN+IYTLPL+FKESLLGFSKT+QT+DGRTLP+
Sbjct: 255 DYNPRTGGRKTLQFVLQEKAHPLFKRDGDNLIYTLPLSFKESLLGFSKTIQTIDGRTLPI 314

Query: 299 SRSQPVQPTEENTYPGQGMPISKNPGQRGNLIIKYKINYPISLTDSQRRAIADNF 353
           SR QP+QP+E + YPGQGMPI+K PGQRG+LI+KYKI+YPISL D+Q+ AI  NF
Sbjct: 315 SRVQPIQPSESSRYPGQGMPITKKPGQRGDLIVKYKIDYPISLNDAQKHAIDQNF 369

 Score =  135 bits (341), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 72/113 (63%), Positives = 81/113 (71%), Gaps = 10/113 (8%)

Query: 1   MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDSNK 60
           MVKETKLYDLLGVS +A++ E+KKGYRKAALKYHPDKPTGDTEKFKEISEAFEIL+DS K
Sbjct: 1   MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDSQK 60

Query: 61  RSVYDQYGLDAARN----------XXXXXXXXXXXXXXXXSTHSFSNDDAFNI 103
           R +YDQYGL+AARN                            H+FSN+DAFNI
Sbjct: 61  REIYDQYGLEAARNGGPAFGGASPGAGGFPGGAGGFSGGHGGHAFSNEDAFNI 113

>Smik_14.321 Chr14 complement(576829..577929) [1101 bp, 366 aa] {ON}
           YNL007C (REAL)
          Length = 366

 Score =  287 bits (735), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 153/175 (87%)

Query: 179 EEEVVSVDIPVSLEDLFTGKKKSFKIGRKGMRGEPEKVQIDINLKPGWKEGTKLTYKNHG 238
           EEE V V++PVSLEDLF GKKKSFKIGRKG  G  EK QIDI LKPGWK GTK+TYKN G
Sbjct: 192 EEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGASEKTQIDIQLKPGWKAGTKITYKNQG 251

Query: 239 DYNPSTGGRKTLQFIIKEKKHPLYKRDGDNIIYTLPLTFKESLLGFSKTLQTLDGRTLPL 298
           DYNP TG RKTLQF+I+EK HP +KRDGD++IYTLPL+FKESLLGFSKT+QT+DGRTLPL
Sbjct: 252 DYNPQTGRRKTLQFVIQEKSHPNFKRDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPL 311

Query: 299 SRSQPVQPTEENTYPGQGMPISKNPGQRGNLIIKYKINYPISLTDSQRRAIADNF 353
           SR QPVQP++ +TYPGQGMP  KNP QRGNLI+KYK++YPISL D+Q+RAI +NF
Sbjct: 312 SRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNDAQKRAIDENF 366

 Score =  136 bits (342), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 80/114 (70%), Gaps = 11/114 (9%)

Query: 1   MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDSNK 60
           MVKETKLYDLLGVS +A++ E+KKGYRKAALKYHPDKPTGDTEKFKEISEAFEIL+DS K
Sbjct: 1   MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDSQK 60

Query: 61  RSVYDQYGLDAAR-----------NXXXXXXXXXXXXXXXXSTHSFSNDDAFNI 103
           R +YDQYGL+AAR                              H+FSN+DAFNI
Sbjct: 61  REIYDQYGLEAARSGGPSFGAGGPGGAGGAGGFPGGAGGFSGGHAFSNEDAFNI 114

>KNAG0H01680 Chr8 complement(300014..301105) [1092 bp, 363 aa] {ON}
           Anc_1.398 YNL007C
          Length = 363

 Score =  285 bits (729), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 154/175 (88%)

Query: 179 EEEVVSVDIPVSLEDLFTGKKKSFKIGRKGMRGEPEKVQIDINLKPGWKEGTKLTYKNHG 238
           +EEVV V +PVSLEDLF GKKKSFK+GRKG  G  EKVQIDI LK GWK GTK+TYKNHG
Sbjct: 189 QEEVVQVHLPVSLEDLFEGKKKSFKVGRKGPGGAQEKVQIDIQLKAGWKAGTKVTYKNHG 248

Query: 239 DYNPSTGGRKTLQFIIKEKKHPLYKRDGDNIIYTLPLTFKESLLGFSKTLQTLDGRTLPL 298
           DYNP TGGRKTLQF+I+EK HPLYKR+GD++ YTLPLTFKESLLGFSKT+QT+DGRTLPL
Sbjct: 249 DYNPRTGGRKTLQFVIQEKTHPLYKRNGDDLEYTLPLTFKESLLGFSKTIQTIDGRTLPL 308

Query: 299 SRSQPVQPTEENTYPGQGMPISKNPGQRGNLIIKYKINYPISLTDSQRRAIADNF 353
           SRS PVQPTE + YPGQGMP+ K P QRG+L++++KI+YPISL D+QR+AIA NF
Sbjct: 309 SRSSPVQPTETSRYPGQGMPMPKMPSQRGDLVVRFKIDYPISLNDAQRQAIAANF 363

 Score =  137 bits (344), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 70/108 (64%), Positives = 79/108 (73%), Gaps = 5/108 (4%)

Query: 1   MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDSNK 60
           MVKETKLYDLLGVS +A++ E+KKGYRK+ALKYHPDKPTGDTEKFKEISEAFEIL+D  K
Sbjct: 1   MVKETKLYDLLGVSPTANEQELKKGYRKSALKYHPDKPTGDTEKFKEISEAFEILNDKQK 60

Query: 61  RSVYDQYGLDAARN-----XXXXXXXXXXXXXXXXSTHSFSNDDAFNI 103
           R +YDQYGL+AAR                        HSFSN+DAFNI
Sbjct: 61  REIYDQYGLEAARQGGPSFGAGGPGAGGAPGGGAGFAHSFSNEDAFNI 108

>CAGL0H03707g Chr8 complement(341230..342279) [1050 bp, 349 aa] {ON}
           highly similar to uniprot|P25294 Saccharomyces
           cerevisiae YNL007c SIS1 heat shock protein
          Length = 349

 Score =  284 bits (727), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 129/175 (73%), Positives = 157/175 (89%)

Query: 179 EEEVVSVDIPVSLEDLFTGKKKSFKIGRKGMRGEPEKVQIDINLKPGWKEGTKLTYKNHG 238
           EEEVV V++ VSLEDL+TGKKK+F IGRKG  G PEK Q+DI LKPGWK GTK+TYKN+G
Sbjct: 175 EEEVVPVNLSVSLEDLYTGKKKTFMIGRKGPNGAPEKTQVDIQLKPGWKAGTKITYKNYG 234

Query: 239 DYNPSTGGRKTLQFIIKEKKHPLYKRDGDNIIYTLPLTFKESLLGFSKTLQTLDGRTLPL 298
           DYNP+TG RKTLQFII+EKKHP + RDG+++IYTLPLTFKESLLGF+KT+QT+DGRTLP+
Sbjct: 235 DYNPATGRRKTLQFIIQEKKHPFFTRDGNDLIYTLPLTFKESLLGFNKTIQTIDGRTLPV 294

Query: 299 SRSQPVQPTEENTYPGQGMPISKNPGQRGNLIIKYKINYPISLTDSQRRAIADNF 353
           SR QP+QP+E++TYPGQGMPI K PGQRG++I+ YK++YPISLTD QR+AI +NF
Sbjct: 295 SRIQPIQPSEKSTYPGQGMPIPKTPGQRGDMIVNYKVDYPISLTDKQRQAIDENF 349

 Score =  144 bits (364), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 80/107 (74%), Gaps = 4/107 (3%)

Query: 1   MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDSNK 60
           MVKETKLYDLLG+S SA++ EIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSD  K
Sbjct: 1   MVKETKLYDLLGISPSANEQEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDPQK 60

Query: 61  RSVYDQYGLDAARN----XXXXXXXXXXXXXXXXSTHSFSNDDAFNI 103
           R VYDQYGL+AARN                      H+FSNDDAFNI
Sbjct: 61  REVYDQYGLEAARNGGPAFGGAGGFRGGGFSSAGGAHAFSNDDAFNI 107

>Suva_14.341 Chr14 complement(598475..599554) [1080 bp, 359 aa] {ON}
           YNL007C (REAL)
          Length = 359

 Score =  283 bits (725), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 131/175 (74%), Positives = 152/175 (86%)

Query: 179 EEEVVSVDIPVSLEDLFTGKKKSFKIGRKGMRGEPEKVQIDINLKPGWKEGTKLTYKNHG 238
           EEE V V++PVSLEDLF GKKKSFKIGRKG  G  EK QIDI LKPGWK GTK+TYKN G
Sbjct: 185 EEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGTSEKTQIDIQLKPGWKAGTKITYKNQG 244

Query: 239 DYNPSTGGRKTLQFIIKEKKHPLYKRDGDNIIYTLPLTFKESLLGFSKTLQTLDGRTLPL 298
           D+NP T  RKTLQF+I+EK HP +KRDGD++IYTLPL+FKESLLGFSKT+QT+DGRTLPL
Sbjct: 245 DFNPQTNRRKTLQFVIQEKSHPNFKRDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPL 304

Query: 299 SRSQPVQPTEENTYPGQGMPISKNPGQRGNLIIKYKINYPISLTDSQRRAIADNF 353
           SR QPVQP++ +TYPGQGMP  KNP QRGNLI+KYK++YPISL D+Q+RAI +NF
Sbjct: 305 SRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNDAQKRAIDENF 359

 Score =  132 bits (333), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 68/114 (59%), Positives = 79/114 (69%), Gaps = 11/114 (9%)

Query: 1   MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDSNK 60
           MVKETKLYD+LGVS +A++ E+KKGYRKAALKYHPDKPTGDTEKFKEISEAFEIL+D  K
Sbjct: 1   MVKETKLYDMLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPQK 60

Query: 61  RSVYDQYGLDAAR-----------NXXXXXXXXXXXXXXXXSTHSFSNDDAFNI 103
           R +YDQYG++AAR                              H+FSN+DAFNI
Sbjct: 61  REIYDQYGIEAARSGGPSFGAGGAGGPGGAGGFPGGAGGFSGGHAFSNEDAFNI 114

>NCAS0G03610 Chr7 (674056..675039) [984 bp, 327 aa] {ON} Anc_1.398
          Length = 327

 Score =  281 bits (720), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 152/176 (86%)

Query: 178 HEEEVVSVDIPVSLEDLFTGKKKSFKIGRKGMRGEPEKVQIDINLKPGWKEGTKLTYKNH 237
            EEEVV V++PVSLEDLF GKKKSFKIGRKG  G  EK QIDI L+PGWK GTK+TYKN 
Sbjct: 152 EEEEVVPVNLPVSLEDLFIGKKKSFKIGRKGPGGSQEKTQIDIQLRPGWKAGTKVTYKNQ 211

Query: 238 GDYNPSTGGRKTLQFIIKEKKHPLYKRDGDNIIYTLPLTFKESLLGFSKTLQTLDGRTLP 297
           GDYNP +GGRKTLQF+I+EK HP +KRDGD++IY L L+FKESLLGFSKT+ T+DGR LP
Sbjct: 212 GDYNPRSGGRKTLQFVIQEKAHPDFKRDGDDLIYILRLSFKESLLGFSKTINTIDGRKLP 271

Query: 298 LSRSQPVQPTEENTYPGQGMPISKNPGQRGNLIIKYKINYPISLTDSQRRAIADNF 353
           LSRSQP+QPTE +TYPGQGMP+SKNP QRGNLIIKYKI+YPISL D+QR AI  NF
Sbjct: 272 LSRSQPIQPTEISTYPGQGMPVSKNPSQRGNLIIKYKIDYPISLNDNQRIAIEQNF 327

 Score =  137 bits (346), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 80/107 (74%), Gaps = 4/107 (3%)

Query: 1   MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDSNK 60
           MVKETKLYDLLGVS +A++ E+KKGYRKAALKYHPDKPTGDTEKFKEISEAFEIL+D N 
Sbjct: 1   MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPNT 60

Query: 61  RSVYDQYGLDAAR----NXXXXXXXXXXXXXXXXSTHSFSNDDAFNI 103
           R VYDQYGL+AAR    +                S H FSNDDAFN+
Sbjct: 61  REVYDQYGLEAARSGGPSFGGAGAGGFPGGAGGFSGHQFSNDDAFNM 107

>Skud_14.320 Chr14 complement(585268..586374) [1107 bp, 368 aa] {ON}
           YNL007C (REAL)
          Length = 368

 Score =  281 bits (720), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 152/175 (86%)

Query: 179 EEEVVSVDIPVSLEDLFTGKKKSFKIGRKGMRGEPEKVQIDINLKPGWKEGTKLTYKNHG 238
           EEE V V++PVSLEDLF GKKKSFKIGRKG  G  EK QIDI LKPGWK GTK+TYKN G
Sbjct: 194 EEETVQVNLPVSLEDLFVGKKKSFKIGRKGPHGAAEKTQIDIQLKPGWKAGTKITYKNQG 253

Query: 239 DYNPSTGGRKTLQFIIKEKKHPLYKRDGDNIIYTLPLTFKESLLGFSKTLQTLDGRTLPL 298
           D+N  TG RKTLQF+I+EK HP +KRDGD++IYTLPL+FKESLLGFSKT+QT+DGRTLPL
Sbjct: 254 DFNSQTGRRKTLQFVIQEKGHPNFKRDGDDLIYTLPLSFKESLLGFSKTIQTIDGRTLPL 313

Query: 299 SRSQPVQPTEENTYPGQGMPISKNPGQRGNLIIKYKINYPISLTDSQRRAIADNF 353
           SR QPVQP++ +TYPGQGMP  KNP QRGNLI+KYK++YPISL ++Q+RAI +NF
Sbjct: 314 SRVQPVQPSQTSTYPGQGMPTPKNPSQRGNLIVKYKVDYPISLNEAQKRAIDENF 368

 Score =  135 bits (339), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 70/117 (59%), Positives = 80/117 (68%), Gaps = 14/117 (11%)

Query: 1   MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDSNK 60
           MVKETKLYDLLGVS +A++ E+KKGYRKAALKYHPDKPTGDTEKFKEISEAFEIL+D+ K
Sbjct: 1   MVKETKLYDLLGVSPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDAQK 60

Query: 61  RSVYDQYGLDAAR--------------NXXXXXXXXXXXXXXXXSTHSFSNDDAFNI 103
           R +YDQYGL+AAR                                 H+FSN+DAFNI
Sbjct: 61  REIYDQYGLEAARSGGPSFGPGGPGGAGGAGGFPGGAGGAGGFSGGHAFSNEDAFNI 117

>NDAI0C02610 Chr3 (606952..607974) [1023 bp, 340 aa] {ON} 
          Length = 340

 Score =  281 bits (718), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 155/175 (88%)

Query: 179 EEEVVSVDIPVSLEDLFTGKKKSFKIGRKGMRGEPEKVQIDINLKPGWKEGTKLTYKNHG 238
           EEEVV+V++PVSLEDLFTGKKKSFKIGRKG  G  EK QIDI LK GWK GTK+TYKN G
Sbjct: 166 EEEVVTVNLPVSLEDLFTGKKKSFKIGRKGPGGSQEKKQIDIQLKRGWKAGTKITYKNEG 225

Query: 239 DYNPSTGGRKTLQFIIKEKKHPLYKRDGDNIIYTLPLTFKESLLGFSKTLQTLDGRTLPL 298
           D+NP TGGRKTLQF+++EK HPL+KRDG+N++YT+PL+F+ESLLGFSKT+QT+DGR+L L
Sbjct: 226 DFNPRTGGRKTLQFVLQEKAHPLFKRDGENLLYTVPLSFQESLLGFSKTVQTIDGRSLSL 285

Query: 299 SRSQPVQPTEENTYPGQGMPISKNPGQRGNLIIKYKINYPISLTDSQRRAIADNF 353
           SR+QP+QPTE  TYPGQGMP  KNP QRG+LII YKI+YPISL+D+QR+AI  NF
Sbjct: 286 SRTQPIQPTETTTYPGQGMPNPKNPNQRGDLIITYKIDYPISLSDAQRQAIQQNF 340

 Score =  150 bits (380), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 75/103 (72%), Positives = 82/103 (79%)

Query: 1   MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDSNK 60
           MVKETKLYDLLGVS SA+D EIKKGYRKAAL+YHPDKPTG+TEKFK+ISEA+EILSDSNK
Sbjct: 1   MVKETKLYDLLGVSPSANDQEIKKGYRKAALQYHPDKPTGNTEKFKQISEAYEILSDSNK 60

Query: 61  RSVYDQYGLDAARNXXXXXXXXXXXXXXXXSTHSFSNDDAFNI 103
           R VYDQYGL+AAR+                  HSFSNDDAFNI
Sbjct: 61  REVYDQYGLEAARSGGPSFGGAGGAGGFPGGAHSFSNDDAFNI 103

>TPHA0B03760 Chr2 (889402..890469) [1068 bp, 355 aa] {ON} Anc_1.398
           YNL007C
          Length = 355

 Score =  278 bits (712), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 152/175 (86%)

Query: 179 EEEVVSVDIPVSLEDLFTGKKKSFKIGRKGMRGEPEKVQIDINLKPGWKEGTKLTYKNHG 238
           EEEVV+VD+PVSLEDLF GKKK+FKIGRKG  G  EKVQ+DI LK GWK GTK+T+KN+G
Sbjct: 181 EEEVVTVDLPVSLEDLFQGKKKTFKIGRKGQNGVQEKVQVDIQLKAGWKAGTKITFKNYG 240

Query: 239 DYNPSTGGRKTLQFIIKEKKHPLYKRDGDNIIYTLPLTFKESLLGFSKTLQTLDGRTLPL 298
           DYNPSTGGRKTLQF+IKEK HP +KR+ D ++Y LPLTFKESLLGF KT+QT+DGRTLP+
Sbjct: 241 DYNPSTGGRKTLQFVIKEKVHPNFKREDDTLVYYLPLTFKESLLGFQKTIQTIDGRTLPI 300

Query: 299 SRSQPVQPTEENTYPGQGMPISKNPGQRGNLIIKYKINYPISLTDSQRRAIADNF 353
           SR QPVQP + +TYPGQGMP++K PGQRG++I+KYKI YP +LTD QRRAI + F
Sbjct: 301 SRVQPVQPNDSSTYPGQGMPMTKKPGQRGDMIVKYKIEYPTTLTDDQRRAIDELF 355

 Score =  148 bits (374), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 81/105 (77%), Gaps = 2/105 (1%)

Query: 1   MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDSNK 60
           MVKETKLYDLLGVS SA+D EIKKGYRKAALKYHPDKPTG+TEKFKEISEAFEILSDSNK
Sbjct: 1   MVKETKLYDLLGVSPSANDQEIKKGYRKAALKYHPDKPTGNTEKFKEISEAFEILSDSNK 60

Query: 61  RSVYDQYGLDAARNX--XXXXXXXXXXXXXXXSTHSFSNDDAFNI 103
           R VYDQYGL+AAR                     H+FSNDDAFNI
Sbjct: 61  REVYDQYGLEAARGNGPQFGPGGMPGGPGGSGGAHTFSNDDAFNI 105

>Kwal_0.207 s0 complement(103950..105011) [1062 bp, 353 aa] {ON}
           YNL007C (SIS1) - sit4 suppressor, dnaJ homolog [contig
           82] FULL
          Length = 353

 Score =  276 bits (705), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 153/175 (87%)

Query: 179 EEEVVSVDIPVSLEDLFTGKKKSFKIGRKGMRGEPEKVQIDINLKPGWKEGTKLTYKNHG 238
           EE+VV V++PVSLEDLF+GKKKSFKI RKG  G  EK Q+DI LKPGWK GTK+TYKN G
Sbjct: 179 EEKVVQVNLPVSLEDLFSGKKKSFKITRKGPGGASEKQQVDIQLKPGWKAGTKITYKNEG 238

Query: 239 DYNPSTGGRKTLQFIIKEKKHPLYKRDGDNIIYTLPLTFKESLLGFSKTLQTLDGRTLPL 298
           DYNP TG R+TLQFI++EK H  Y RDG+++IY+LPLTFKESLLGFSKT+QT+DGRTLP+
Sbjct: 239 DYNPRTGRRQTLQFILQEKPHSNYTRDGNDLIYSLPLTFKESLLGFSKTIQTIDGRTLPI 298

Query: 299 SRSQPVQPTEENTYPGQGMPISKNPGQRGNLIIKYKINYPISLTDSQRRAIADNF 353
           SR QPVQP++ +TYPGQGMPI+K P QRGNLI+KYKI+YP++L DSQRRAI +NF
Sbjct: 299 SRVQPVQPSDSSTYPGQGMPIAKTPSQRGNLIVKYKIDYPVTLNDSQRRAILENF 353

 Score =  134 bits (338), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 70/110 (63%), Positives = 77/110 (70%), Gaps = 7/110 (6%)

Query: 1   MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDSNK 60
           MVK+TKLYDLLGVS SA + E+KKGYRKAALKYHPDKP+GD EKFKEISEAFEIL+D  K
Sbjct: 1   MVKDTKLYDLLGVSPSAQETELKKGYRKAALKYHPDKPSGDAEKFKEISEAFEILNDPQK 60

Query: 61  RSVYDQYGLDAARN-------XXXXXXXXXXXXXXXXSTHSFSNDDAFNI 103
           R VYD YGL+AARN                         HSFSN+DAFNI
Sbjct: 61  REVYDTYGLEAARNGGPAFGGAGGPGGAGGHPGAGFAGAHSFSNEDAFNI 110

>KLTH0H12100g Chr8 complement(1032695..1033747) [1053 bp, 350 aa]
           {ON} some similarities with uniprot|P25294 Saccharomyces
           cerevisiae YNL007C SIS1 HSP40 family chaperone sit4
           suppressor dnaJ homolog
          Length = 350

 Score =  276 bits (705), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 127/175 (72%), Positives = 154/175 (88%)

Query: 179 EEEVVSVDIPVSLEDLFTGKKKSFKIGRKGMRGEPEKVQIDINLKPGWKEGTKLTYKNHG 238
           EE+ V V++PVSLEDLF+GKKKSFKI RKG  G PEK Q+DI L+PGWK GTK+TYKN G
Sbjct: 176 EEKTVQVNLPVSLEDLFSGKKKSFKITRKGPGGAPEKQQVDIQLRPGWKAGTKITYKNEG 235

Query: 239 DYNPSTGGRKTLQFIIKEKKHPLYKRDGDNIIYTLPLTFKESLLGFSKTLQTLDGRTLPL 298
           DYNP TG R+T+QFII+EK H  Y RDG+++IYTLPLTFKESLLGF+KT+QT+DGRTLP+
Sbjct: 236 DYNPRTGRRQTMQFIIQEKPHENYTRDGNDLIYTLPLTFKESLLGFNKTIQTIDGRTLPI 295

Query: 299 SRSQPVQPTEENTYPGQGMPISKNPGQRGNLIIKYKINYPISLTDSQRRAIADNF 353
           SR QPVQP++ +TYPGQGMP++KNP QRGNLI+KYKI+YP +L DSQRRAI++NF
Sbjct: 296 SRVQPVQPSDVSTYPGQGMPVAKNPSQRGNLIVKYKIDYPATLNDSQRRAISENF 350

 Score =  139 bits (349), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 71/108 (65%), Positives = 79/108 (73%), Gaps = 5/108 (4%)

Query: 1   MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDSNK 60
           MVK+TKLYDLLGVS SA + E+KKGYRKAALKYHPDKPTGD EKFKEISEAFEIL+D  K
Sbjct: 1   MVKDTKLYDLLGVSPSAQETELKKGYRKAALKYHPDKPTGDAEKFKEISEAFEILNDPQK 60

Query: 61  RSVYDQYGLDAARN-----XXXXXXXXXXXXXXXXSTHSFSNDDAFNI 103
           R +YD YGL+AARN                     S+HSFSN+DAFNI
Sbjct: 61  REIYDNYGLEAARNGGPAFGGAGGAGGAGGHPGFASSHSFSNEDAFNI 108

>KAFR0H03150 Chr8 (601486..602565) [1080 bp, 359 aa] {ON} Anc_1.398
           YNL007C
          Length = 359

 Score =  274 bits (701), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 124/175 (70%), Positives = 150/175 (85%)

Query: 179 EEEVVSVDIPVSLEDLFTGKKKSFKIGRKGMRGEPEKVQIDINLKPGWKEGTKLTYKNHG 238
           +EE V V +PVSLEDLF GKKKSFKIGRKG  G PEK QIDI LKPGWK GTK+TYK+ G
Sbjct: 185 QEETVQVSLPVSLEDLFHGKKKSFKIGRKGQGGIPEKTQIDIQLKPGWKAGTKITYKSQG 244

Query: 239 DYNPSTGGRKTLQFIIKEKKHPLYKRDGDNIIYTLPLTFKESLLGFSKTLQTLDGRTLPL 298
           DYNP TGGRKTLQF+++EK HP++KR+GD++  TLPLTFKESLLGF+K +QT+DGRTLP+
Sbjct: 245 DYNPQTGGRKTLQFMLQEKNHPVFKREGDDLTCTLPLTFKESLLGFNKQIQTIDGRTLPI 304

Query: 299 SRSQPVQPTEENTYPGQGMPISKNPGQRGNLIIKYKINYPISLTDSQRRAIADNF 353
           SR+QP+QP+E + YPGQGMPI K P QRGNLI++YKI+YPI+L D+Q+ AI  NF
Sbjct: 305 SRTQPIQPSETSVYPGQGMPIPKTPSQRGNLIVRYKIDYPITLNDAQKNAILQNF 359

 Score =  144 bits (362), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 75/109 (68%), Positives = 80/109 (73%), Gaps = 6/109 (5%)

Query: 1   MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDSNK 60
           MVKETKLYDLLGVS SA+D EIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSD NK
Sbjct: 1   MVKETKLYDLLGVSPSANDQEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDKNK 60

Query: 61  RSVYDQYGLDAARN------XXXXXXXXXXXXXXXXSTHSFSNDDAFNI 103
           R VYDQYGL AAR+                        H+F+N+DAFNI
Sbjct: 61  REVYDQYGLQAARSGGPQFGGAGGPGGAGGFPGGGFGGHAFTNEDAFNI 109

>SAKL0D08778g Chr4 (729953..730999) [1047 bp, 348 aa] {ON} similar
           to uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
           HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 348

 Score =  273 bits (699), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 124/175 (70%), Positives = 152/175 (86%)

Query: 179 EEEVVSVDIPVSLEDLFTGKKKSFKIGRKGMRGEPEKVQIDINLKPGWKEGTKLTYKNHG 238
           EEE V V++PVSLEDLF G+KKSFKI RKG    PEK QIDI +KPGWK GTK+T+KN G
Sbjct: 174 EEETVQVNLPVSLEDLFAGRKKSFKITRKGPGSVPEKKQIDIQMKPGWKAGTKITFKNEG 233

Query: 239 DYNPSTGGRKTLQFIIKEKKHPLYKRDGDNIIYTLPLTFKESLLGFSKTLQTLDGRTLPL 298
           DYN  TGGR+T+QF+I+EK HP +KRDG+N+IYTLPL+FKESLLGFSKT+QT+DGRTLP+
Sbjct: 234 DYNQQTGGRQTMQFVIQEKLHPHFKRDGNNLIYTLPLSFKESLLGFSKTIQTIDGRTLPI 293

Query: 299 SRSQPVQPTEENTYPGQGMPISKNPGQRGNLIIKYKINYPISLTDSQRRAIADNF 353
           SR QP+QP+E +TYPGQGMP+ K P QRG+LIIKYK++YPI L ++Q+RAIA+NF
Sbjct: 294 SRVQPIQPSETSTYPGQGMPLPKTPAQRGDLIIKYKVDYPIGLNEAQKRAIAENF 348

 Score =  133 bits (334), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 77/113 (68%), Gaps = 10/113 (8%)

Query: 1   MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDSNK 60
           MVK+TKLYDLLGVS SA + E+KKGYRKAALKYHPDKPTGDTEKFKEISEAFEIL+D  K
Sbjct: 1   MVKDTKLYDLLGVSPSADEGELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPQK 60

Query: 61  RSVYDQYGLDAARNXXXXXXXXXXXXXXXXST----------HSFSNDDAFNI 103
           R +YD YGL+AARN                            H+FS +DAFNI
Sbjct: 61  REIYDSYGLEAARNGGPSFGGAGAGAGGFPGGAGGFPGGAGQHAFSQEDAFNI 113

>NCAS0C04890 Chr3 (997613..998716) [1104 bp, 367 aa] {ON} Anc_1.398
          Length = 367

 Score =  274 bits (700), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 151/176 (85%)

Query: 178 HEEEVVSVDIPVSLEDLFTGKKKSFKIGRKGMRGEPEKVQIDINLKPGWKEGTKLTYKNH 237
            EE+   V +PVSLEDLF GKKKSFK+GRKG  G+ EK QIDI LKPGWK GTK+TYK+ 
Sbjct: 192 QEEKTDEVHLPVSLEDLFVGKKKSFKVGRKGPDGKHEKTQIDIQLKPGWKAGTKITYKSK 251

Query: 238 GDYNPSTGGRKTLQFIIKEKKHPLYKRDGDNIIYTLPLTFKESLLGFSKTLQTLDGRTLP 297
           GDYNP TGGRKTLQFII EK HP +KR+ DN+IYTLPLTFKESLLGFSKT+QT+DG+ LP
Sbjct: 252 GDYNPKTGGRKTLQFIISEKPHPHFKREDDNLIYTLPLTFKESLLGFSKTIQTIDGKNLP 311

Query: 298 LSRSQPVQPTEENTYPGQGMPISKNPGQRGNLIIKYKINYPISLTDSQRRAIADNF 353
           LSR QPVQP+E  TYPGQGMPI+K PGQRG+L+IKYK++YPI+LT +QR AI++NF
Sbjct: 312 LSRGQPVQPSETTTYPGQGMPITKKPGQRGDLLIKYKVDYPINLTPAQREAISNNF 367

 Score =  128 bits (321), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 78/109 (71%), Gaps = 6/109 (5%)

Query: 1   MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDSNK 60
           MVKETKLYDLL V  +A++ E+KKGYRKAALKYHPDKPTGDTEKFKEISEAFEIL+D  K
Sbjct: 1   MVKETKLYDLLNVQPTANEQELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPQK 60

Query: 61  RSVYDQYGLDAARNXXX------XXXXXXXXXXXXXSTHSFSNDDAFNI 103
           R +YDQYGL+AARN                        H+FSN+DAFNI
Sbjct: 61  REIYDQYGLEAARNGGAIPTSDGGASFQGGFPGGAGGAHAFSNEDAFNI 109

>Kpol_457.15 s457 (41492..42565) [1074 bp, 357 aa] {ON}
           (41492..42565) [1074 nt, 358 aa]
          Length = 357

 Score =  271 bits (693), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 127/174 (72%), Positives = 150/174 (86%)

Query: 180 EEVVSVDIPVSLEDLFTGKKKSFKIGRKGMRGEPEKVQIDINLKPGWKEGTKLTYKNHGD 239
           EEVV VD+PVSLEDLF GKKK+FKIGRKG  GE EK QI+I LK GWK GTK+TYKN GD
Sbjct: 184 EEVVQVDLPVSLEDLFEGKKKTFKIGRKGPNGEAEKAQIEIALKAGWKAGTKITYKNQGD 243

Query: 240 YNPSTGGRKTLQFIIKEKKHPLYKRDGDNIIYTLPLTFKESLLGFSKTLQTLDGRTLPLS 299
           YNPSTGGRKTLQFI+KEK +  +KRD DN+IYTLPLTFKESLLGF KT++T+DG+TLP+S
Sbjct: 244 YNPSTGGRKTLQFILKEKPNTNFKRDEDNLIYTLPLTFKESLLGFQKTIKTIDGKTLPIS 303

Query: 300 RSQPVQPTEENTYPGQGMPISKNPGQRGNLIIKYKINYPISLTDSQRRAIADNF 353
           R QPVQP+E  TYPGQGMPISK+ GQRG++I+K+K+ YP SLT+ Q+R I +NF
Sbjct: 304 RVQPVQPSECTTYPGQGMPISKSVGQRGDMIVKFKVGYPTSLTEDQKRVINENF 357

 Score =  142 bits (358), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 71/103 (68%), Positives = 77/103 (74%)

Query: 1   MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDSNK 60
           MVKET LYDLL VS +A++ EIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSD+ K
Sbjct: 1   MVKETGLYDLLNVSPTANEQEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDAEK 60

Query: 61  RSVYDQYGLDAARNXXXXXXXXXXXXXXXXSTHSFSNDDAFNI 103
           R VYDQYGL AAR                   H+F+NDDAFNI
Sbjct: 61  REVYDQYGLKAARGEAPQFANGGAGGFPGGGAHTFTNDDAFNI 103

>AAL008W Chr1 (327127..328176) [1050 bp, 349 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL007C (SIS1)
          Length = 349

 Score =  269 bits (688), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 122/175 (69%), Positives = 152/175 (86%)

Query: 179 EEEVVSVDIPVSLEDLFTGKKKSFKIGRKGMRGEPEKVQIDINLKPGWKEGTKLTYKNHG 238
           EE++V V++PVSLEDLF GK+KSFKI RKG  G PEK QIDI L+PGWK GTK+TYKN G
Sbjct: 175 EEKLVQVNLPVSLEDLFVGKRKSFKITRKGQTGIPEKKQIDIQLRPGWKAGTKITYKNEG 234

Query: 239 DYNPSTGGRKTLQFIIKEKKHPLYKRDGDNIIYTLPLTFKESLLGFSKTLQTLDGRTLPL 298
           DYNPSTGGR+T+QFII+EK H  +KRDG+++IYTLPLTFKESLLGF KT++T+DGR + +
Sbjct: 235 DYNPSTGGRQTIQFIIQEKPHEFFKRDGNDLIYTLPLTFKESLLGFDKTVRTIDGRQISI 294

Query: 299 SRSQPVQPTEENTYPGQGMPISKNPGQRGNLIIKYKINYPISLTDSQRRAIADNF 353
            ++QPVQP+EE  YPGQGMP+SKNP +RG+LI+KYK +YPI+LT+ QRRAI +NF
Sbjct: 295 HKTQPVQPSEEMRYPGQGMPLSKNPSERGDLIVKYKTDYPITLTEKQRRAILENF 349

 Score =  142 bits (357), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 75/111 (67%), Positives = 79/111 (71%), Gaps = 8/111 (7%)

Query: 1   MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDSNK 60
           MVKETKLYDLLGVS SASDAE+KKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSD NK
Sbjct: 1   MVKETKLYDLLGVSPSASDAELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDPNK 60

Query: 61  RSVYDQYGLDAARNXXXXXXXXXXXXXXXXST--------HSFSNDDAFNI 103
           R VYD YGL+AAR                           H+FS +DAFNI
Sbjct: 61  REVYDTYGLEAARGNAPSGFGGAGPGGAGFGGFSTGGGGRHAFSQEDAFNI 111

>NDAI0G04250 Chr7 (1021818..1022909) [1092 bp, 363 aa] {ON}
           Anc_1.398
          Length = 363

 Score =  268 bits (684), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 130/176 (73%), Positives = 144/176 (81%)

Query: 178 HEEEVVSVDIPVSLEDLFTGKKKSFKIGRKGMRGEPEKVQIDINLKPGWKEGTKLTYKNH 237
            EE V  V I VSLEDLF GKKKSFKIGRKG  G  EK QIDI LKPGWK GTKLTYKN 
Sbjct: 186 QEEGVDEVHISVSLEDLFAGKKKSFKIGRKGPGGVQEKTQIDIQLKPGWKAGTKLTYKNK 245

Query: 238 GDYNPSTGGRKTLQFIIKEKKHPLYKRDGDNIIYTLPLTFKESLLGFSKTLQTLDGRTLP 297
           GDYNP T GRKTLQFII EK HP ++R+ DN++ T+PLTFKESLLGFSKT+QT+DGR LP
Sbjct: 246 GDYNPRTHGRKTLQFIIDEKPHPTFQREDDNLVCTVPLTFKESLLGFSKTVQTIDGRNLP 305

Query: 298 LSRSQPVQPTEENTYPGQGMPISKNPGQRGNLIIKYKINYPISLTDSQRRAIADNF 353
           +SRSQP+QPTE   YPGQGMPISK PGQRG+LI+KYKI YPI+LT +QR AI  NF
Sbjct: 306 ISRSQPIQPTEITRYPGQGMPISKKPGQRGDLIVKYKIAYPITLTQAQRDAIKTNF 361

 Score =  144 bits (363), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 73/111 (65%), Positives = 83/111 (74%), Gaps = 8/111 (7%)

Query: 1   MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDSNK 60
           MVKETKLYDLLGV+ SA++ EIKKGYRKAALKYHPDKPTGDTEKFK+ISEA+EILSDSNK
Sbjct: 1   MVKETKLYDLLGVTPSANEQEIKKGYRKAALKYHPDKPTGDTEKFKQISEAYEILSDSNK 60

Query: 61  RSVYDQYGLDAARNXXXXXXXXXXXXXXXXS--------THSFSNDDAFNI 103
           R +YDQYGL+AARN                +         H+FSN+DAFNI
Sbjct: 61  REIYDQYGLEAARNGGAMPMPGQDGTTFTSTGGFPGGGGAHAFSNEDAFNI 111

>Ecym_1292 Chr1 complement(593715..594758) [1044 bp, 347 aa] {ON}
           similar to Ashbya gossypii AAL008W
          Length = 347

 Score =  265 bits (677), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 152/176 (86%)

Query: 178 HEEEVVSVDIPVSLEDLFTGKKKSFKIGRKGMRGEPEKVQIDINLKPGWKEGTKLTYKNH 237
            EE+VV V++PVSLEDL+ GK+KSFKI RKG  G PEK QIDI L+PGWK GTK+TYKN 
Sbjct: 172 QEEKVVQVNLPVSLEDLYAGKRKSFKITRKGPSGIPEKKQIDIQLRPGWKAGTKITYKNE 231

Query: 238 GDYNPSTGGRKTLQFIIKEKKHPLYKRDGDNIIYTLPLTFKESLLGFSKTLQTLDGRTLP 297
           GDYNPSTGGR+TLQFII+EK H   KRDG+++ YTLPL+FKESLLGFSKT+ T+DGR + 
Sbjct: 232 GDYNPSTGGRQTLQFIIQEKMHDFLKRDGNDLTYTLPLSFKESLLGFSKTVHTIDGRQIF 291

Query: 298 LSRSQPVQPTEENTYPGQGMPISKNPGQRGNLIIKYKINYPISLTDSQRRAIADNF 353
           +S++QPVQP+EE+ YPGQGMP+SKNP +RG+LI+KYKI+YPI+L++ Q+ AIA NF
Sbjct: 292 ISKTQPVQPSEESRYPGQGMPLSKNPSERGDLIVKYKIDYPITLSEQQKLAIAGNF 347

 Score =  132 bits (332), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 69/73 (94%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDSNK 60
          MVKETKLYDLLGVS + +DAE+KKGYRKAALKYHPDKPTGDTEKFKEISEAFEIL+D NK
Sbjct: 1  MVKETKLYDLLGVSPNCNDAELKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILNDPNK 60

Query: 61 RSVYDQYGLDAAR 73
          R VYD+YGL+AAR
Sbjct: 61 REVYDKYGLEAAR 73

>KLLA0D04818g Chr4 complement(411615..412679) [1065 bp, 354 aa] {ON}
           similar to gnl|GLV|CAGL0H03707g Candida glabrata
           CAGL0H03707g and some similarites with YNL007C
           uniprot|P25294 Saccharomyces cerevisiae YNL007C SIS1
           HSP40 family chaperone sit4 suppressor dnaJ homolog
          Length = 354

 Score =  262 bits (669), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 120/175 (68%), Positives = 149/175 (85%)

Query: 179 EEEVVSVDIPVSLEDLFTGKKKSFKIGRKGMRGEPEKVQIDINLKPGWKEGTKLTYKNHG 238
           EEEVV V++PVSLEDLF+GKKKSFKI RKG  G  EK QIDI LKPGWK GTK+T+K  G
Sbjct: 180 EEEVVQVNLPVSLEDLFSGKKKSFKITRKGAGGVSEKNQIDIQLKPGWKAGTKITFKGEG 239

Query: 239 DYNPSTGGRKTLQFIIKEKKHPLYKRDGDNIIYTLPLTFKESLLGFSKTLQTLDGRTLPL 298
           DYNP TGGR+TLQF+++EK H  + R  +++IYTLPL+FKESLLGFSK +QT+DG+T+P+
Sbjct: 240 DYNPRTGGRQTLQFVLQEKPHEFFTRQDNDLIYTLPLSFKESLLGFSKQVQTIDGKTIPI 299

Query: 299 SRSQPVQPTEENTYPGQGMPISKNPGQRGNLIIKYKINYPISLTDSQRRAIADNF 353
           +R+QP+QPT+ +TYPGQGM +SKNP QRG+LIIK+KI+YP SLT  QR+AI DNF
Sbjct: 300 TRTQPIQPTQTSTYPGQGMTLSKNPSQRGDLIIKFKIDYPTSLTPQQRQAIMDNF 354

 Score =  137 bits (346), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 72/113 (63%), Positives = 78/113 (69%), Gaps = 10/113 (8%)

Query: 1   MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDSNK 60
           MVK+TKLYDLLG+S SA +AEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSD+ K
Sbjct: 1   MVKDTKLYDLLGISPSAGEAEIKKGYRKAALKYHPDKPTGDTEKFKEISEAFEILSDAQK 60

Query: 61  RSVYDQYGLDAARNXX----------XXXXXXXXXXXXXXSTHSFSNDDAFNI 103
           R VYD YGL+AAR                             H+FS DDAFNI
Sbjct: 61  REVYDTYGLEAARGNAPQFGGAGGPGGPGGPGGFSSGGFAGGHAFSQDDAFNI 113

>Kpol_1003.12 s1003 complement(35339..36565) [1227 bp, 408 aa]
          {ON} complement(35339..36565) [1227 nt, 409 aa]
          Length = 408

 Score =  103 bits (258), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 53/70 (75%), Positives = 60/70 (85%), Gaps = 2/70 (2%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDK-PTGD-TEKFKEISEAFEILSDS 58
          MVKETK YDLLGVS +AS++EIKKGYRKAALKYHPDK PT +  EKFKE S A+E+LSDS
Sbjct: 1  MVKETKFYDLLGVSPNASESEIKKGYRKAALKYHPDKNPTDEAAEKFKECSGAYEVLSDS 60

Query: 59 NKRSVYDQYG 68
           KR +YDQYG
Sbjct: 61 QKREIYDQYG 70

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 71/134 (52%), Gaps = 4/134 (2%)

Query: 207 KGMRGEPEKVQIDINLKPGWKEGTKLTYKNHGDYNPSTGGRKTLQFIIKEKKHPLYKRDG 266
           KG +   E+  ++++++PG +EG K+T+K   D  P       + F++ EK H  +KR G
Sbjct: 204 KGNKVANERKVLEVHVEPGMREGQKVTFKGEADQAPDIIPGDVI-FVVTEKPHKHFKRSG 262

Query: 267 DNIIYTLPLTFKESLLGFSKTLQTLDGRTLPLS--RSQPVQPTEENTYPGQGMPISKNPG 324
           D+++Y   +    ++ G    ++ + G  L ++    + + P       G+GMP+ K  G
Sbjct: 263 DDLLYEAEVDLLTAIAGGDFAIEHVSGDWLKVTIVPGEVISPGVRKVIDGKGMPVQKY-G 321

Query: 325 QRGNLIIKYKINYP 338
             GNLII +KI +P
Sbjct: 322 GYGNLIITFKIKFP 335

>TBLA0E03810 Chr5 complement(959045..960277) [1233 bp, 410 aa]
          {ON} Anc_2.243 YNL064C
          Length = 410

 Score =  101 bits (252), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 51/70 (72%), Positives = 59/70 (84%), Gaps = 2/70 (2%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDK-PTGD-TEKFKEISEAFEILSDS 58
          MVK+TK YD+LGVS +AS++EIKKGYRKAALKYHPDK PT +  EKFKE S A+E+LSD 
Sbjct: 1  MVKDTKFYDILGVSPTASESEIKKGYRKAALKYHPDKNPTAEAAEKFKECSAAYEVLSDP 60

Query: 59 NKRSVYDQYG 68
           KR VYDQYG
Sbjct: 61 EKRDVYDQYG 70

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 67/127 (52%), Gaps = 4/127 (3%)

Query: 214 EKVQIDINLKPGWKEGTKLTYKNHGDYNPSTGGRKTLQFIIKEKKHPLYKRDGDNIIYTL 273
           E+  +++ ++PG K+G ++ +K   D  P       + F++ EK H  ++R G++++Y  
Sbjct: 213 ERKILEVKIEPGMKDGQRIVFKGESDQAPDIIPGDVV-FVVNEKPHKHFQRSGNDLVYLA 271

Query: 274 PLTFKESLLGFSKTLQTLDGRTLPLS--RSQPVQPTEENTYPGQGMPISKNPGQRGNLII 331
            +    ++ G    L+ + G  L ++    + + P  +    G+GMPI K  G  GNLII
Sbjct: 272 EIDLLTAIAGGEFALEHVSGEWLKIAIVAGEVIAPGAKKVIEGKGMPILKY-GGYGNLII 330

Query: 332 KYKINYP 338
           ++ I +P
Sbjct: 331 QFNIKFP 337

>CAGL0J09966g Chr10 complement(978692..979915) [1224 bp, 407 aa]
          {ON} highly similar to uniprot|P25491 Saccharomyces
          cerevisiae YNL064c YDJ1
          Length = 407

 Score =  101 bits (251), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 51/70 (72%), Positives = 57/70 (81%), Gaps = 2/70 (2%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILSDS 58
          MVK+TKLYD LGVS  ASDAEIKK YRK+ALKYHPDK   +   EKFKE+S A+EILSDS
Sbjct: 1  MVKDTKLYDTLGVSPGASDAEIKKAYRKSALKYHPDKNPSEEAAEKFKEVSSAYEILSDS 60

Query: 59 NKRSVYDQYG 68
           KR VYDQ+G
Sbjct: 61 QKREVYDQFG 70

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 68/133 (51%), Gaps = 4/133 (3%)

Query: 208 GMRGEPEKVQIDINLKPGWKEGTKLTYKNHGDYNPSTGGRKTLQFIIKEKKHPLYKRDGD 267
           G + + E+  +++ ++PG K+G K+ +K   D  P       + F+I EK H  ++R GD
Sbjct: 204 GKKVDNERKILEVRIEPGMKDGQKIVFKGEADQAPDVIPGDVV-FVISEKPHKHFQRAGD 262

Query: 268 NIIYTLPLTFKESLLGFSKTLQTLDGRTLPLS--RSQPVQPTEENTYPGQGMPISKNPGQ 325
           ++IY   +    +L G    L+ + G  L +     + + P       G+GMPI K  G 
Sbjct: 263 DLIYEAEIDLLTALAGGQFALEHVSGDWLKVDIVPGEVIAPGARKIVEGKGMPIQKY-GG 321

Query: 326 RGNLIIKYKINYP 338
            GNL+IK+ I +P
Sbjct: 322 YGNLLIKFNIKFP 334

>KAFR0J00940 Chr10 complement(170725..171960) [1236 bp, 411 aa]
          {ON} Anc_2.243 YNL064C
          Length = 411

 Score = 99.8 bits (247), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 58/73 (79%), Gaps = 2/73 (2%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILSDS 58
          MV+ETKLYD+LGVS +ASD+EIKK YRK ALKYHPDK   +   EKFKE S A+E+LSDS
Sbjct: 1  MVRETKLYDILGVSPTASDSEIKKAYRKQALKYHPDKNPSEEAAEKFKEASSAYEVLSDS 60

Query: 59 NKRSVYDQYGLDA 71
           KR +YDQ+G D 
Sbjct: 61 EKRDIYDQFGQDG 73

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 64/127 (50%), Gaps = 4/127 (3%)

Query: 214 EKVQIDINLKPGWKEGTKLTYKNHGDYNPSTGGRKTLQFIIKEKKHPLYKRDGDNIIYTL 273
           E+  + +N+ PG K G K+ +K   D  P       + F+I EK H  ++R GD++IY  
Sbjct: 211 ERKILQVNVDPGMKNGQKVVFKGEADQAPDIIPGDVI-FVISEKPHKHFQRVGDDLIYEA 269

Query: 274 PLTFKESLLGFSKTLQTLDGRTLPLS--RSQPVQPTEENTYPGQGMPISKNPGQRGNLII 331
            +    ++ G    L+ + G  L +S    + + P       G+GMPI K  G  GNLII
Sbjct: 270 EIDLLTAVAGGEFALEHVSGEWLKVSIVPGEVIAPNMRKVVEGKGMPIQKY-GGYGNLII 328

Query: 332 KYKINYP 338
           K+ I +P
Sbjct: 329 KFSIKFP 335

>Skud_14.268 Chr14 complement(496140..497372) [1233 bp, 410 aa]
          {ON} YNL064C (REAL)
          Length = 410

 Score = 99.8 bits (247), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 56/73 (76%), Gaps = 2/73 (2%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILSDS 58
          MVKETK YD+LGVS +A+D EIKK YRK ALKYHPDK   +   EKFKE S A+EILSDS
Sbjct: 1  MVKETKFYDILGVSVTATDVEIKKAYRKCALKYHPDKNPSEEAAEKFKEASSAYEILSDS 60

Query: 59 NKRSVYDQYGLDA 71
           KR VYDQ+G D 
Sbjct: 61 EKRDVYDQFGEDG 73

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 70/133 (52%), Gaps = 4/133 (3%)

Query: 208 GMRGEPEKVQIDINLKPGWKEGTKLTYKNHGDYNPSTGGRKTLQFIIKEKKHPLYKRDGD 267
           G + E E+  ++++++PG K+G ++ +K   D  P       + F++ E+ H  +KRDGD
Sbjct: 207 GKKVENERKILEVHVEPGMKDGQRIVFKGEADQAPDVIPGDVV-FLVSERPHKSFKRDGD 265

Query: 268 NIIYTLPLTFKESLLGFSKTLQTLDGRTLPLS--RSQPVQPTEENTYPGQGMPISKNPGQ 325
           +++Y   +    ++ G    L+ + G  L +     + + P       G+GMP+ K  G 
Sbjct: 266 DLVYEAEIDLLTAIAGGEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPVPKY-GG 324

Query: 326 RGNLIIKYKINYP 338
            GNLIIK+ + +P
Sbjct: 325 YGNLIIKFTVKFP 337

>TPHA0C03110 Chr3 complement(687136..688359) [1224 bp, 407 aa]
          {ON} Anc_2.243 YNL064C
          Length = 407

 Score = 99.0 bits (245), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 55/69 (79%), Gaps = 2/69 (2%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILSDS 58
          MVKETK YDLLGVS +AS+ EIKKGYRK ALKYHPDK   +   EKFKE S A+E+LSDS
Sbjct: 1  MVKETKFYDLLGVSPNASETEIKKGYRKQALKYHPDKNPSEEAAEKFKECSAAYEVLSDS 60

Query: 59 NKRSVYDQY 67
           KR VYDQY
Sbjct: 61 QKREVYDQY 69

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 70/134 (52%), Gaps = 4/134 (2%)

Query: 207 KGMRGEPEKVQIDINLKPGWKEGTKLTYKNHGDYNPSTGGRKTLQFIIKEKKHPLYKRDG 266
           KG +   E+  ++++++PG +EG K+ +K   D  P       + F++ EK H  +KR G
Sbjct: 204 KGKKIANERKVLEVHVEPGMREGQKIVFKGEADQAPDVIPGDVI-FVVVEKPHKHFKRAG 262

Query: 267 DNIIYTLPLTFKESLLGFSKTLQTLDGRTLPLSR--SQPVQPTEENTYPGQGMPISKNPG 324
           D+++Y   +    ++ G    +Q + G  L +S    + +    +    G+GMP+ K  G
Sbjct: 263 DDLLYEAEIDLLTAIAGGEFAIQHVSGDWLKVSTVPGEVISSGMKKVIEGKGMPVPKY-G 321

Query: 325 QRGNLIIKYKINYP 338
             GNLI+ +KI +P
Sbjct: 322 GYGNLIVTFKIKFP 335

>Smik_14.263 Chr14 complement(486255..487484) [1230 bp, 409 aa]
          {ON} YNL064C (REAL)
          Length = 409

 Score = 98.6 bits (244), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 55/70 (78%), Gaps = 2/70 (2%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILSDS 58
          MVKETK YD+LGVS +A+D EIKK YRK ALKYHPDK   +   EKFKE S A+EILSDS
Sbjct: 1  MVKETKFYDILGVSVTATDVEIKKAYRKCALKYHPDKNPSEEAAEKFKEASSAYEILSDS 60

Query: 59 NKRSVYDQYG 68
           KR VYDQ+G
Sbjct: 61 EKREVYDQFG 70

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 70/133 (52%), Gaps = 4/133 (3%)

Query: 208 GMRGEPEKVQIDINLKPGWKEGTKLTYKNHGDYNPSTGGRKTLQFIIKEKKHPLYKRDGD 267
           G + E E+  ++++++PG K+G ++ +K   D  P       + FI+ E+ H  +KRDGD
Sbjct: 206 GKKVENERKILEVHVEPGMKDGQRIVFKGEADQAPDVIPGDVV-FIVSERPHKNFKRDGD 264

Query: 268 NIIYTLPLTFKESLLGFSKTLQTLDGRTLPLS--RSQPVQPTEENTYPGQGMPISKNPGQ 325
           +++Y   +    ++ G    L+ + G  L +     + + P       G+GMPI K  G 
Sbjct: 265 DLVYEAEIDLLTAIAGGEFALEHVSGDWLKVGIVPGEVISPGMRKVIEGKGMPIPKY-GG 323

Query: 326 RGNLIIKYKINYP 338
            GNL+IK+ I +P
Sbjct: 324 YGNLVIKFTIKFP 336

>KLLA0F03333g Chr6 complement(313991..315220) [1230 bp, 409 aa]
          {ON} highly similar to uniprot|P25491 Saccharomyces
          cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
          envelope protein) heat shock protein
          Length = 409

 Score = 98.6 bits (244), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 58/73 (79%), Gaps = 2/73 (2%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILSDS 58
          MVK+TKLYDLLGVS  A D +IKK YRK+ALK+HPDK   +   EKFKEI+ A+EILSDS
Sbjct: 1  MVKDTKLYDLLGVSPGADDNQIKKAYRKSALKFHPDKNPSEEAAEKFKEITSAYEILSDS 60

Query: 59 NKRSVYDQYGLDA 71
           KR VYDQ+GL+ 
Sbjct: 61 QKREVYDQFGLEG 73

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 69/127 (54%), Gaps = 4/127 (3%)

Query: 214 EKVQIDINLKPGWKEGTKLTYKNHGDYNPSTGGRKTLQFIIKEKKHPLYKRDGDNIIYTL 273
           E+  +++N++PG K+G ++ ++   D +P       + F++ E+ HP++KRDG+++ Y  
Sbjct: 209 ERKVLEVNIEPGMKDGQRIVFQGEADQSPGIIPGDVV-FVVSEQPHPVFKRDGNDLHYDA 267

Query: 274 PLTFKESLLGFSKTLQTLDGRTLPLS--RSQPVQPTEENTYPGQGMPISKNPGQRGNLII 331
            +    ++ G    ++ + G  L +     + + P       G+GMPI K  G  GNL+I
Sbjct: 268 EIDLLSAIAGGQFAVKHVSGEYLKVEIVPGEVISPGSVKVIEGKGMPIPKY-GGYGNLLI 326

Query: 332 KYKINYP 338
           K+ I +P
Sbjct: 327 KFNIKFP 333

>Suva_14.277 Chr14 complement(504861..506090) [1230 bp, 409 aa]
          {ON} YNL064C (REAL)
          Length = 409

 Score = 97.8 bits (242), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 58/73 (79%), Gaps = 2/73 (2%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDK-PTGD-TEKFKEISEAFEILSDS 58
          MVKETK YD+LGVS +A+D EIKK YRK ALK+HPDK P+ +  EKFKE S A+E+LSDS
Sbjct: 1  MVKETKFYDILGVSVTATDVEIKKAYRKCALKFHPDKNPSEEAAEKFKEASSAYEVLSDS 60

Query: 59 NKRSVYDQYGLDA 71
           KR VYDQ+G D 
Sbjct: 61 EKREVYDQFGEDG 73

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 70/133 (52%), Gaps = 4/133 (3%)

Query: 208 GMRGEPEKVQIDINLKPGWKEGTKLTYKNHGDYNPSTGGRKTLQFIIKEKKHPLYKRDGD 267
           G + E E+  ++++++PG K+G K+ +K   D  P       + F++ E+ H  +KRDGD
Sbjct: 206 GKKIENERKILEVHVEPGMKDGQKIVFKGEADQAPDVIPGDVV-FLVSERPHKHFKRDGD 264

Query: 268 NIIYTLPLTFKESLLGFSKTLQTLDGRTLPLS--RSQPVQPTEENTYPGQGMPISKNPGQ 325
           +++Y   +    ++ G    L+ + G  L +     + + P       G+GMP+ K  G 
Sbjct: 265 DLVYEAEIDLLTAIAGGEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPVPKY-GG 323

Query: 326 RGNLIIKYKINYP 338
            GNLI+K+ I +P
Sbjct: 324 YGNLIVKFTIKFP 336

>SAKL0E08734g Chr5 (713258..714493) [1236 bp, 411 aa] {ON} similar
          to uniprot|P25491 Saccharomyces cerevisiae YNL064C YDJ1
          yeast dnaJ homolog (nuclear envelope protein) heat
          shock protein
          Length = 411

 Score = 97.8 bits (242), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 57/68 (83%), Gaps = 2/68 (2%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDK-PTGD-TEKFKEISEAFEILSDS 58
          MVK+TKLYDL+GVS  A DA+IKK YRKAALKYHPDK PT +  EKFKEIS A+EILSDS
Sbjct: 1  MVKDTKLYDLIGVSPGADDAQIKKAYRKAALKYHPDKNPTEEAAEKFKEISSAYEILSDS 60

Query: 59 NKRSVYDQ 66
           KR +YDQ
Sbjct: 61 QKREMYDQ 68

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 65/127 (51%), Gaps = 4/127 (3%)

Query: 214 EKVQIDINLKPGWKEGTKLTYKNHGDYNPSTGGRKTLQFIIKEKKHPLYKRDGDNIIYTL 273
           E+  ++++++PG K+G K+ ++   D  P       + F++ E+ H  + R GD++ Y  
Sbjct: 213 ERKILEVHIEPGMKDGQKIVFQGEADQAPDV-VPGDVVFVVSERPHERFNRKGDDLYYEA 271

Query: 274 PLTFKESLLGFSKTLQTLDGRTLPLS--RSQPVQPTEENTYPGQGMPISKNPGQRGNLII 331
            +    ++ G    +Q + G  L +     + + P       G+GMP+ K  G  GNLI+
Sbjct: 272 EVDLLTAIAGGEFAVQHVSGDWLKVEIVPGEVIAPGATKIIEGKGMPVQKY-GGFGNLIV 330

Query: 332 KYKINYP 338
           K+KI +P
Sbjct: 331 KFKIKFP 337

>NCAS0G03000 Chr7 complement(552266..553498) [1233 bp, 410 aa]
          {ON} Anc_2.243
          Length = 410

 Score = 96.7 bits (239), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 49/68 (72%), Positives = 58/68 (85%), Gaps = 2/68 (2%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDK-PTGD-TEKFKEISEAFEILSDS 58
          MVK+TKLYD+LGVS +A D+EIKK YRK+ALKYHPDK PT +  EKFKE+S A+EILSDS
Sbjct: 1  MVKDTKLYDVLGVSPTAGDSEIKKAYRKSALKYHPDKNPTEEGAEKFKEVSAAYEILSDS 60

Query: 59 NKRSVYDQ 66
           KR +YDQ
Sbjct: 61 EKREIYDQ 68

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 66/127 (51%), Gaps = 4/127 (3%)

Query: 214 EKVQIDINLKPGWKEGTKLTYKNHGDYNPSTGGRKTLQFIIKEKKHPLYKRDGDNIIYTL 273
           E+  ++++++PG K+G  + +K   D  P       + F++ +K H  ++R GD+++Y  
Sbjct: 215 ERKILEVHIEPGMKDGQNIVFKGEADQAPDVIPGDVI-FVVAQKPHKHFQRSGDDLVYEA 273

Query: 274 PLTFKESLLGFSKTLQTLDGRTLPLS--RSQPVQPTEENTYPGQGMPISKNPGQRGNLII 331
            +    ++ G    L+ + G  L +S    + + P  +    G+GMPI K  G  GNLI+
Sbjct: 274 EIDLLTAIAGGEFALEHVSGDWLKVSILPGEVISPGSKKVIEGKGMPIPKYGGH-GNLIV 332

Query: 332 KYKINYP 338
            + + +P
Sbjct: 333 HFTVKFP 339

>Ecym_3281 Chr3 complement(532720..533949) [1230 bp, 409 aa] {ON}
          similar to Ashbya gossypii ADL257C
          Length = 409

 Score = 95.9 bits (237), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 48/68 (70%), Positives = 59/68 (86%), Gaps = 2/68 (2%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDK-PTGD-TEKFKEISEAFEILSDS 58
          MVK+TKLYDLLGVS+ A+DA+IKK YRKAALKYHPDK P+ +  +KFK+++ A+EILSDS
Sbjct: 1  MVKDTKLYDLLGVSADANDAQIKKAYRKAALKYHPDKNPSSEAADKFKQMTAAYEILSDS 60

Query: 59 NKRSVYDQ 66
           KR VYDQ
Sbjct: 61 QKREVYDQ 68

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 67/129 (51%), Gaps = 4/129 (3%)

Query: 214 EKVQIDINLKPGWKEGTKLTYKNHGDYNPSTGGRKTLQFIIKEKKHPLYKRDGDNIIYTL 273
           E+  +++N++PG K G K+ ++   D  P       + F++ E++HP + R+GDN+ Y  
Sbjct: 212 ERKILEVNIEPGMKNGQKVVFQGEADQQPGQIPGDVV-FVVNEQEHPKFVRNGDNLHYEA 270

Query: 274 PLTFKESLLGFSKTLQTLDGRTLPLS--RSQPVQPTEENTYPGQGMPISKNPGQRGNLII 331
            +    ++ G    L+ + G  L +     + + P       G+GMPI K  G  GNL+I
Sbjct: 271 QIDLLTAVAGGQFALEHVSGDWLKVDIVPGEVIAPGMVKVIEGKGMPIQKY-GSYGNLLI 329

Query: 332 KYKINYPIS 340
           K+ + +P S
Sbjct: 330 KFNVKFPKS 338

>KNAG0I01900 Chr9 (371556..372785) [1230 bp, 409 aa] {ON}
          Anc_2.243 YNL064C
          Length = 409

 Score = 95.9 bits (237), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 58/73 (79%), Gaps = 2/73 (2%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILSDS 58
          MVK+TKLYD+LGVS +A+D EIKK YRK ALK+HPDK   +   EKFKE S A+E+LSD+
Sbjct: 1  MVKDTKLYDVLGVSVTATDVEIKKAYRKMALKFHPDKNPSEEAAEKFKEASSAYEVLSDA 60

Query: 59 NKRSVYDQYGLDA 71
          +KR  YDQ+GL+ 
Sbjct: 61 DKRDTYDQFGLEG 73

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 66/127 (51%), Gaps = 4/127 (3%)

Query: 214 EKVQIDINLKPGWKEGTKLTYKNHGDYNPSTGGRKTLQFIIKEKKHPLYKRDGDNIIYTL 273
           E+  +++++ PG K G K+ +K   D  P       + F+I EK H  ++R GDN++Y  
Sbjct: 211 ERKILEVHVDPGMKNGQKVVFKGEADQAPDVIPGDVV-FVINEKPHKHFQRSGDNLVYEA 269

Query: 274 PLTFKESLLGFSKTLQTLDGRTLPLS--RSQPVQPTEENTYPGQGMPISKNPGQRGNLII 331
            +    ++ G    ++ + G  L ++    + + P       G+GMP++K  G  GNLII
Sbjct: 270 EVDLLTAIAGGEFAIEHVSGDWLKVAIVPGEVIAPGARKVIDGKGMPVAKY-GGYGNLII 328

Query: 332 KYKINYP 338
           K+ + +P
Sbjct: 329 KFTVKFP 335

>YNL064C Chr14 complement(505868..507097) [1230 bp, 409 aa] {ON}
          YDJ1Type I HSP40 co-chaperone involved in regulation of
          the HSP90 and HSP70 functions; involved in protein
          translocation across membranes; member of the DnaJ
          family
          Length = 409

 Score = 95.1 bits (235), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 54/73 (73%), Gaps = 2/73 (2%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILSDS 58
          MVKETK YD+LGV  +A+D EIKK YRK ALKYHPDK   +   EKFKE S A+EILSD 
Sbjct: 1  MVKETKFYDILGVPVTATDVEIKKAYRKCALKYHPDKNPSEEAAEKFKEASAAYEILSDP 60

Query: 59 NKRSVYDQYGLDA 71
           KR +YDQ+G D 
Sbjct: 61 EKRDIYDQFGEDG 73

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 70/133 (52%), Gaps = 4/133 (3%)

Query: 208 GMRGEPEKVQIDINLKPGWKEGTKLTYKNHGDYNPSTGGRKTLQFIIKEKKHPLYKRDGD 267
           G + E E+  ++++++PG K+G ++ +K   D  P       + FI+ E+ H  +KRDGD
Sbjct: 206 GKKVENERKILEVHVEPGMKDGQRIVFKGEADQAPDVIPGDVV-FIVSERPHKSFKRDGD 264

Query: 268 NIIYTLPLTFKESLLGFSKTLQTLDGRTLPLS--RSQPVQPTEENTYPGQGMPISKNPGQ 325
           +++Y   +    ++ G    L+ + G  L +     + + P       G+GMPI K  G 
Sbjct: 265 DLVYEAEIDLLTAIAGGEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPIPKY-GG 323

Query: 326 RGNLIIKYKINYP 338
            GNLIIK+ I +P
Sbjct: 324 YGNLIIKFTIKFP 336

>TDEL0C04600 Chr3 complement(833405..834640) [1236 bp, 411 aa]
          {ON} Anc_2.243 YNL064C
          Length = 411

 Score = 94.7 bits (234), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 58/69 (84%), Gaps = 2/69 (2%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDK-PTGD-TEKFKEISEAFEILSDS 58
          MVK++K YDLLGVS SA++ EIKK YRK+ALKYHPDK P+ +  EKFKE+S A+E+LSDS
Sbjct: 1  MVKDSKYYDLLGVSVSATEIEIKKAYRKSALKYHPDKNPSAEAAEKFKEVSSAYEVLSDS 60

Query: 59 NKRSVYDQY 67
           KR VYDQ+
Sbjct: 61 EKRQVYDQF 69

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 69/127 (54%), Gaps = 4/127 (3%)

Query: 214 EKVQIDINLKPGWKEGTKLTYKNHGDYNPSTGGRKTLQFIIKEKKHPLYKRDGDNIIYTL 273
           E+  +++++ PG K+G K+ +K   D  P       + F++ EK H  ++R GD+++Y  
Sbjct: 213 ERKILEVHVDPGMKDGQKIVFKGEADQAPDVIPGDVI-FVVSEKPHKNFQRVGDDLVYEA 271

Query: 274 PLTFKESLLGFSKTLQTLDGRTLPLS--RSQPVQPTEENTYPGQGMPISKNPGQRGNLII 331
            +    ++ G   +L+ + G  L ++    + + P       G+GMPI+K  G  GNL++
Sbjct: 272 EIDLLTAVAGGEFSLEHVSGDWLKVAIVPGEVISPGMRKVVEGKGMPIAKF-GGYGNLLV 330

Query: 332 KYKINYP 338
            +KIN+P
Sbjct: 331 TFKINFP 337

>ZYRO0A01496g Chr1 complement(123559..124797) [1239 bp, 412 aa]
          {ON} highly similar to gnl|GLV|CAGL0J09966g Candida
          glabrata CAGL0J09966g and similar to YNL064C
          uniprot|P25491 Saccharomyces cerevisiae YNL064C YDJ1
          yeast dnaJ homolog (nuclear envelope protein) heat
          shock protein
          Length = 412

 Score = 94.0 bits (232), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 46/70 (65%), Positives = 54/70 (77%), Gaps = 2/70 (2%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILSDS 58
          MVKETK YDLLGVS++AS+ EIKK YRK ALKYHPDK   +   EKFKE S A+E+L D+
Sbjct: 1  MVKETKFYDLLGVSATASETEIKKAYRKTALKYHPDKNPSEEAAEKFKEASSAYEVLMDA 60

Query: 59 NKRSVYDQYG 68
           KR  YDQ+G
Sbjct: 61 EKREAYDQFG 70

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 65/127 (51%), Gaps = 4/127 (3%)

Query: 214 EKVQIDINLKPGWKEGTKLTYKNHGDYNPSTGGRKTLQFIIKEKKHPLYKRDGDNIIYTL 273
           E+  +++++ PG K+G K+ +K   D  P       + F++ E+ H  ++RD D+++Y  
Sbjct: 214 ERKILEVHVDPGMKDGQKIVFKGEADQAPDIIPGDVI-FVVSERPHKHFRRDSDDLVYEA 272

Query: 274 PLTFKESLLGFSKTLQTLDGRTLPLS--RSQPVQPTEENTYPGQGMPISKNPGQRGNLII 331
            +    ++ G    ++ + G  L +     + + P       G+GMP+ K  G  GNL++
Sbjct: 273 DIDLLTAIAGGEFAIEHVSGDWLKVEIVPGEVISPGMRKVIEGKGMPVLKY-GGFGNLLV 331

Query: 332 KYKINYP 338
           K+ I +P
Sbjct: 332 KFNIVFP 338

>ADL257C Chr4 complement(249512..250744) [1233 bp, 410 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YNL064C
          (YDJ1)
          Length = 410

 Score = 92.0 bits (227), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 46/68 (67%), Positives = 56/68 (82%), Gaps = 2/68 (2%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILSDS 58
          MVK+TKLYDLLGVS  A+DA+IKK YRK+ALKYHPDK   +   +KFK+I+ A+EILSDS
Sbjct: 1  MVKDTKLYDLLGVSPDANDAQIKKAYRKSALKYHPDKNPSEEAADKFKQITGAYEILSDS 60

Query: 59 NKRSVYDQ 66
           KR +YDQ
Sbjct: 61 QKREMYDQ 68

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 67/129 (51%), Gaps = 4/129 (3%)

Query: 214 EKVQIDINLKPGWKEGTKLTYKNHGDYNPSTGGRKTLQFIIKEKKHPLYKRDGDNIIYTL 273
           E+  +++N++PG K G K+ ++   D  P       + F++ E++HP + R+GDN+ Y  
Sbjct: 213 ERKILEVNIQPGMKHGQKIVFQGEADQQPGQIPGDVV-FVVNEQEHPRFVRNGDNLHYEA 271

Query: 274 PLTFKESLLGFSKTLQTLDGRTLPLS--RSQPVQPTEENTYPGQGMPISKNPGQRGNLII 331
            +    ++ G    L+ + G  L +     + + P       G+GMPI K  G  G+L+I
Sbjct: 272 EIDLLTAIAGGQFALEHVSGDWLKIDIVPGEVIAPGMVKVIEGKGMPIQKY-GSYGDLLI 330

Query: 332 KYKINYPIS 340
           K+ + +P S
Sbjct: 331 KFNVKFPKS 339

>KLTH0G09394g Chr7 complement(782211..783446) [1236 bp, 411 aa]
          {ON} highly similar to uniprot|P25491 Saccharomyces
          cerevisiae YNL064C YDJ1 yeast dnaJ homolog (nuclear
          envelope protein) heat shock protein
          Length = 411

 Score = 91.3 bits (225), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 45/68 (66%), Positives = 56/68 (82%), Gaps = 2/68 (2%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDK-PTGD-TEKFKEISEAFEILSDS 58
          MVKETK YDLLGV   A+DA+IKKGYRK ALK+HPDK P+ +  +KFKE++ A+E+LSDS
Sbjct: 1  MVKETKFYDLLGVPVDANDAQIKKGYRKQALKFHPDKNPSAEAADKFKELTVAYEVLSDS 60

Query: 59 NKRSVYDQ 66
           KR +YDQ
Sbjct: 61 QKRDIYDQ 68

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 66/127 (51%), Gaps = 4/127 (3%)

Query: 214 EKVQIDINLKPGWKEGTKLTYKNHGDYNPSTGGRKTLQFIIKEKKHPLYKRDGDNIIYTL 273
           E+  ++++++PG K+G K+ ++   D  P       + F+I ++ H  ++R GDN+ Y  
Sbjct: 212 ERKILEVHIEPGMKDGQKIVFQGEADQAPGVIPGDVI-FVISQRPHKHFERKGDNLYYQA 270

Query: 274 PLTFKESLLGFSKTLQTLDGRTLPLS--RSQPVQPTEENTYPGQGMPISKNPGQRGNLII 331
            +    ++ G    ++ + G  L +     + + P       G+GMP+ K  G  G+LI+
Sbjct: 271 EVDLLSAIAGGEFAIEHVSGEWLKVGIVPGEVISPGMTKVIEGKGMPVQKY-GGFGDLIV 329

Query: 332 KYKINYP 338
            +K+N+P
Sbjct: 330 TFKVNFP 336

>NDAI0D01030 Chr4 complement(232909..234144) [1236 bp, 411 aa]
          {ON} Anc_2.243
          Length = 411

 Score = 89.7 bits (221), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 53/69 (76%), Gaps = 2/69 (2%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILSDS 58
          MVK+TK YD+LGVS SAS +EIKK YRK ALKYHPDK   +   EKFKE S A+E+LSD 
Sbjct: 1  MVKDTKFYDILGVSPSASSSEIKKAYRKFALKYHPDKNPSEEAAEKFKEASAAYEVLSDD 60

Query: 59 NKRSVYDQY 67
           KR +YDQ+
Sbjct: 61 EKREMYDQF 69

 Score = 62.0 bits (149), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 66/127 (51%), Gaps = 4/127 (3%)

Query: 214 EKVQIDINLKPGWKEGTKLTYKNHGDYNPSTGGRKTLQFIIKEKKHPLYKRDGDNIIYTL 273
           E+  ++++++PG K+G K+ +K   D  P       + F++ +K H  ++R GD+++Y  
Sbjct: 214 ERKILEVHIEPGMKDGQKVVFKGEADQAPDIIPGDVI-FVVSQKPHEHFQRAGDDLVYEA 272

Query: 274 PLTFKESLLGFSKTLQTLDGRTLPLS--RSQPVQPTEENTYPGQGMPISKNPGQRGNLII 331
            +    ++ G    ++ + G  L ++    + + P        +GMPI K  G  GNLI+
Sbjct: 273 EIDLLTAIAGGEFAIKHVSGEWLKVAIVPGEVISPGARKIISDKGMPIPKY-GGYGNLIV 331

Query: 332 KYKINYP 338
           K+ I +P
Sbjct: 332 KFNIKFP 338

>Kwal_23.4830 s23 complement(885244..886479) [1236 bp, 411 aa]
          {ON} YNL064C (YDJ1) - yeast dnaJ homolog (nuclear
          envelope protein); heat shock protein [contig 5] FULL
          Length = 411

 Score = 89.0 bits (219), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 44/68 (64%), Positives = 54/68 (79%), Gaps = 2/68 (2%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILSDS 58
          MVK+TK YDLLGVS  A+DA+IKK YRK ALK+HPDK   +   +KFKE++ A+EILSDS
Sbjct: 1  MVKDTKFYDLLGVSPDANDAQIKKAYRKQALKFHPDKNPSEEAADKFKELTVAYEILSDS 60

Query: 59 NKRSVYDQ 66
           KR +YDQ
Sbjct: 61 QKRDIYDQ 68

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 68/127 (53%), Gaps = 4/127 (3%)

Query: 214 EKVQIDINLKPGWKEGTKLTYKNHGDYNPSTGGRKTLQFIIKEKKHPLYKRDGDNIIYTL 273
           E+  ++++++PG K+G K+ ++   D  P       + F+I ++ H  ++R GD+++Y  
Sbjct: 213 ERKILEVHIEPGMKDGQKIVFQGEADQAPGIIPGDVV-FVISQRPHKHFERKGDDLLYQA 271

Query: 274 PLTFKESLLGFSKTLQTLDGRTLPLS--RSQPVQPTEENTYPGQGMPISKNPGQRGNLII 331
            +    ++ G    ++ + G  L +S    + + P       G+GMPI K  G  GNLI+
Sbjct: 272 EVDLLSAIAGGEFAIEHVSGEWLKVSIVPGEVISPGMTKVIEGKGMPIQKY-GGYGNLIV 330

Query: 332 KYKINYP 338
            +KIN+P
Sbjct: 331 TFKINFP 337

>TPHA0L00790 Chr12 (150654..151994) [1341 bp, 446 aa] {ON}
          Anc_7.157 YIR004W
          Length = 446

 Score = 84.7 bits (208), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 56/75 (74%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MV ET+ YDLLG+S++A+D EIKK YRK ++K HPDK   D   TE+F+ ISEA+++LSD
Sbjct: 1  MVLETEYYDLLGISTTATDIEIKKAYRKKSIKEHPDKNPNDPSATERFQAISEAYQVLSD 60

Query: 58 SNKRSVYDQYGLDAA 72
             RS YD+YG + A
Sbjct: 61 KQLRSNYDKYGKEKA 75

>KLLA0E07899g Chr5 complement(709306..710793) [1488 bp, 495 aa]
          {ON} similar to gnl|GLV|CAGL0J10296g Candida glabrata
          CAGL0J10296g and weakly similar to YNL077W
          uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
          Putative chaperone of the HSP40 (DNAJ) family
          overexpression interferes with propagation of the [Psi
          ] prion
          Length = 495

 Score = 84.0 bits (206), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 41/71 (57%), Positives = 53/71 (74%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTEK---FKEISEAFEILSD 57
          M K TKLYD+L V+++A++ EIKK YRK ALK+HPDK     E    F++IS A+E LS+
Sbjct: 1  MAKNTKLYDILEVNTTATEQEIKKAYRKKALKHHPDKNNHSAESIKLFQDISHAYETLSN 60

Query: 58 SNKRSVYDQYG 68
          SNKR +YDQYG
Sbjct: 61 SNKRELYDQYG 71

>TDEL0C04350 Chr3 (777185..778573) [1389 bp, 462 aa] {ON}
          Anc_2.218 YNL077W
          Length = 462

 Score = 82.8 bits (203), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 51/71 (71%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          MVK+T+LYD+L VS  AS  EI+K YR  ALK+HPDK     E   KF E++EA+EIL D
Sbjct: 1  MVKDTRLYDVLNVSPEASAVEIRKAYRLLALKHHPDKNNHSEESKSKFLEVNEAYEILID 60

Query: 58 SNKRSVYDQYG 68
            KRS+YDQYG
Sbjct: 61 EKKRSLYDQYG 71

>KAFR0A04160 Chr1 (836039..837175) [1137 bp, 378 aa] {ON}
          Anc_8.730 YMR214W
          Length = 378

 Score = 82.4 bits (202), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 39/77 (50%), Positives = 53/77 (68%), Gaps = 3/77 (3%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          ++     Y +LGV+  A+D EIK  YR+ + KYHPDK  GD E   KF E+ EA+++LSD
Sbjct: 17 LINAQDYYKILGVNKDANDKEIKSAYRQLSKKYHPDKNPGDEEAHNKFIEVGEAYDVLSD 76

Query: 58 SNKRSVYDQYGLDAARN 74
          S KR++YDQYG DA +N
Sbjct: 77 SEKRNIYDQYGADAIKN 93

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 48/89 (53%), Gaps = 5/89 (5%)

Query: 262 YKRDGDNIIYTLPLTFKESLL-GFSKTLQTLD-GRTLPLSR--SQPVQPTEENTYPGQGM 317
           Y+R GD++  T  L+ +E+L  G+ + L+  D  + + L R  +Q V   E    PG GM
Sbjct: 285 YRRRGDHLYRTEVLSVQEALKGGWERELEFFDKDKNVKLKRDANQVVITGEIECVPGFGM 344

Query: 318 PISKNPGQR-GNLIIKYKINYPISLTDSQ 345
           PI  + G++ G+L I Y I  P    +++
Sbjct: 345 PILNSQGRKFGDLFIDYVILMPQEFKNTK 373

>Smik_14.249 Chr14 (461706..463307) [1602 bp, 533 aa] {ON} YNL077W
          (REAL)
          Length = 533

 Score = 80.9 bits (198), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 51/71 (71%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          M   T LYD L V+++AS +EIKK YR AALKYHPDK     E   KF+EI +A+E+L D
Sbjct: 1  MQHNTSLYDSLNVTATASTSEIKKAYRNAALKYHPDKNNHTEESKRKFQEICQAYEVLKD 60

Query: 58 SNKRSVYDQYG 68
          ++ RS+YDQYG
Sbjct: 61 NHLRSLYDQYG 71

>YNL077W Chr14 (481391..482977) [1587 bp, 528 aa] {ON}
          APJ1Putative chaperone of the HSP40 (DNAJ) family;
          overexpression interferes with propagation of the
          [Psi+] prion; the authentic, non-tagged protein is
          detected in highly purified mitochondria in
          high-throughput studies
          Length = 528

 Score = 80.9 bits (198), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 51/71 (71%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          M + T LYD L V+++AS +EIKK YR AALKYHPDK     E   KF+EI +A+EIL D
Sbjct: 1  MQQNTSLYDSLNVTAAASTSEIKKAYRNAALKYHPDKNNHTEESKRKFQEICQAYEILKD 60

Query: 58 SNKRSVYDQYG 68
          +  R++YDQYG
Sbjct: 61 NRLRALYDQYG 71

>TBLA0J01870 Chr10 complement(438718..440130) [1413 bp, 470 aa]
          {ON} Anc_7.157 YIR004W
          Length = 470

 Score = 80.1 bits (196), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 38/75 (50%), Positives = 56/75 (74%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MV +T  YD+LG++ +A+ AEIKK YRK ++K HPDK   D   TE+F++ISEA+++LSD
Sbjct: 1  MVVDTTYYDILGITPTATQAEIKKAYRKKSIKEHPDKNPNDPTATERFQQISEAYQVLSD 60

Query: 58 SNKRSVYDQYGLDAA 72
           + R+ YDQ+G + A
Sbjct: 61 EHLRNNYDQFGKEQA 75

>NDAI0B02000 Chr2 (497023..498324) [1302 bp, 433 aa] {ON}
          Anc_8.264
          Length = 433

 Score = 79.7 bits (195), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 45/74 (60%), Positives = 53/74 (71%), Gaps = 7/74 (9%)

Query: 7  LYDLLGVSSSASDAEIKKGYRKAALKYHPDK---PTGDTE---KFKEISEAFEILSDSNK 60
          LY +LGV+SSA+D+EIKK YRK AL+YHPDK   P    E   KFKEI+ A+EILSD  K
Sbjct: 4  LYSILGVTSSATDSEIKKAYRKLALQYHPDKVLDPNDREENEIKFKEITSAYEILSDEEK 63

Query: 61 RSVYDQYGLDAARN 74
          R+ YD YG DA  N
Sbjct: 64 RAHYDLYG-DANEN 76

 Score = 37.0 bits (84), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 40/81 (49%), Gaps = 4/81 (4%)

Query: 262 YKRDGDNIIYTLPLTFKESLLGFSKTL--QTLDGRTLPLS--RSQPVQPTEENTYPGQGM 317
           + R G + +  L L+  E+L GF      ++LDGR L LS    + ++P        +G 
Sbjct: 270 FIRKGTDFVMYLSLSLAEALTGFKDKFLSKSLDGRILTLSVPSGKVIRPGNIIKIKQEGW 329

Query: 318 PISKNPGQRGNLIIKYKINYP 338
           P++    + G+L +  KI +P
Sbjct: 330 PVNPQASKFGDLYVIIKIEFP 350

>Suva_14.262 Chr14 (480056..481666) [1611 bp, 536 aa] {ON} YNL077W
          (REAL)
          Length = 536

 Score = 79.7 bits (195), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 39/71 (54%), Positives = 51/71 (71%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          M   T LYD L V+++AS +EIKK YR AAL+YHPDK     E   KF+EI +A+E+L D
Sbjct: 1  MQHNTSLYDSLNVTTTASTSEIKKAYRNAALRYHPDKNNHTEESKRKFQEICQAYEVLKD 60

Query: 58 SNKRSVYDQYG 68
          ++ RS+YDQYG
Sbjct: 61 NHLRSLYDQYG 71

>TDEL0H02290 Chr8 (383876..385039) [1164 bp, 387 aa] {ON}
          Anc_7.217 YER048C
          Length = 387

 Score = 79.0 bits (193), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 54/75 (72%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          MVK+T+ YD+LGVS +A+  EIKK YRK A++ HPDK   D E   KF+ + EA+++LSD
Sbjct: 1  MVKDTEYYDVLGVSPTATAMEIKKAYRKKAMQTHPDKNPDDPEAETKFQAVGEAYQVLSD 60

Query: 58 SNKRSVYDQYGLDAA 72
          +  RS YDQ+G D A
Sbjct: 61 TELRSRYDQFGKDDA 75

>Skud_14.253 Chr14 (471602..473200) [1599 bp, 532 aa] {ON} YNL077W
          (REAL)
          Length = 532

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 50/71 (70%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          M   T LYD L V+++AS +EIKK YR AALKYHPDK     E   KF+EI +A+E L D
Sbjct: 1  MQHNTSLYDSLNVTATASTSEIKKAYRNAALKYHPDKNNHTEESKRKFQEICQAYETLKD 60

Query: 58 SNKRSVYDQYG 68
          ++ RS+YDQYG
Sbjct: 61 NHLRSLYDQYG 71

>Kwal_26.9024 s26 (1044497..1045624) [1128 bp, 375 aa] {ON}
          YMR214W (SCJ1) - dnaJ homolog [contig 68] FULL
          Length = 375

 Score = 78.2 bits (191), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 51/77 (66%), Gaps = 3/77 (3%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          +V     Y +LGVS  ASD EIK  YR+ + K+HPDK  GD +   KF E+ EA+E+LSD
Sbjct: 20 LVAAQDYYGILGVSKDASDKEIKSAYRQLSKKFHPDKNPGDEDAHHKFIEVGEAYEVLSD 79

Query: 58 SNKRSVYDQYGLDAARN 74
            KR +YDQ+G +A +N
Sbjct: 80 DQKRQIYDQHGAEALKN 96

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 44/81 (54%), Gaps = 5/81 (6%)

Query: 262 YKRDGDNIIYTLPLTFKESLL-GFSKTLQTLD-GRTLPLSRSQ--PVQPTEENTYPGQGM 317
           Y+R G ++  T  L+ KE+LL G+ + ++  D  + L L R Q  PV+  E    PG GM
Sbjct: 284 YRRRGPHLYRTEVLSLKEALLGGWKREIEFFDPNKKLKLQRGQGVPVRNGEIERVPGFGM 343

Query: 318 PISKNPGQRGNLIIKYKINYP 338
           P   + G+ G+L + Y +  P
Sbjct: 344 PTGGH-GKHGDLFVDYVVVIP 363

>TBLA0A01100 Chr1 (250770..252074) [1305 bp, 434 aa] {ON}
          Anc_7.157 YIR004W
          Length = 434

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 54/75 (72%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MV  T+ YDLLGV  +++D EIKK YRK ++K HPDK   +   T+KF+ ISEA+++LSD
Sbjct: 1  MVVNTEYYDLLGVEPNSTDIEIKKAYRKKSIKLHPDKNPNNPDATKKFQAISEAYQVLSD 60

Query: 58 SNKRSVYDQYGLDAA 72
           N RS YD++G D A
Sbjct: 61 KNLRSNYDKFGKDKA 75

>YIR004W Chr9 (363221..364519) [1299 bp, 432 aa] {ON}
          DJP1Cytosolic J-domain-containing protein, required for
          peroxisomal protein import and involved in peroxisome
          assembly, homologous to E. coli DnaJ
          Length = 432

 Score = 78.2 bits (191), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 38/71 (53%), Positives = 53/71 (74%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MV +T+ YDLLGVS++AS  EIKK YRK +++ HPDK   D   TE+F+ ISEA+++L D
Sbjct: 1  MVVDTEYYDLLGVSTTASSIEIKKAYRKKSIQEHPDKNPNDPTATERFQAISEAYQVLGD 60

Query: 58 SNKRSVYDQYG 68
           + R+ YD+YG
Sbjct: 61 DDLRAKYDKYG 71

>TDEL0B03790 Chr2 complement(681870..682991) [1122 bp, 373 aa]
          {ON} Anc_8.730 YMR214W
          Length = 373

 Score = 77.8 bits (190), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 49/70 (70%), Gaps = 3/70 (4%)

Query: 8  YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSDSNKRSVY 64
          Y +LG++  ASD EIK  YR+ + K+HPDK  GD E   KF EI EA+E+LSD  KR ++
Sbjct: 23 YAILGLNKDASDKEIKSSYRQLSKKFHPDKNPGDEEAHHKFIEIGEAYEVLSDPEKRKIF 82

Query: 65 DQYGLDAARN 74
          DQYG DA +N
Sbjct: 83 DQYGADALKN 92

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 44/90 (48%), Gaps = 4/90 (4%)

Query: 262 YKRDGDNIIYTLPLTFKESLLG-FSKTLQTLDGRT---LPLSRSQPVQPTEENTYPGQGM 317
           Y+R G ++  T  L+ +E+L G + + ++ LD +    +  +++  V   E    PG GM
Sbjct: 281 YRRRGPHLYRTEVLSAREALKGDWQREVEFLDEKKKVKIARAKNVVVHNGEVERIPGFGM 340

Query: 318 PISKNPGQRGNLIIKYKINYPISLTDSQRR 347
           P        G+L I+Y +  P  ++ S  R
Sbjct: 341 PQPNGKHAFGDLFIEYVVVMPHEISKSGIR 370

>AGR084C Chr7 complement(885020..886303) [1284 bp, 427 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YLR090W
          (XDJ1)
          Length = 427

 Score = 78.2 bits (191), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 36/68 (52%), Positives = 52/68 (76%), Gaps = 6/68 (8%)

Query: 7  LYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDSNK 60
          LY++LG++SSAS+ E+K+ YR+ AL+YHPDK + ++E      KFKEIS A+ +LSD  K
Sbjct: 5  LYEVLGIASSASEQEVKRAYRQLALRYHPDKISDESEREASEAKFKEISAAYAVLSDEQK 64

Query: 61 RSVYDQYG 68
          R+ YDQ+G
Sbjct: 65 RAEYDQFG 72

>KNAG0G02880 Chr7 (636899..638035) [1137 bp, 378 aa] {ON}
          Anc_8.730 YMR214W
          Length = 378

 Score = 77.4 bits (189), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 37/70 (52%), Positives = 50/70 (71%), Gaps = 3/70 (4%)

Query: 8  YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSDSNKRSVY 64
          Y +LGV+  AS+ +IK  YR+ + K+HPDK  GD E   KF EI EA+E+LSDS KR+ Y
Sbjct: 21 YAILGVAKDASEKDIKSAYRQMSKKWHPDKNAGDDEAHHKFIEIGEAYEVLSDSEKRATY 80

Query: 65 DQYGLDAARN 74
          D++G DA +N
Sbjct: 81 DRFGADALKN 90

 Score = 37.0 bits (84), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 49/99 (49%), Gaps = 10/99 (10%)

Query: 250 LQFIIKEKKHP--LYKRDGDNIIYTLPLTFKESLL-GFSKTLQTLDG-RTLPLSRSQPV- 304
           L F+ +E  H    Y+R GD++  T  L +KE+LL G+ + +   D  + + + R + V 
Sbjct: 263 LVFVFEENSHENLGYRRRGDHLYRTEVLHWKEALLGGWERRIAFFDDQKQVVVKRDKNVV 322

Query: 305 -QPTEENTYPGQGMPISKNPGQR----GNLIIKYKINYP 338
             P E    P  GMP   + G+     G+L I+Y I  P
Sbjct: 323 TAPGEIERVPNLGMPKLNSKGKSTNAYGDLFIEYVIVSP 361

>Ecym_5384 Chr5 (781017..782528) [1512 bp, 503 aa] {ON} similar to
          Ashbya gossypii AER427W
          Length = 503

 Score = 77.8 bits (190), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 53/73 (72%), Gaps = 5/73 (6%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTEK----FKEISEAFEILS 56
          MVK+T+ YDLL VS + S  E+KK Y+ AAL+YHPDK  G +E     F++I+EA+ ILS
Sbjct: 1  MVKDTRFYDLLNVSPTVSPQELKKSYKLAALRYHPDK-NGHSESAKQAFQQITEAYGILS 59

Query: 57 DSNKRSVYDQYGL 69
          D  KR +YD+YG+
Sbjct: 60 DERKRKIYDRYGV 72

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 61/140 (43%), Gaps = 12/140 (8%)

Query: 214 EKVQIDINLKPGWKEGTKLTYKNHGDYNPST--GGRKTLQ----FIIKEKKHP-LYKR-- 264
           E+   ++ +KPG    +++      D   ST  G ++ +      I++E+     Y+R  
Sbjct: 249 ERKIFEVEIKPGLSNKSEIILPGEADQVISTVYGKQQVIPGDVIIIVQEQCSTGRYRRFR 308

Query: 265 DGDNIIYTLPLTFKESLLGFSKTLQTL-DGRTLPLSR--SQPVQPTEENTYPGQGMPISK 321
           + D ++    +  + SL G S  +     GR + L     + + P         GMP   
Sbjct: 309 ESDLVLTRCVVDLRTSLCGGSIYIDDHPSGRPIKLEVIPGELLNPGSIKCVENLGMPKRD 368

Query: 322 NPGQRGNLIIKYKINYPISL 341
           NP Q G+L IK+ +N+P  L
Sbjct: 369 NPSQYGDLYIKFCVNFPERL 388

>NCAS0E02930 Chr5 (572593..573756) [1164 bp, 387 aa] {ON}
          Anc_7.217
          Length = 387

 Score = 77.0 bits (188), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 53/75 (70%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          MVK+T  YD+LGV  +A+ AEIKK YR+ A++ HPDK   D E   KF+E+ EA+++LSD
Sbjct: 1  MVKDTGYYDVLGVQPTATPAEIKKAYRRRAMQTHPDKHPDDPEAQAKFQEVGEAYQVLSD 60

Query: 58 SNKRSVYDQYGLDAA 72
             RS YD++G D A
Sbjct: 61 PGLRSRYDEFGKDEA 75

>KLTH0D12496g Chr4 (1020286..1021413) [1128 bp, 375 aa] {ON}
          similar to uniprot|P25303 Saccharomyces cerevisiae
          YMR214W SCJ1 dnaJ homolog
          Length = 375

 Score = 76.3 bits (186), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 37/70 (52%), Positives = 48/70 (68%), Gaps = 3/70 (4%)

Query: 8  YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDT---EKFKEISEAFEILSDSNKRSVY 64
          Y +LGVS  AS+ EIK  YR+ + KYHPDK  GD     KF E+ EA+E+LSD  KR +Y
Sbjct: 26 YAILGVSKDASEKEIKSAYRQLSKKYHPDKNPGDETAHHKFIEVGEAYEVLSDDQKRQIY 85

Query: 65 DQYGLDAARN 74
          +QYG +A +N
Sbjct: 86 NQYGAEALKN 95

>ZYRO0C01606g Chr3 complement(113396..114694) [1299 bp, 432 aa]
          {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
          YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
          related to Ydj1p
          Length = 432

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 47/68 (69%), Gaps = 6/68 (8%)

Query: 7  LYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILSDSNK 60
          LYD LGVS  A+  EIKK YRK AL++HPDK T D+       +FKEI+ A+E+LSD  K
Sbjct: 3  LYDTLGVSQDATQVEIKKAYRKLALQHHPDKVTDDSVREESEVRFKEITAAYEVLSDEEK 62

Query: 61 RSVYDQYG 68
          RS YD YG
Sbjct: 63 RSKYDTYG 70

>Kpol_1002.122 s1002 (305710..307221) [1512 bp, 503 aa] {ON}
          (305710..307221) [1512 nt, 504 aa]
          Length = 503

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 38/71 (53%), Positives = 49/71 (69%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTEK---FKEISEAFEILSD 57
          MV  ++LYD+L +SS+A   +IKK YR  ALKYHPDK     E    F++ISEA+E+L D
Sbjct: 1  MVMSSELYDILNISSNADAKDIKKAYRVLALKYHPDKNNHSEESKVMFQKISEAYEVLID 60

Query: 58 SNKRSVYDQYG 68
            KR +YDQYG
Sbjct: 61 VEKRKLYDQYG 71

>AER427W Chr5 (1456998..1458410) [1413 bp, 470 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL077W (APJ1)
          Length = 470

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 50/71 (70%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILSD 57
          MVK+T+LYD+LGV    S AE+KK Y+ AAL+YHPDK        ++F++I++A+ +L D
Sbjct: 1  MVKDTRLYDVLGVQPGVSAAELKKSYKLAALRYHPDKNGHSEASKQRFQQIADAYRVLGD 60

Query: 58 SNKRSVYDQYG 68
             R +YD+YG
Sbjct: 61 ERLRKIYDRYG 71

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 71/149 (47%), Gaps = 12/149 (8%)

Query: 214 EKVQIDINLKPGWKEGTKLTYKNHGD--YNPSTGGRKTL---QFIIKEKKHPL--YKRDG 266
           E+   ++ ++PG + G+++ +    D   N   G  + L     I  E+  P   Y+  G
Sbjct: 227 ERKVFEVEIRPGMRAGSEVVFPGEADEVVNTPYGKEQVLPGDLAITIEEATPATRYQCRG 286

Query: 267 D-NIIYT-LPLTFKESLLGFSKTLQTL-DGRTLPLSR--SQPVQPTEENTYPGQGMPISK 321
           D N++ T L +  + SL G +  ++    G+ + L     + ++P         GMP   
Sbjct: 287 DANLLLTELHVDLRTSLCGGTVYIEDHPSGKLIQLEIIPGELLEPGAIKCIEHLGMPHPD 346

Query: 322 NPGQRGNLIIKYKINYPISLTDSQRRAIA 350
           +P Q G+L IK+ +++P +L DS   AIA
Sbjct: 347 DPSQYGHLFIKFHVDFPKTLADSTITAIA 375

>NDAI0A02820 Chr1 complement(634394..635842) [1449 bp, 482 aa]
          {ON} Anc_7.157
          Length = 482

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/71 (53%), Positives = 50/71 (70%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MV +T  YDLLG+  SA+  EIKK YRK ++K HPDK   D   TE+F+ ISEA+++LSD
Sbjct: 1  MVVDTAYYDLLGIEPSATQGEIKKAYRKKSIKEHPDKNPNDPQATERFQAISEAYQVLSD 60

Query: 58 SNKRSVYDQYG 68
           + R  YD+YG
Sbjct: 61 ESLRLKYDKYG 71

>Suva_9.213 Chr9 (350204..351499) [1296 bp, 431 aa] {ON} YIR004W
          (REAL)
          Length = 431

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/71 (53%), Positives = 52/71 (73%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MV +T+ YDLLGVS++AS  EIKK YRK +++ HPDK   D   TE+F+ ISEA+++L D
Sbjct: 1  MVVDTEYYDLLGVSTTASAIEIKKAYRKKSIQEHPDKNPNDPKATERFQAISEAYQVLGD 60

Query: 58 SNKRSVYDQYG 68
          +  R  YD+YG
Sbjct: 61 NELRVKYDKYG 71

>Skud_9.181 Chr9 (334059..335324) [1266 bp, 421 aa] {ON} YIR004W
          (REAL)
          Length = 421

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 52/71 (73%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MV +T+ YDLLGVS++AS  EIKK YRK +++ HPDK   D   TE+F+ ISEA+++L D
Sbjct: 1  MVVDTEYYDLLGVSTTASAIEIKKAYRKKSIQEHPDKNPNDLKATERFQAISEAYQVLGD 60

Query: 58 SNKRSVYDQYG 68
             R+ YD++G
Sbjct: 61 DELRAKYDKFG 71

>SAKL0H16984g Chr8 complement(1490925..1492232) [1308 bp, 435 aa]
          {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
          YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
          related to Ydj1p
          Length = 435

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 40/73 (54%), Positives = 49/73 (67%), Gaps = 6/73 (8%)

Query: 5  TKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILSDS 58
          TKLY++LGV+  AS  EIKK YRK AL++HPDK   +        KFKEI+ A+EILSD 
Sbjct: 2  TKLYEVLGVAPDASQTEIKKAYRKLALQHHPDKVADEVLREESEMKFKEITAAYEILSDE 61

Query: 59 NKRSVYDQYGLDA 71
          + R  YD YG DA
Sbjct: 62 DSRKKYDVYGDDA 74

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 47/94 (50%), Gaps = 5/94 (5%)

Query: 250 LQFIIKEKKHPL--YKRDGDNIIYTLPLTFKESLLGFSKTL-QTLDGRTLPLS--RSQPV 304
           L F+I+E        +R GD++   L ++  E++ GF K +  TLD R L L   + + +
Sbjct: 263 LLFVIEENPETSTNLERRGDDLHTRLKISLSEAITGFEKVVTTTLDDRILKLKIPQGKVI 322

Query: 305 QPTEENTYPGQGMPISKNPGQRGNLIIKYKINYP 338
           +P        +G P+  +  + G++ ++  I +P
Sbjct: 323 RPGNYIRLENEGWPLDDSGNKFGDMYVQVHIEFP 356

>Ecym_5626 Chr5 (1262223..1262954) [732 bp, 243 aa] {ON} similar
          to Ashbya gossypii AFL190C
          Length = 243

 Score = 73.6 bits (179), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 46/67 (68%), Gaps = 4/67 (5%)

Query: 7  LYDLLGVSSSASDAEIKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILSDSNKRSV 63
           Y+LL +   ASD+++KK YRK A+K HPDK   P    E FK+I+ AFE+LSD NKR V
Sbjct: 25 FYELLQIDKEASDSDVKKAYRKLAIKLHPDKNRHPRA-AEAFKKINRAFEVLSDENKRKV 83

Query: 64 YDQYGLD 70
          YDQ G D
Sbjct: 84 YDQIGCD 90

>CAGL0J10296g Chr10 complement(1006624..1008063) [1440 bp, 479 aa]
          {ON} similar to uniprot|P53940 Saccharomyces cerevisiae
          YNL077w
          Length = 479

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 48/71 (67%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          MVK+T+LYDLL V   AS   IKK +  AAL+ HPDK     E   +F+EIS+A+E+LSD
Sbjct: 1  MVKDTRLYDLLNVECDASQVTIKKAFHAAALRCHPDKNNHSEESKKQFQEISKAYEVLSD 60

Query: 58 SNKRSVYDQYG 68
             R +YD+YG
Sbjct: 61 PKSREMYDRYG 71

>NCAS0B05030 Chr2 (934492..935793) [1302 bp, 433 aa] {ON}
          Anc_8.264
          Length = 433

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 50/72 (69%), Gaps = 8/72 (11%)

Query: 5  TKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE--------KFKEISEAFEILS 56
          T LY +LGV+S+A+D++IKK YRK AL++HPDK              KFKEIS A+EILS
Sbjct: 2  TDLYAVLGVASNATDSDIKKAYRKLALQHHPDKVVNSNSDDREASEIKFKEISAAYEILS 61

Query: 57 DSNKRSVYDQYG 68
          D +KR+ YD YG
Sbjct: 62 DEDKRAHYDLYG 73

>Ecym_4372 Chr4 complement(790363..792102) [1740 bp, 579 aa] {ON}
          similar to Ashbya gossypii ADL111W
          Length = 579

 Score = 75.9 bits (185), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 52/76 (68%), Gaps = 3/76 (3%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          MVK+TK YD+LGV   A+  +IKK YRK A++ HPDK   D E   KF+E+S+A+++LSD
Sbjct: 1  MVKDTKYYDVLGVQPDATAEQIKKAYRKKAIQTHPDKNPNDPEAQAKFQEVSKAYKVLSD 60

Query: 58 SNKRSVYDQYGLDAAR 73
             RS YD+ GL   R
Sbjct: 61 GELRSRYDEVGLSDER 76

>Kpol_1070.22 s1070 (52022..53164) [1143 bp, 380 aa] {ON}
          (52022..53164) [1143 nt, 381 aa]
          Length = 380

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 38/75 (50%), Positives = 52/75 (69%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          MVK+T+ YD+LGV   A+ AEIKK YR+ A++ HPDK   D E   KF+ + EA+++LSD
Sbjct: 1  MVKDTQYYDILGVKPEATPAEIKKAYRRRAMETHPDKHPDDPEAQSKFQAVGEAYQVLSD 60

Query: 58 SNKRSVYDQYGLDAA 72
             RS YD++G D A
Sbjct: 61 PGLRSRYDEFGKDDA 75

>KNAG0M02020 Chr13 complement(375304..376686) [1383 bp, 460 aa]
          {ON} Anc_2.218 YNL077W
          Length = 460

 Score = 75.5 bits (184), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/65 (56%), Positives = 46/65 (70%), Gaps = 3/65 (4%)

Query: 7  LYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDT---EKFKEISEAFEILSDSNKRSV 63
          LYD+LGV+S AS +EIKK YRK AL+YHPDK  GD    E F++IS A+ +L D  +R  
Sbjct: 4  LYDVLGVASDASQSEIKKAYRKLALRYHPDKNNGDEKCHEAFQKISHAYGVLGDVAQRQR 63

Query: 64 YDQYG 68
          YDQ G
Sbjct: 64 YDQSG 68

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 59/151 (39%), Gaps = 32/151 (21%)

Query: 214 EKVQIDINLKPGWKEGTKLTYKNHGDY-------NPSTGGRKTLQFIIKEKKHPLYKRDG 266
           E+V   +++KPG  +G  +      D        + +      +  +I+E     +KR  
Sbjct: 203 ERVVFKVHVKPGMHDGQTIVLDGEADQCVRDRLGHLTVAESGDVVIVIRELADAKFKRSA 262

Query: 267 DN-----------IIYTLPLTFKESLL-----GFSKTLQTLDGRTLPLSRSQPVQPTEEN 310
            N           +  T  LT    LL     G    +  L G  LP +  + V+     
Sbjct: 263 LNKRENLFVDQVKVDLTTALTGGNVLLEDHPSGNLMKINILPGEFLPENCIKCVE----- 317

Query: 311 TYPGQGMPISKNPGQRGNLIIKYKINYPISL 341
              G GMPI  + GQRG+L I++  + P+ L
Sbjct: 318 ---GLGMPID-DTGQRGDLYIRFCTHSPLQL 344

>TDEL0H03210 Chr8 (532389..533624) [1236 bp, 411 aa] {ON}
          Anc_7.157 YIR004W
          Length = 411

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 56/75 (74%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MV +T+ Y+LLG+ ++A+  EIKK YRK +++ HPDK   D   TE+F+ ISEA+++LSD
Sbjct: 1  MVVDTEYYELLGIETTATAVEIKKAYRKKSIEEHPDKNPNDPGATERFQAISEAYQVLSD 60

Query: 58 SNKRSVYDQYGLDAA 72
          S+ R+ YD++G + A
Sbjct: 61 SDLRANYDKFGKEKA 75

>KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa]
          {ON} Anc_7.217 YER048C
          Length = 396

 Score = 74.7 bits (182), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 35/75 (46%), Positives = 54/75 (72%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MVKET+ YD+LG+  +A+  EIKK YR+ A++ HPDK   D   +E+F+++ EA+++LSD
Sbjct: 1  MVKETEYYDVLGIPPTATATEIKKAYRRKAMETHPDKHPDDPTASERFQQVGEAYQVLSD 60

Query: 58 SNKRSVYDQYGLDAA 72
           + R  YD++G D A
Sbjct: 61 PDLRKQYDEFGKDNA 75

>TBLA0E03660 Chr5 (916944..918290) [1347 bp, 448 aa] {ON}
          Anc_2.218 YNL077W
          Length = 448

 Score = 75.1 bits (183), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 36/71 (50%), Positives = 50/71 (70%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          MVK+ +LY+ L +  +AS ++IKK YR  AL+YHPDK     E   KF++ISEA+ IL D
Sbjct: 1  MVKDPRLYNALNIPPTASQSDIKKAYRVQALRYHPDKNNESEESKKKFQDISEAYSILRD 60

Query: 58 SNKRSVYDQYG 68
           N+R +YD+YG
Sbjct: 61 ENQRKMYDKYG 71

>Smik_9.203 Chr9 (339194..340492) [1299 bp, 432 aa] {ON} YIR004W
          (REAL)
          Length = 432

 Score = 74.7 bits (182), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 36/71 (50%), Positives = 52/71 (73%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MV +++ YDLLGVS++A+  EIKK YRK +++ HPDK   D   TE+F+ ISEA+++L D
Sbjct: 1  MVVDSEYYDLLGVSTTATAIEIKKAYRKKSIQEHPDKNPNDPKATERFQAISEAYQVLGD 60

Query: 58 SNKRSVYDQYG 68
             R+ YD+YG
Sbjct: 61 DELRAKYDKYG 71

>ZYRO0D16390g Chr4 complement(1366068..1367264) [1197 bp, 398 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 398

 Score = 74.7 bits (182), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 53/75 (70%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          MVK+T+ YD LG+S +A+  EIKK YR+ A++ HPDK   D E   KF+ + EA+++LSD
Sbjct: 1  MVKDTEYYDRLGISPTATPTEIKKAYRRKAMETHPDKHPDDPEAENKFQAVGEAYQVLSD 60

Query: 58 SNKRSVYDQYGLDAA 72
           + R+ YD+YG D A
Sbjct: 61 ESLRARYDEYGKDDA 75

>TPHA0C01260 Chr3 (287466..288608) [1143 bp, 380 aa] {ON}
          Anc_7.217 YER048C
          Length = 380

 Score = 73.9 bits (180), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 38/75 (50%), Positives = 52/75 (69%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          MVK+T+ YD+LGV+  A+  +IKK YRK A++ HPDK   D E   KF+ + EA+++LSD
Sbjct: 1  MVKDTEYYDVLGVTPEATPTDIKKAYRKKAMQTHPDKHPDDPEAQSKFQAVGEAYQVLSD 60

Query: 58 SNKRSVYDQYGLDAA 72
             RS YDQ+G D A
Sbjct: 61 PGLRSKYDQFGKDDA 75

>NCAS0B00530 Chr2 (79130..80257) [1128 bp, 375 aa] {ON} Anc_8.730
          Length = 375

 Score = 73.9 bits (180), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 48/70 (68%), Gaps = 3/70 (4%)

Query: 8  YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDT---EKFKEISEAFEILSDSNKRSVY 64
          Y +LG++  A+D EIK  YR+ + K+HPDK  G+    +KF E+ EA+E+LSD  KR  +
Sbjct: 23 YQILGIAKDATDKEIKSAYRQLSKKFHPDKNPGNEDAHQKFIEVGEAYEVLSDPQKRQTF 82

Query: 65 DQYGLDAARN 74
          DQ+G DA +N
Sbjct: 83 DQFGADAVKN 92

 Score = 34.7 bits (78), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 62/151 (41%), Gaps = 9/151 (5%)

Query: 197 GKKKSFKIGRKGMRGE---PEKVQIDINLKPGWKEGTKLTYKNHGDYNPST-GGRKTLQF 252
           GK + FK   +   G    P+K +  + L  G K           D NP    G   ++F
Sbjct: 211 GKGQLFKKQCRKCHGNKVMPQKKEFQVKLPKGAKRHYMDVKHGEADKNPDLEAGDLLIEF 270

Query: 253 IIKEKKHPLYKRDGDNIIYTLPLTFKESLL-GFSKTLQTLD-GRTLPLSRSQ--PVQPTE 308
              +K +  Y+R G N+  T  L   E+L  G+ + +  LD  + L + R     V   E
Sbjct: 271 NENDKSNMGYRRRGQNLYRTEVLNVTEALYGGWQREIPFLDPKKKLQVGRESNIVVSHGE 330

Query: 309 ENTYPGQGMPISKNPGQR-GNLIIKYKINYP 338
               PG GMP  K   +  G+L I Y +  P
Sbjct: 331 VERIPGFGMPTGKGKKETFGDLFIDYVVIMP 361

>ZYRO0A06226g Chr1 complement(499313..500446) [1134 bp, 377 aa]
          {ON} similar to uniprot|P25303 Saccharomyces cerevisiae
          YMR214W SCJ1 dnaJ homolog
          Length = 377

 Score = 73.9 bits (180), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 48/70 (68%), Gaps = 3/70 (4%)

Query: 8  YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDT---EKFKEISEAFEILSDSNKRSVY 64
          Y +LG++  ASD ++K  YR+ + KYHPDK  GD    ++F E+ EA+E+LSD  KR ++
Sbjct: 21 YSILGLNKDASDKDVKSAYRQLSKKYHPDKNPGDESAHQRFIEVGEAYEVLSDPEKRGIF 80

Query: 65 DQYGLDAARN 74
          DQYG D  +N
Sbjct: 81 DQYGADGLKN 90

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/96 (28%), Positives = 49/96 (51%), Gaps = 4/96 (4%)

Query: 250 LQFIIKEKKHPLYKRDGDNIIYTLPLTFKESLL-GFSKTLQTL-DGRTLPLSRSQP--VQ 305
           ++F   +K +  Y+R GD++  T  L+ +E+L  G+S+ ++ L D + + L R +   V 
Sbjct: 271 VEFTESDKNNMGYRRRGDHLFRTEVLSAREALAGGWSREIEFLDDAKKVKLQRPKGNIVH 330

Query: 306 PTEENTYPGQGMPISKNPGQRGNLIIKYKINYPISL 341
             E    PG GMP   +    G+L ++Y +  P   
Sbjct: 331 HGEIEQIPGFGMPKGSSGKSFGDLFVEYAVVMPAQF 366

>KLTH0G08756g Chr7 complement(715507..716895) [1389 bp, 462 aa]
          {ON} similar to uniprot|P53940 Saccharomyces cerevisiae
          YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
          family overexpression interferes with propagation of
          the [Psi ] prion
          Length = 462

 Score = 74.3 bits (181), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 38/71 (53%), Positives = 52/71 (73%), Gaps = 5/71 (7%)

Query: 2  VKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE----KFKEISEAFEILSD 57
          V  ++LYD+LGVS+SAS  +IKK YR  ALK+HPDK  G +E    KF++I +A+EIL D
Sbjct: 4  VSNSELYDILGVSASASRQDIKKAYRVNALKHHPDK-NGHSEESKLKFQQICKAYEILKD 62

Query: 58 SNKRSVYDQYG 68
            KR +YD++G
Sbjct: 63 ERKREMYDRFG 73

>SAKL0H05258g Chr8 complement(474006..475112) [1107 bp, 368 aa]
          {ON} similar to uniprot|P25303 Saccharomyces cerevisiae
          YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score = 73.6 bits (179), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 37/70 (52%), Positives = 48/70 (68%), Gaps = 3/70 (4%)

Query: 8  YDLLGVSSSASDAEIKKGYRKAALKYHPDK-PTGDT--EKFKEISEAFEILSDSNKRSVY 64
          Y +LGVS  A D +IK  YR+ + KYHPDK P  D+   KF E+ EA+E+LSD  KR +Y
Sbjct: 22 YSILGVSKGAGDKDIKSAYRQLSKKYHPDKNPDDDSAHNKFIEVGEAYEVLSDPEKRKIY 81

Query: 65 DQYGLDAARN 74
          DQYG +A +N
Sbjct: 82 DQYGAEALKN 91

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 44/87 (50%), Gaps = 6/87 (6%)

Query: 262 YKRDGDNIIYTLPLTFKESLL-GFSKTLQTLDG-RTLPLSRSQPVQPT--EENTYPGQGM 317
           Y+R GD++  T  L+ +E+L  G+ + ++ LD  R + + R+  +     E    PG GM
Sbjct: 278 YRRRGDDLFRTEALSLREALKGGWEREIEFLDAKRKVKIKRASSMVTNNGEIERIPGFGM 337

Query: 318 PISKNPGQRGNLIIKYKINYPISLTDS 344
           P   N  + G+L I Y +  P  +  S
Sbjct: 338 PKEHN--KFGDLYIDYVVIVPDDIATS 362

>KAFR0L00740 Chr12 complement(141062..142156) [1095 bp, 364 aa]
          {ON} Anc_7.217 YER048C
          Length = 364

 Score = 73.6 bits (179), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 52/75 (69%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          MVK+T+ YD+LG+  SA+  EIKK YRK A++ HPDK   D +   KF+ + EA+++LSD
Sbjct: 1  MVKDTEYYDILGIQPSATSTEIKKAYRKKAMETHPDKHPDDPDAQSKFQSVGEAYQVLSD 60

Query: 58 SNKRSVYDQYGLDAA 72
           + R  YD++G D A
Sbjct: 61 DDLRKRYDEFGKDNA 75

>KLLA0E04423g Chr5 complement(400495..401781) [1287 bp, 428 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 428

 Score = 73.9 bits (180), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 51/73 (69%), Gaps = 3/73 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          MVK+T  YD+L VS  AS  EIKK YRK A+K HPDK   D +   KF+E+++A+++L D
Sbjct: 1  MVKDTTYYDILQVSVDASPQEIKKSYRKLAIKTHPDKNPDDPQAQTKFQELAKAYQVLID 60

Query: 58 SNKRSVYDQYGLD 70
           + R  YDQ+GLD
Sbjct: 61 DDLRKKYDQFGLD 73

>CAGL0H04499g Chr8 complement(427509..428207) [699 bp, 232 aa]
          {ON} similar to uniprot|P48353 Saccharomyces cerevisiae
          YMR161w HLJ1
          Length = 232

 Score = 71.6 bits (174), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 38/67 (56%), Positives = 45/67 (67%), Gaps = 4/67 (5%)

Query: 7  LYDLLGVSSSASDAEIKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILSDSNKRSV 63
           YD+L V  S+SD +IKK YRK A+K HPDK   P    E FK I+ AFE+LSDS KR +
Sbjct: 22 FYDILNVERSSSDVDIKKAYRKLAIKLHPDKNPYPKA-HEAFKLINRAFEVLSDSQKRQI 80

Query: 64 YDQYGLD 70
          YDQ G D
Sbjct: 81 YDQIGRD 87

>ZYRO0C15048g Chr3 complement(1170614..1172089) [1476 bp, 491 aa]
          {ON} similar to gnl|GLV|CAGL0J10296g Candida glabrata
          CAGL0J10296g and some similarites with YNL077W
          uniprot|P53940 Saccharomyces cerevisiae YNL077W APJ1
          Putative chaperone of the HSP40 (DNAJ) family
          overexpression interferes with propagation of the [Psi
          ] prion
          Length = 491

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 51/71 (71%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          M ++T+LYD L VS  A+ +EIK+ Y+  ALKYHPDK     +   KF+E+ +A+EIL+D
Sbjct: 1  MARDTRLYDTLKVSPDATISEIKRAYKVMALKYHPDKNHHSEDAKNKFQEVCKAYEILAD 60

Query: 58 SNKRSVYDQYG 68
           +KR +YD+YG
Sbjct: 61 EDKRVMYDRYG 71

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 22/38 (57%)

Query: 304 VQPTEENTYPGQGMPISKNPGQRGNLIIKYKINYPISL 341
           + P    +  G GMP   + G +GNL I++++ YP+ L
Sbjct: 362 IGPNCLKSIEGMGMPKYGHDGGKGNLYIQFQLEYPVGL 399

>Kpol_499.30 s499 (76723..77949) [1227 bp, 408 aa] {ON}
          (76723..77949) [1227 nt, 409 aa]
          Length = 408

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 53/75 (70%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MV +T+ YDLL +  +A+  EIKK YRK ++K HPDK   D   TE+F+ ISEA+++LSD
Sbjct: 1  MVVDTEYYDLLDIDITATAIEIKKAYRKKSIKEHPDKNPNDPTATERFQAISEAYQVLSD 60

Query: 58 SNKRSVYDQYGLDAA 72
           N R+ YD++G + A
Sbjct: 61 KNLRANYDKFGKEKA 75

>Ecym_6236 Chr6 (440622..441746) [1125 bp, 374 aa] {ON} similar to
          Ashbya gossypii AER346W
          Length = 374

 Score = 72.8 bits (177), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 47/70 (67%), Gaps = 3/70 (4%)

Query: 8  YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSDSNKRSVY 64
          Y +LGV   ASD +IK  YR+ + KYHPDK  GD +   +F E+ EA+E LSD  KR +Y
Sbjct: 23 YAILGVGRGASDKDIKSAYRQLSKKYHPDKNPGDEDAHNRFIEVGEAYEALSDPEKRKIY 82

Query: 65 DQYGLDAARN 74
          DQ+G +A +N
Sbjct: 83 DQFGAEALKN 92

>NCAS0A13210 Chr1 (2599196..2600440) [1245 bp, 414 aa] {ON}
          Anc_7.157
          Length = 414

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 50/71 (70%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MV +T  Y+LLG+S SA+  EIKK YRK +++ HPDK   D   TE+F+ ISEA+++LSD
Sbjct: 1  MVVDTAYYELLGISPSATAIEIKKAYRKKSIQEHPDKNPNDPTATERFQAISEAYQVLSD 60

Query: 58 SNKRSVYDQYG 68
             R  YD+YG
Sbjct: 61 DTLRLKYDKYG 71

>CAGL0F03729g Chr6 complement(362972..364057) [1086 bp, 361 aa]
          {ON} similar to uniprot|P25303 Saccharomyces cerevisiae
          YMR214w SCJ1
          Length = 361

 Score = 72.8 bits (177), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/70 (52%), Positives = 46/70 (65%), Gaps = 3/70 (4%)

Query: 8  YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSDSNKRSVY 64
          Y +LG+S  ASD EIK  YR+ + KYHPDK  GD E   KF E+ EA++IL D  KR  Y
Sbjct: 22 YAILGLSKDASDKEIKSAYRQLSKKYHPDKNPGDEEAHHKFIEVGEAYDILGDPEKRKTY 81

Query: 65 DQYGLDAARN 74
          D +G DA +N
Sbjct: 82 DVHGADAFKN 91

>CAGL0L00957g Chr12 (112612..113733) [1122 bp, 373 aa] {ON}
          similar to uniprot|P39101 Saccharomyces cerevisiae
          YER048c CAJ1
          Length = 373

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 50/75 (66%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MVK+T+ YD+LGV   A+ AEIKK YR+ A++ HPDK   D     KF+ + EA+++LSD
Sbjct: 1  MVKDTEYYDILGVKPEATSAEIKKAYRRRAMETHPDKHPNDPNAQAKFQAVGEAYQVLSD 60

Query: 58 SNKRSVYDQYGLDAA 72
             R  YDQ G ++A
Sbjct: 61 DELRKRYDQLGKESA 75

>ZYRO0G03850g Chr7 complement(307633..308889) [1257 bp, 418 aa]
          {ON} similar to gnl|GLV|CAGL0J01936g Candida glabrata
          CAGL0J01936g and some similarites with uniprot|P40564
          YIR004W Saccharomyces cerevisiae DJP1 Cytosolic
          J-domain- containing protein, required for peroxisomal
          protein import
          Length = 418

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 53/75 (70%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MV +T+ YDLLGV  +A+D EIKK YRK ++  HPDK   D   TE+F+ ISEA+++LS+
Sbjct: 1  MVVDTEYYDLLGVEVTATDVEIKKAYRKKSILEHPDKNRDDPAATERFQSISEAYQVLSN 60

Query: 58 SNKRSVYDQYGLDAA 72
           + R+ YD+ G + A
Sbjct: 61 KDLRANYDKSGKEKA 75

>Ecym_4306 Chr4 complement(650450..651754) [1305 bp, 434 aa] {ON}
          similar to Ashbya gossypii AGR084C
          Length = 434

 Score = 72.4 bits (176), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 48/68 (70%), Gaps = 6/68 (8%)

Query: 7  LYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDSNK 60
          LY +LG+ S+A++ E+K+ YR  AL YHPDK + +++      KFKEIS A++ILSD  K
Sbjct: 5  LYSVLGIKSNATEQEVKRAYRNLALMYHPDKISDESQRAESEAKFKEISAAYDILSDEQK 64

Query: 61 RSVYDQYG 68
          RS YD YG
Sbjct: 65 RSEYDHYG 72

>AER346W Chr5 (1271436..1272539) [1104 bp, 367 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YMR214W (SCJ1)
          Length = 367

 Score = 72.0 bits (175), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 46/70 (65%), Gaps = 3/70 (4%)

Query: 8  YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDT---EKFKEISEAFEILSDSNKRSVY 64
          Y +LGV   A++ +IK  YR+ + KYHPDK  GDT     F E+ EA+E LSD  KR +Y
Sbjct: 23 YAILGVDREATEKDIKSAYRQLSKKYHPDKNPGDTTAHHNFIEVGEAYEALSDPEKRRIY 82

Query: 65 DQYGLDAARN 74
          DQYG +A +N
Sbjct: 83 DQYGAEALKN 92

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 44/81 (54%), Gaps = 5/81 (6%)

Query: 262 YKRDGDNIIYTLPLTFKESLLG-FSKTLQTLD-GRTLPLSR--SQPVQPTEENTYPGQGM 317
           Y+R G N+  T  L+ KE+L G + + L+ LD  + +P SR   Q VQ  E    PG GM
Sbjct: 277 YRRQGANLFRTEVLSLKEALHGDWKRELEFLDPSKKVPFSRKKGQTVQHGEVERVPGFGM 336

Query: 318 PISKNPGQRGNLIIKYKINYP 338
           P+  + G  G+L + Y +  P
Sbjct: 337 PLPDSAG-FGDLYVDYVVILP 356

>Suva_13.397 Chr13 (675784..676911) [1128 bp, 375 aa] {ON} YMR214W
          (REAL)
          Length = 375

 Score = 72.0 bits (175), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 46/70 (65%), Gaps = 3/70 (4%)

Query: 8  YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSDSNKRSVY 64
          Y +L +   AS+ EIK  YR+ + KYHPDK  G  E   KF EI EA+E+LSD  K+ +Y
Sbjct: 25 YAILDIGKDASEKEIKSAYRQLSKKYHPDKNAGSDEAHHKFIEIGEAYEVLSDPEKKKIY 84

Query: 65 DQYGLDAARN 74
          DQ+G DA +N
Sbjct: 85 DQFGADAVKN 94

>Smik_12.149 Chr12 (300591..301973) [1383 bp, 460 aa] {ON} YLR090W
          (REAL)
          Length = 460

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 47/71 (66%), Gaps = 6/71 (8%)

Query: 6  KLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDSN 59
          +LYD+LGV+S AS  EIK  YRK ALK+HPDK            KFKEI+ A+EILSD  
Sbjct: 9  QLYDVLGVTSDASVQEIKTAYRKLALKHHPDKYVDQNSKEVNEIKFKEITAAYEILSDPE 68

Query: 60 KRSVYDQYGLD 70
          K+S YD YG D
Sbjct: 69 KKSHYDLYGDD 79

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 69/153 (45%), Gaps = 14/153 (9%)

Query: 200 KSFKIGRKGMRGEPEKVQIDINLKPGWKEGTKLTYKNHGDYNPSTGGRKTLQFIIKEKKH 259
           K+F     G+  + +K  I +N+ PG      +T K   D          L+F + EK+ 
Sbjct: 225 KNFCPDCAGVGLQSKKEIITVNVAPGHHFNDVITIKGMADEELDKSACGDLKFHLVEKQE 284

Query: 260 PLYKRD----------GDNIIYTLPLTFKESLLGFSKTL-QTLDGRTLPLSR--SQPVQP 306
            L ++            +++  +  ++  E+L GF K L +T D R L LS    + ++P
Sbjct: 285 NLEQKQIFLKNFDEGSAEDLYTSATISLSEALTGFEKFLTRTFDDRLLTLSIKPGRVIRP 344

Query: 307 TEENTYPGQGMPISKNP-GQRGNLIIKYKINYP 338
            +      +G PI  +P GQRG+L +   I +P
Sbjct: 345 GDVIKITNEGWPIMDDPRGQRGDLYVFIHIEFP 377

>SAKL0E06050g Chr5 (491382..492080) [699 bp, 232 aa] {ON} some
          similarities with uniprot|P48353 Saccharomyces
          cerevisiae YMR161W
          Length = 232

 Score = 70.1 bits (170), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 36/67 (53%), Positives = 45/67 (67%), Gaps = 2/67 (2%)

Query: 6  KLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTG--DTEKFKEISEAFEILSDSNKRSV 63
          + Y+LL V   ASD EIKK YRK A++ HPDK T    +E FK I+ AFE+LSD  KR +
Sbjct: 24 EFYELLQVEKGASDNEIKKAYRKLAIRLHPDKNTHPRASEAFKRINRAFEVLSDVGKRRM 83

Query: 64 YDQYGLD 70
          +DQ G D
Sbjct: 84 FDQLGRD 90

>Kpol_1064.40 s1064 (74841..76004) [1164 bp, 387 aa] {ON}
          (74841..76004) [1164 nt, 388 aa]
          Length = 387

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 48/70 (68%), Gaps = 3/70 (4%)

Query: 8  YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSDSNKRSVY 64
          Y +LG+S + ++ EIK  YR+ + K+HPDK   D +   KF EI EA+E+LSD  KR +Y
Sbjct: 25 YKILGLSKNCNEKEIKSAYRQLSKKFHPDKNPNDEDAHNKFIEIGEAYEVLSDPEKRRMY 84

Query: 65 DQYGLDAARN 74
          DQ+G DA +N
Sbjct: 85 DQFGADAVKN 94

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 44/81 (54%), Gaps = 4/81 (4%)

Query: 262 YKRDGDNIIYTLPLTFKESLLG-FSKTLQTLD-GRTLPLSRS--QPVQPTEENTYPGQGM 317
           Y+R G ++  T  LT +E++ G +S+ +Q LD  + L L RS    V   E    PG GM
Sbjct: 295 YRRRGKDLFRTEVLTLQEAINGDWSRDIQFLDPTKKLQLKRSPMDIVMNGEVEKIPGFGM 354

Query: 318 PISKNPGQRGNLIIKYKINYP 338
           PI  + G+ G+L I Y +  P
Sbjct: 355 PILGSKGKFGDLYIDYVVIKP 375

>TBLA0E02490 Chr5 complement(624528..625628) [1101 bp, 366 aa]
          {ON} Anc_7.217 YER048C
          Length = 366

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 50/75 (66%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          MVK+ + YD+LGVS  AS  EIKK YRK A++ HPDK   D +   KF+ + EA+++LSD
Sbjct: 1  MVKDLEYYDVLGVSPKASAIEIKKAYRKRAMETHPDKHPDDPDAQAKFQRVGEAYQVLSD 60

Query: 58 SNKRSVYDQYGLDAA 72
             R  YD++G D A
Sbjct: 61 EELRKRYDEFGKDYA 75

>AFL190C Chr6 complement(84145..84852) [708 bp, 235 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YMR161W
          (HLJ1)
          Length = 235

 Score = 70.1 bits (170), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 44/67 (65%), Gaps = 4/67 (5%)

Query: 7  LYDLLGVSSSASDAEIKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILSDSNKRSV 63
           Y+LL V   ASD +IKK YRK A+K HPDK   P    E FK+++ AFE+LSD  KR V
Sbjct: 25 FYELLQVDEKASDGDIKKAYRKMAIKLHPDKNRHPRA-AEAFKKVNRAFEVLSDEKKRRV 83

Query: 64 YDQYGLD 70
          YDQ G D
Sbjct: 84 YDQLGYD 90

>KLTH0A03740g Chr1 complement(322936..324123) [1188 bp, 395 aa]
          {ON} similar to uniprot|P39101 YER048C Saccharomyces
          cerevisiae CAJ1 Nuclear type II J heat shock protein of
          the E. coli dnaJ family
          Length = 395

 Score = 71.6 bits (174), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 48/71 (67%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          MVK+T+ YDLLG+   AS  EIKK YRK A+  HPDK   D E   KF+ I +A+++LSD
Sbjct: 1  MVKDTEYYDLLGIQPDASATEIKKAYRKKAMLTHPDKHPDDPEAQAKFQAIGQAYQVLSD 60

Query: 58 SNKRSVYDQYG 68
             RS YD++G
Sbjct: 61 PELRSRYDEFG 71

>SAKL0E09306g Chr5 complement(773968..775353) [1386 bp, 461 aa]
          {ON} similar to uniprot|P53940 Saccharomyces cerevisiae
          YNL077W APJ1 Putative chaperone of the HSP40 (DNAJ)
          family overexpression interferes with propagation of
          the [Psi ] prion
          Length = 461

 Score = 71.6 bits (174), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 37/70 (52%), Positives = 48/70 (68%), Gaps = 3/70 (4%)

Query: 2  VKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSDS 58
          VK T+LYD L +S  A+  EIKK YR AALK HPDK     +   KF+EI +A+EIL D+
Sbjct: 4  VKNTELYDTLNISVDATPQEIKKAYRLAALKSHPDKNNHSEDSKRKFQEICKAYEILGDA 63

Query: 59 NKRSVYDQYG 68
           K+ +YD+YG
Sbjct: 64 KKKLLYDRYG 73

>YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}
          CAJ1Nuclear type II J heat shock protein of the E. coli
          dnaJ family, contains a leucine zipper-like motif,
          binds to non-native substrates for presentation to
          Ssa3p, may function during protein translocation,
          assembly and disassembly
          Length = 391

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 51/75 (68%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          MVKET+ YD+LG+   A+  EIKK YR+ A++ HPDK   D +   KF+ + EA+++LSD
Sbjct: 1  MVKETEYYDILGIKPEATPTEIKKAYRRKAMETHPDKHPDDPDAQAKFQAVGEAYQVLSD 60

Query: 58 SNKRSVYDQYGLDAA 72
             RS YDQ+G + A
Sbjct: 61 PGLRSKYDQFGKEDA 75

>NDAI0E04560 Chr5 (1020784..1021968) [1185 bp, 394 aa] {ON} 
          Length = 394

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 51/75 (68%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          MVK+T+ YD+LGV   A+  EIKK YR+ A++ HPDK   D +   KF+ + EA+++LSD
Sbjct: 1  MVKDTEYYDILGVEPDATPTEIKKAYRRKAMQTHPDKHPDDPDAQAKFQAVGEAYQVLSD 60

Query: 58 SNKRSVYDQYGLDAA 72
             RS YD++G D A
Sbjct: 61 PGLRSRYDEFGKDDA 75

>Kwal_47.18133 s47 complement(703122..704303) [1182 bp, 393 aa]
          {ON} YER048C (CAJ1) - homologous to E. coli DnaJ
          [contig 197] FULL
          Length = 393

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 49/71 (69%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          MVK+T+ YDLLG+   AS  +IKK YRK A+  HPDK   D E   KF+ I EA+++LSD
Sbjct: 1  MVKDTEYYDLLGLQPDASATDIKKAYRKKAMLTHPDKHPDDPEAQAKFQAIGEAYQVLSD 60

Query: 58 SNKRSVYDQYG 68
           + RS YD++G
Sbjct: 61 PDLRSRYDEFG 71

>Smik_13.422 Chr13 (679417..680553) [1137 bp, 378 aa] {ON} YMR214W
          (REAL)
          Length = 378

 Score = 70.9 bits (172), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 47/70 (67%), Gaps = 3/70 (4%)

Query: 8  YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSDSNKRSVY 64
          Y +L V   AS+ EIK  YR+ + KYHPDK +G  E   KF E+ EA+++LSD  K+ +Y
Sbjct: 25 YAILEVDKDASEKEIKSAYRQLSKKYHPDKNSGSEEAHHKFIEVGEAYDVLSDPEKKKIY 84

Query: 65 DQYGLDAARN 74
          DQ+G DA +N
Sbjct: 85 DQFGADAVKN 94

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 49/102 (48%), Gaps = 8/102 (7%)

Query: 245 GGRKTLQFIIKEKKHPLYKRDGDNIIYTLPLTFKESLL-GFSKTLQTLDGRTLPLSRSQP 303
            G   ++F  K+ ++  Y+R GDN+  T  L+ +E+L  G+ +T++  D    P+  S+P
Sbjct: 269 AGDLVIEFKEKDTENMGYRRRGDNLYRTEVLSAEEALYGGWQRTIEFFD-ENKPVKLSRP 327

Query: 304 VQPTEEN----TYPGQGMPISKNPGQRGNLIIKYKINYPISL 341
                 N       G GMP  K+    G+L I Y +  P  L
Sbjct: 328 AHVVVSNGEIEVLKGFGMP--KSGKGHGDLYIDYVVIMPNKL 367

>CAGL0J02750g Chr10 complement(273009..274157) [1149 bp, 382 aa]
          {ON} highly similar to uniprot|P39101 Saccharomyces
          cerevisiae YER048c CAJ1
          Length = 382

 Score = 70.9 bits (172), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 51/75 (68%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          MVK+T+ YD+LG+S  A+ +EIKK YRK A+  HPDK   D E   KF+ + EA+++L+D
Sbjct: 1  MVKDTEFYDVLGISPEATPSEIKKAYRKMAMLTHPDKHPDDPEAQAKFQAVGEAYQVLND 60

Query: 58 SNKRSVYDQYGLDAA 72
             R  YD++G D A
Sbjct: 61 PALRKQYDEFGKDNA 75

>Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 70.9 bits (172), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 35/75 (46%), Positives = 51/75 (68%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          MVKET+ YD+LG+   A+  EIKK YR+ A++ HPDK   D +   KF+ + EA+++LSD
Sbjct: 1  MVKETEYYDILGIKPEATATEIKKAYRRKAMETHPDKHPDDPDAQAKFQAVGEAYQVLSD 60

Query: 58 SNKRSVYDQYGLDAA 72
             RS YD++G + A
Sbjct: 61 QGLRSKYDEFGKEDA 75

>ADR015W Chr4 (732199..733509) [1311 bp, 436 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YIR004W (DJP1)
          Length = 436

 Score = 70.9 bits (172), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 50/75 (66%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MV +T  YDLLGVS  A   EIKK YRK +++ HPDK   D   TE+F+ ISEA+++LS 
Sbjct: 1  MVVDTAYYDLLGVSPDAKAIEIKKAYRKKSVQEHPDKNPNDPKATERFQAISEAYQVLSS 60

Query: 58 SNKRSVYDQYGLDAA 72
             R+ YD++G + A
Sbjct: 61 DELRAKYDKFGKEEA 75

>TBLA0D04240 Chr4 (1048036..1049205) [1170 bp, 389 aa] {ON}
          Anc_7.217 YER048C
          Length = 389

 Score = 70.9 bits (172), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 35/75 (46%), Positives = 51/75 (68%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          MVK+ + YD+LG+   A+ AEIKK YR+ A++ HPDK   D +   KF+ + EA+++LSD
Sbjct: 1  MVKDMEYYDVLGIQPDATPAEIKKAYRRKAMQTHPDKHPDDPDAQSKFQAVGEAYQVLSD 60

Query: 58 SNKRSVYDQYGLDAA 72
             +S YDQ+G D A
Sbjct: 61 PQLKSRYDQFGKDDA 75

>Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 70.9 bits (172), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 35/75 (46%), Positives = 51/75 (68%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          MVKET+ YD+LG+   A+  EIKK YR+ A++ HPDK   D +   KF+ + EA+++LSD
Sbjct: 1  MVKETEYYDILGIKPEATSTEIKKAYRRKAMETHPDKHPDDPDAQAKFQAVGEAYQVLSD 60

Query: 58 SNKRSVYDQYGLDAA 72
             RS YD++G + A
Sbjct: 61 PGLRSKYDEFGKEDA 75

>Kwal_23.3061 s23 complement(140207..141583) [1377 bp, 458 aa]
          {ON} YNL077W - Hypothetical ORF [contig 248] FULL
          Length = 458

 Score = 70.9 bits (172), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 36/66 (54%), Positives = 48/66 (72%), Gaps = 5/66 (7%)

Query: 7  LYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE----KFKEISEAFEILSDSNKRS 62
          LYD LGV+++AS  EIKK YR  ALK+HPDK  G +E    KF++I +A+EIL D  KR 
Sbjct: 9  LYDTLGVAANASRQEIKKAYRLKALKHHPDK-NGHSEQSKLKFQQICKAYEILGDDKKRE 67

Query: 63 VYDQYG 68
          +YD++G
Sbjct: 68 MYDRFG 73

>KLLA0E01629g Chr5 (155088..155783) [696 bp, 231 aa] {ON} similar
          to uniprot|P48353 Saccharomyces cerevisiae YMR161W
          Length = 231

 Score = 68.9 bits (167), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 49/68 (72%), Gaps = 4/68 (5%)

Query: 6  KLYDLLGVSSSASDAEIKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILSDSNKRS 62
          + Y++L V  SAS+++IKK YRK A+K HPDK   P   +E FK+I+ AFE+LSD +KR 
Sbjct: 22 EFYEMLKVGKSASESDIKKAYRKLAIKLHPDKNRHPRA-SEAFKKINRAFEVLSDDSKRR 80

Query: 63 VYDQYGLD 70
          ++DQ G D
Sbjct: 81 IFDQLGHD 88

>Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON}
          YER048C (REAL)
          Length = 391

 Score = 70.5 bits (171), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 35/75 (46%), Positives = 51/75 (68%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          MVKET+ YD+LG+   A+  EIKK YR+ A++ HPDK   D +   KF+ + EA+++LSD
Sbjct: 1  MVKETEYYDILGIKPDATSTEIKKAYRRKAMETHPDKHPDDPDAQAKFQAVGEAYQVLSD 60

Query: 58 SNKRSVYDQYGLDAA 72
             RS YD++G + A
Sbjct: 61 PGLRSKYDEFGKEDA 75

>KLLA0F19184g Chr6 (1778227..1779765) [1539 bp, 512 aa] {ON} similar
           to uniprot|P39102 Saccharomyces cerevisiae YLR090W XDJ1
           Putative homolog of E. coli DnaJ closely related to
           Ydj1p
          Length = 512

 Score = 70.9 bits (172), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 46/70 (65%), Gaps = 6/70 (8%)

Query: 8   YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTEK------FKEISEAFEILSDSNKR 61
           YD+LGV   A++ EI+K YRK ALKYHPDK   + E+      FKE++ A+EILSD   +
Sbjct: 74  YDVLGVEKDATEVEIRKAYRKLALKYHPDKIIDEAERETSEAMFKEVTAAYEILSDPELK 133

Query: 62  SVYDQYGLDA 71
           S YD YG  A
Sbjct: 134 SRYDMYGDSA 143

>Suva_14.116 Chr14 complement(214797..216599) [1803 bp, 600 aa]
          {ON} YNL227C (REAL)
          Length = 600

 Score = 70.9 bits (172), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 46/67 (68%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILSDSNK 60
          T  Y+LLGV S ASD E+KK YRK AL+YHPDK   +    TEKF  I  A+E+LSDS +
Sbjct: 3  TCYYELLGVESHASDLELKKAYRKKALQYHPDKNPDNVEEATEKFAIIRAAYEVLSDSQE 62

Query: 61 RSVYDQY 67
          R+ YD +
Sbjct: 63 RAWYDSH 69

>TDEL0F03910 Chr6 (728488..729777) [1290 bp, 429 aa] {ON}
          Anc_8.264 YLR090W
          Length = 429

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 48/70 (68%), Gaps = 6/70 (8%)

Query: 5  TKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDT------EKFKEISEAFEILSDS 58
          + LY++LGV   A+  EIKK YRKAAL++HPDK   ++       +FKEI+ A+E+L D 
Sbjct: 2  STLYEILGVEIDATQLEIKKAYRKAALQHHPDKVADESLREESEVRFKEIAAAYEVLGDE 61

Query: 59 NKRSVYDQYG 68
           KR+ YD+YG
Sbjct: 62 EKRARYDKYG 71

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 59/132 (44%), Gaps = 9/132 (6%)

Query: 214 EKVQIDINLKPGWKEGTKLTYKNHGDYNPSTGGRKTLQFIIKEKKHPL----YKRDGDNI 269
           E   + ++L  G ++  ++  K   D          L F IKE          +R G ++
Sbjct: 227 ESKSLTVSLPRGSRQDDQIVLKGEADQEVGKSQTGNLVFTIKEGTECPEGVDLQRHGFDL 286

Query: 270 IYTLPLTFKESLLGFSKTL-QTLDGRTLPLS--RSQPVQPTEENTYPGQGMPISKNPGQR 326
           I  L L+  E++ GFSKTL +TLDGR L L     + ++P      P +G PI       
Sbjct: 287 ITHLTLSLAEAITGFSKTLTKTLDGRILQLQIPPGKVIRPGNIIQIPHEGWPIDTT--TS 344

Query: 327 GNLIIKYKINYP 338
           G+L +   I +P
Sbjct: 345 GDLYVVVHIEFP 356

>KNAG0I00740 Chr9 (130033..131310) [1278 bp, 425 aa] {ON}
          Anc_7.157 YIR004W
          Length = 425

 Score = 70.5 bits (171), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 51/71 (71%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MV +T  Y++LGV+ +A+  EIKK YRK +++ HPDK   D   TE+F+ ISEA+++LSD
Sbjct: 1  MVVDTGYYEILGVTPTATAVEIKKAYRKKSVQEHPDKNRDDPMATERFQAISEAYQVLSD 60

Query: 58 SNKRSVYDQYG 68
           + R  YD++G
Sbjct: 61 EDLRGKYDRFG 71

>SAKL0F04444g Chr6 complement(357126..358415) [1290 bp, 429 aa]
          {ON} similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 429

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 52/75 (69%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MV +T  YDLLGVS +A   EIKK YRK +++ HPDK   D   TE+F+ IS+A+++LS+
Sbjct: 1  MVVDTTYYDLLGVSPNARPIEIKKAYRKKSVQEHPDKNPNDPSATERFQSISQAYQVLSN 60

Query: 58 SNKRSVYDQYGLDAA 72
             R+ YD++G + A
Sbjct: 61 EELRTKYDKFGKEEA 75

>KLTH0F09944g Chr6 complement(863160..863861) [702 bp, 233 aa]
          {ON} some similarities with uniprot|P48353
          Saccharomyces cerevisiae YMR161W
          Length = 233

 Score = 68.2 bits (165), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 44/67 (65%), Gaps = 4/67 (5%)

Query: 7  LYDLLGVSSSASDAEIKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILSDSNKRSV 63
           Y++L +   ASD EIKK YRK A+K HPDK   P   +E FK I+ AFE+LSD  KR +
Sbjct: 23 FYEVLQIEREASDNEIKKAYRKLAIKLHPDKNKHPRA-SEAFKRINRAFEVLSDEQKRRI 81

Query: 64 YDQYGLD 70
          +DQ G D
Sbjct: 82 FDQVGHD 88

>TPHA0C02980 Chr3 (652607..654271) [1665 bp, 554 aa] {ON}
          Anc_2.218 YNL077W
          Length = 554

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 48/71 (67%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTEK---FKEISEAFEILSD 57
          MV  T+LYD+L V   + ++ IKK YR  ALKYHPDK     E    F++ISEA+ +LS+
Sbjct: 1  MVASTQLYDILQVRYDSDESVIKKAYRTLALKYHPDKNNLSEESKQMFQKISEAYVVLSN 60

Query: 58 SNKRSVYDQYG 68
           +KR +YD+YG
Sbjct: 61 KDKRQMYDKYG 71

>ABL194C Chr2 complement(42210..43868) [1659 bp, 552 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YNL227C
          Length = 552

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 46/67 (68%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILSDSNK 60
          T  Y+LLGV S ASD ++KK YR+ AL+YHPDK  G+    TE F  I  A+E+LSD+ +
Sbjct: 3  TCYYELLGVDSGASDTDLKKAYRRKALQYHPDKNIGNVQQATEIFASIRAAYEVLSDAQE 62

Query: 61 RSVYDQY 67
          R+ YD +
Sbjct: 63 RAWYDAH 69

>KLLA0D13464g Chr4 complement(1159251..1160552) [1302 bp, 433 aa]
          {ON} similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 433

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/76 (48%), Positives = 51/76 (67%), Gaps = 5/76 (6%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDK----PTGDTEKFKEISEAFEILS 56
          MV +T  YDLLGV++ A   +IKK YRK ++K HPDK    PT  TE+F+ ISEA+++LS
Sbjct: 1  MVVDTTYYDLLGVATDAKQIDIKKAYRKKSVKEHPDKNPDDPTA-TERFQAISEAYQVLS 59

Query: 57 DSNKRSVYDQYGLDAA 72
              R  YD++G + A
Sbjct: 60 SEELRMKYDKFGKEEA 75

>YMR214W Chr13 (695350..696483) [1134 bp, 377 aa] {ON}  SCJ1One of
          several homologs of bacterial chaperone DnaJ, located
          in the ER lumen where it cooperates with Kar2p to
          mediate maturation of proteins
          Length = 377

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 46/70 (65%), Gaps = 3/70 (4%)

Query: 8  YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSDSNKRSVY 64
          Y +L +   A++ EIK  YR+ + KYHPDK  G  E   KF E+ EA+++LSD  K+ +Y
Sbjct: 25 YAILEIDKDATEKEIKSAYRQLSKKYHPDKNAGSEEAHQKFIEVGEAYDVLSDPEKKKIY 84

Query: 65 DQYGLDAARN 74
          DQ+G DA +N
Sbjct: 85 DQFGADAVKN 94

 Score = 36.6 bits (83), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 50/106 (47%), Gaps = 8/106 (7%)

Query: 245 GGRKTLQFIIKEKKHPLYKRDGDNIIYTLPLTFKESLL-GFSKTLQTLDGRTLPLSRSQP 303
            G   ++F  K+ ++  Y+R GDN+  T  L+  E+L  G+ +T++ LD    P+  S+P
Sbjct: 268 AGDLVIEFKEKDTENMGYRRRGDNLYRTEVLSAAEALYGGWQRTIEFLD-ENKPVKLSRP 326

Query: 304 ----VQPTEENTYPGQGMPISKNPGQRGNLIIKYKINYPISLTDSQ 345
               V   E     G GMP  K     G+L I Y +  P +    Q
Sbjct: 327 AHVVVSNGEVEVVKGFGMP--KGSKGYGDLYIDYVVVMPKTFKSGQ 370

>SAKL0F08052g Chr6 complement(616679..617860) [1182 bp, 393 aa]
          {ON} highly similar to uniprot|P39101 YER048C
          Saccharomyces cerevisiae CAJ1 Nuclear type II J heat
          shock protein of the E. coli dnaJ family
          Length = 393

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 50/75 (66%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          MVK+T+ YD LG+S  A+  EIKK YRK A+  HPDK   D +   KF+ + +A+++LSD
Sbjct: 1  MVKDTEYYDALGISPDATPTEIKKAYRKKAMLTHPDKHPNDPDAQAKFQAVGQAYQVLSD 60

Query: 58 SNKRSVYDQYGLDAA 72
             RS YD++G D A
Sbjct: 61 PGLRSRYDEFGKDDA 75

>TPHA0C04590 Chr3 (991298..991999) [702 bp, 233 aa] {ON} Anc_2.350
          YMR161W
          Length = 233

 Score = 67.4 bits (163), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 43/67 (64%), Gaps = 4/67 (5%)

Query: 7  LYDLLGVSSSASDAEIKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILSDSNKRSV 63
           YD+L V  SA   EIKK YRK A+K HPDK   P    E FK I+ AFE+LSD  KRSV
Sbjct: 25 FYDILNVQKSADSVEIKKSYRKLAIKLHPDKNPHPKA-GEAFKVINRAFEVLSDDEKRSV 83

Query: 64 YDQYGLD 70
          +D+ G D
Sbjct: 84 FDRIGRD 90

>TPHA0G00630 Chr7 complement(118713..119894) [1182 bp, 393 aa] {ON}
           Anc_8.730 YMR214W
          Length = 393

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 44/70 (62%), Gaps = 3/70 (4%)

Query: 8   YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSDSNKRSVY 64
           Y +LG+   AS+  IK  YR+ + KYHPDK   D E    F EI EA+E+LSD  KR  Y
Sbjct: 31  YKILGIPKEASEKAIKSAYRQLSKKYHPDKNQNDEEAHNHFIEIGEAYEVLSDPEKRRTY 90

Query: 65  DQYGLDAARN 74
           DQ+G DA +N
Sbjct: 91  DQFGSDAFQN 100

 Score = 33.5 bits (75), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 43/81 (53%), Gaps = 5/81 (6%)

Query: 262 YKRDGDNIIYTLPLTFKESLL-GFSKTLQTLD-GRTLPLSRSQ--PVQPTEENTYPGQGM 317
           Y+R G+++  T  L FK+++  G+++T+   D  R + +SR    PV   E     G GM
Sbjct: 300 YRRRGNDLFRTEALVFKDAMEGGWNRTIPFFDPKRDVKISRKPGIPVLNKEIEKLVGFGM 359

Query: 318 PISKNPGQRGNLIIKYKINYP 338
           PI +   + G+L I Y I  P
Sbjct: 360 PI-QGSDRFGDLYIDYVIIVP 379

>Ecym_4469 Chr4 complement(953409..954710) [1302 bp, 433 aa] {ON}
          similar to Ashbya gossypii ADR015W
          Length = 433

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 49/75 (65%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MV +T  YDLLGVS  A   +IKK YRK +++ HPDK   D   TE+F+ ISEA+++L  
Sbjct: 1  MVFDTTYYDLLGVSPDAKQIDIKKAYRKKSVQEHPDKNPNDPKATERFQAISEAYQVLGS 60

Query: 58 SNKRSVYDQYGLDAA 72
             R+ YD++G D A
Sbjct: 61 DELRAKYDKFGKDEA 75

>Skud_13.323 Chr13 (550675..551349) [675 bp, 224 aa] {ON} YMR161W
          (REAL)
          Length = 224

 Score = 67.0 bits (162), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 46/67 (68%), Gaps = 2/67 (2%)

Query: 6  KLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTG--DTEKFKEISEAFEILSDSNKRSV 63
          + Y++L V   A+D EIKK YRK A+K HPDK +    +E FK I+ AFE+LS+  KRS+
Sbjct: 21 EFYEILRVDKKATDGEIKKAYRKLAIKLHPDKNSHPRASEAFKVINRAFEVLSNEEKRSI 80

Query: 64 YDQYGLD 70
          YD+ G D
Sbjct: 81 YDRIGRD 87

>Suva_10.174 Chr10 (325531..326901) [1371 bp, 456 aa] {ON} YLR090W
          (REAL)
          Length = 456

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 45/68 (66%), Gaps = 6/68 (8%)

Query: 6  KLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTG------DTEKFKEISEAFEILSDSN 59
          +LYD+LGV+  AS  EIK  YRK ALK+HPDK         +  KFKEI+ A+EILSD  
Sbjct: 9  RLYDVLGVTREASVQEIKTAYRKLALKHHPDKSVDQDSKELNETKFKEITAAYEILSDPE 68

Query: 60 KRSVYDQY 67
          K+S YD Y
Sbjct: 69 KKSHYDLY 76

>KAFR0B04780 Chr2 (994492..995763) [1272 bp, 423 aa] {ON} 
          Length = 423

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 50/71 (70%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MV +T  YDLLG++ +A+  EIKK YRK +++ HPDK   D   TE+F+ ISEA+++LS+
Sbjct: 1  MVVDTAYYDLLGITPNATSIEIKKAYRKKSVQEHPDKNPNDPGATERFQAISEAYQVLSN 60

Query: 58 SNKRSVYDQYG 68
             R+ YD+ G
Sbjct: 61 DELRAKYDRLG 71

>YLR090W Chr12 (320701..322080) [1380 bp, 459 aa] {ON}
          XDJ1Putative chaperone, homolog of E. coli DnaJ,
          closely related to Ydj1p; the authentic, non-tagged
          protein is detected in highly purified mitochondria in
          high-throughput studies
          Length = 459

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 38/71 (53%), Positives = 46/71 (64%), Gaps = 6/71 (8%)

Query: 6  KLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDSN 59
          +LYD+LGV+  A+  EIK  YRK ALK+HPDK            KFKEI+ A+EILSD  
Sbjct: 9  RLYDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPE 68

Query: 60 KRSVYDQYGLD 70
          K+S YD YG D
Sbjct: 69 KKSHYDLYGDD 79

>CAGL0J01936g Chr10 complement(192784..194061) [1278 bp, 425 aa]
          {ON} highly similar to uniprot|P40564 Saccharomyces
          cerevisiae YIR004w DJP1
          Length = 425

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 49/71 (69%), Gaps = 3/71 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MV ++  YDLLG+  +A+  EIKK YRK +++ HPDK   D   TE+F+ ISEA+++LS 
Sbjct: 1  MVVDSTYYDLLGIGPTATAVEIKKAYRKKSIQEHPDKNPNDPTATERFQAISEAYQVLSS 60

Query: 58 SNKRSVYDQYG 68
             R+ YD++G
Sbjct: 61 EELRAKYDKFG 71

>KLLA0C07260g Chr3 complement(632987..634093) [1107 bp, 368 aa]
          {ON} similar to uniprot|P25303 Saccharomyces cerevisiae
          YMR214W SCJ1 dnaJ homolog
          Length = 368

 Score = 68.6 bits (166), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 46/69 (66%), Gaps = 3/69 (4%)

Query: 8  YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSDSNKRSVY 64
          Y +LGV   AS+ EIK  YR+ + KYHPDK  G+ E    F E+ EA+++LSD  KR +Y
Sbjct: 22 YAILGVDKQASEKEIKSAYRQLSKKYHPDKNPGNDEAHHHFIEVGEAYDVLSDPEKRQIY 81

Query: 65 DQYGLDAAR 73
          D++G DA +
Sbjct: 82 DRHGADALK 90

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 47/95 (49%), Gaps = 4/95 (4%)

Query: 256 EKKHPLYKRDGDNIIYTLPLTFKESLL-GFSKTLQTLDG-RTLPLSR--SQPVQPTEENT 311
           EK    Y+R G+ +  T  L+FKE+L  G+ + ++  D  ++L LSR     VQ  E   
Sbjct: 268 EKDSMGYRRRGNTLYRTEILSFKEALQGGWERNIEFFDKEKSLVLSRPVGHTVQNGETEV 327

Query: 312 YPGQGMPISKNPGQRGNLIIKYKINYPISLTDSQR 346
               GMPI     + G+LII Y I  P   + S +
Sbjct: 328 IKSFGMPIPSATDKFGDLIIDYVILLPGEWSTSSK 362

>Kwal_23.3578 s23 complement(349005..349259) [255 bp, 85 aa] {OFF}
          YMR161W (HLJ1) - similar to E. coli DnaJ [contig 253]
          PARTIAL
          Length = 85

 Score = 63.2 bits (152), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 41/64 (64%), Gaps = 4/64 (6%)

Query: 7  LYDLLGVSSSASDAEIKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILSDSNKRSV 63
           Y++L V   ASD EIKK YRK A+K HPDK   P   +E FK I+ AFE+LSD  KR +
Sbjct: 23 FYEVLRVEKQASDLEIKKAYRKLAIKLHPDKNKHPRA-SEAFKRINRAFEVLSDEQKRRI 81

Query: 64 YDQY 67
            ++
Sbjct: 82 LTRW 85

>ZYRO0A07502g Chr1 complement(614282..614998) [717 bp, 238 aa]
          {ON} similar to uniprot|P48353 Saccharomyces cerevisiae
          YMR161W
          Length = 238

 Score = 67.0 bits (162), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 47/68 (69%), Gaps = 4/68 (5%)

Query: 6  KLYDLLGVSSSASDAEIKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILSDSNKRS 62
          + Y++L V  +A+D EIKK YRK A++ HPDK   P   +E FK I+ AFE+L DS KRS
Sbjct: 22 QFYEILKVERTANDNEIKKSYRKLAIRLHPDKNPHPRA-SEAFKLINRAFEVLGDSEKRS 80

Query: 63 VYDQYGLD 70
          +YD+ G D
Sbjct: 81 LYDRLGRD 88

>TDEL0G02800 Chr7 complement(538403..539080) [678 bp, 225 aa] {ON}
          Anc_2.350 YMR161W
          Length = 225

 Score = 66.6 bits (161), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 36/67 (53%), Positives = 45/67 (67%), Gaps = 4/67 (5%)

Query: 7  LYDLLGVSSSASDAEIKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILSDSNKRSV 63
           Y++L +  SASD EIKK YRK A+K HPDK   P   +E FK I+ AFE+LSD  KR +
Sbjct: 25 FYEVLQIERSASDNEIKKSYRKLAIKLHPDKNPHPRA-SEAFKVINRAFEVLSDEEKRRL 83

Query: 64 YDQYGLD 70
          YD+ G D
Sbjct: 84 YDRLGRD 90

>Skud_14.110 Chr14 complement(209411..211201) [1791 bp, 596 aa]
          {ON} YNL227C (REAL)
          Length = 596

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 35/64 (54%), Positives = 45/64 (70%), Gaps = 4/64 (6%)

Query: 8  YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILSDSNKRSV 63
          Y+LLGV S ASD E+KK YRK AL+YHPDK   +    T+KF  I  A+E+LSDS +R+ 
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPDNVEEATQKFAIIRAAYEVLSDSQERAW 65

Query: 64 YDQY 67
          YD +
Sbjct: 66 YDSH 69

>YMR161W Chr13 (577718..578392) [675 bp, 224 aa] {ON}
          HLJ1Co-chaperone for Hsp40p, anchored in the ER
          membrane; with its homolog Ydj1p promotes ER-associated
          protein degradation (ERAD) of integral membrane
          substrates; similar to E. coli DnaJ
          Length = 224

 Score = 66.2 bits (160), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 46/67 (68%), Gaps = 2/67 (2%)

Query: 6  KLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTG--DTEKFKEISEAFEILSDSNKRSV 63
          + Y++L V   A+D+EIKK YRK A+K HPDK +     E FK I+ AFE+LS+  KRS+
Sbjct: 21 EFYEILKVDRKATDSEIKKAYRKLAIKLHPDKNSHPKAGEAFKVINRAFEVLSNEEKRSI 80

Query: 64 YDQYGLD 70
          YD+ G D
Sbjct: 81 YDRIGRD 87

>KLTH0F13398g Chr6 (1101625..1102884) [1260 bp, 419 aa] {ON}
          similar to uniprot|P40564 YIR004W Saccharomyces
          cerevisiae DJP1 Cytosolic J-domain-containing protein,
          required for peroxisomal protein import
          Length = 419

 Score = 67.8 bits (164), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 35/75 (46%), Positives = 51/75 (68%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          MV +T  YDLLGVS  A   +IKK YRK +++ HPDK   D   TE+F+ IS+A+++LS 
Sbjct: 1  MVVDTTYYDLLGVSPDAKSIDIKKAYRKKSVQEHPDKNPNDPTATERFQAISQAYQVLSK 60

Query: 58 SNKRSVYDQYGLDAA 72
           + R+ YD++G + A
Sbjct: 61 DDLRAKYDKFGKEEA 75

>KNAG0I00860 Chr9 complement(162792..163451) [660 bp, 219 aa] {ON}
          Anc_2.350 YMR161W
          Length = 219

 Score = 65.9 bits (159), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 45/68 (66%), Gaps = 2/68 (2%)

Query: 5  TKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTG--DTEKFKEISEAFEILSDSNKRS 62
          ++ Y++L V  +ASD EIKK YR+ A+K HPDK       E FK I+ AFE+L D +KR 
Sbjct: 22 SEFYEVLQVERTASDNEIKKAYRRLAIKLHPDKNGHPRSAEAFKVINRAFEVLGDEDKRR 81

Query: 63 VYDQYGLD 70
          ++DQ G D
Sbjct: 82 LFDQLGRD 89

>Smik_14.106 Chr14 complement(199985..201766) [1782 bp, 593 aa]
          {ON} YNL227C (REAL)
          Length = 593

 Score = 68.2 bits (165), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 35/64 (54%), Positives = 44/64 (68%), Gaps = 4/64 (6%)

Query: 8  YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILSDSNKRSV 63
          Y+LLGV S ASD E+KK YRK AL+YHPDK   +    TEKF  I  A+E+LSD  +R+ 
Sbjct: 6  YELLGVESHASDLELKKAYRKKALQYHPDKNPDNVQEATEKFAIIRAAYEVLSDPQERAW 65

Query: 64 YDQY 67
          YD +
Sbjct: 66 YDSH 69

>Skud_13.383 Chr13 (669140..670267) [1128 bp, 375 aa] {ON} YMR214W
          (REAL)
          Length = 375

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 46/70 (65%), Gaps = 3/70 (4%)

Query: 8  YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSDSNKRSVY 64
          Y +L +   AS+ EIK  YR+ + K+HPDK  G  E   KF E+ EA+++LSD  K+ +Y
Sbjct: 25 YAILEIDKGASEKEIKSAYRQLSKKFHPDKNAGSEEAHQKFIEVGEAYDVLSDPEKKKIY 84

Query: 65 DQYGLDAARN 74
          DQ+G +A +N
Sbjct: 85 DQFGAEAVKN 94

 Score = 38.1 bits (87), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 52/105 (49%), Gaps = 8/105 (7%)

Query: 246 GRKTLQFIIKEKKHPLYKRDGDNIIYTLPLTFKESLL-GFSKTLQTLDGRTLPLSRSQP- 303
           G   ++F  K+ ++  Y+R GDN+  T  L+ +E+L  G+ +T++ LD    P+  S+P 
Sbjct: 267 GDLVIEFKEKDSENMGYRRRGDNLYRTEVLSIEEALYGGWERTIEFLD-ENKPVKLSRPA 325

Query: 304 ---VQPTEENTYPGQGMPISKNPGQRGNLIIKYKINYPISLTDSQ 345
              V   E     G GMP  K     G+L I Y +  P +L   Q
Sbjct: 326 YVGVSNGEIEVMKGFGMP--KGGKGYGDLYIDYVVIMPKTLKREQ 368

>NDAI0F02450 Chr6 complement(585345..586937) [1593 bp, 530 aa]
          {ON} Anc_2.218
          Length = 530

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 46/67 (68%), Gaps = 3/67 (4%)

Query: 5  TKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSDSNKR 61
          T+LY +L V ++A+  EIK  Y+K ALKYHPDK     E   KF+EI +A+E+L D +K+
Sbjct: 12 TRLYSILQVPTAATLFEIKNAYKKLALKYHPDKNNHSEESKLKFQEICKAYEVLHDKDKK 71

Query: 62 SVYDQYG 68
           +YD YG
Sbjct: 72 LLYDTYG 78

>TBLA0B09380 Chr2 complement(2231452..2232135) [684 bp, 227 aa]
          {ON} Anc_2.350 YMR161W
          Length = 227

 Score = 65.5 bits (158), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 43/67 (64%), Gaps = 4/67 (5%)

Query: 7  LYDLLGVSSSASDAEIKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILSDSNKRSV 63
           YD+L V  +A D EIKK YRK A+K HPDK   P   +E FK I+ AFE+L D  KR +
Sbjct: 25 FYDILKVDKTAQDNEIKKSYRKLAIKLHPDKNPHPKA-SEAFKRINRAFEVLGDEKKRVL 83

Query: 64 YDQYGLD 70
          +D+ G D
Sbjct: 84 FDRIGRD 90

>KAFR0C02450 Chr3 (477069..478190) [1122 bp, 373 aa] {ON}
          Anc_7.217 YER048C
          Length = 373

 Score = 66.6 bits (161), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 47/75 (62%), Gaps = 3/75 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKP---TGDTEKFKEISEAFEILSD 57
          MVKET  Y+LLGV   A+ +EIKK YRK AL   P+K     G  EKF+ I+EA+++L  
Sbjct: 1  MVKETAYYELLGVEPDATSSEIKKAYRKKALSMLPEKHPSNIGANEKFQAIAEAYQVLHS 60

Query: 58 SNKRSVYDQYGLDAA 72
             R  YD+ G +AA
Sbjct: 61 KELREKYDKLGKEAA 75

>KAFR0A07950 Chr1 (1592293..1593948) [1656 bp, 551 aa] {ON}
          Anc_2.15 YNL227C
          Length = 551

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 45/67 (67%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSSSASDAEIKKGYRKAALKYHPDK-PTG---DTEKFKEISEAFEILSDSNK 60
          T  Y+LLGV S ASD E+KK YRK AL+YHPDK PT     TE F  I  A+E+LSD  +
Sbjct: 3  TCYYELLGVDSHASDLELKKAYRKKALQYHPDKNPTKVEEATEIFATIRTAYEVLSDPQE 62

Query: 61 RSVYDQY 67
          R+ YD +
Sbjct: 63 RAWYDSH 69

>NCAS0D00960 Chr4 complement(187021..187695) [675 bp, 224 aa] {ON}
          Anc_2.350
          Length = 224

 Score = 64.7 bits (156), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 45/67 (67%), Gaps = 4/67 (5%)

Query: 7  LYDLLGVSSSASDAEIKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILSDSNKRSV 63
           Y++L V  +A+D EIKK YRK A+K HPDK   P   +E FK I+ AFE+LSD  KR +
Sbjct: 23 FYEILKVEKTANDNEIKKAYRKLAVKLHPDKNPHPKA-SEAFKIINRAFEVLSDVEKRQL 81

Query: 64 YDQYGLD 70
          YD+ G D
Sbjct: 82 YDRIGRD 88

>NDAI0F03800 Chr6 (902416..904332) [1917 bp, 638 aa] {ON} Anc_2.15
          Length = 638

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 45/67 (67%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILSDSNK 60
          T  Y+LLGV  +ASDAE+KK YRK AL++HPDK   +    TE F  I  A+E+LSD  +
Sbjct: 3  TCYYELLGVEVTASDAELKKAYRKKALQFHPDKNPDNVDEATENFATIRAAYEVLSDPQE 62

Query: 61 RSVYDQY 67
          R+ YD +
Sbjct: 63 RAWYDAH 69

>Smik_13.361 Chr13 (561431..562105) [675 bp, 224 aa] {ON} YMR161W
          (REAL)
          Length = 224

 Score = 64.7 bits (156), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 46/67 (68%), Gaps = 2/67 (2%)

Query: 6  KLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTG--DTEKFKEISEAFEILSDSNKRSV 63
          + Y++L V   A+D++IKK YRK A+K HPDK +     E FK I+ AFE+LS+  KRS+
Sbjct: 21 EFYEILKVDRKATDSDIKKAYRKLAIKLHPDKNSHPKAGEAFKVINRAFEVLSNEEKRSI 80

Query: 64 YDQYGLD 70
          YD+ G D
Sbjct: 81 YDRIGRD 87

>Kwal_55.20965 s55 (627332..628597) [1266 bp, 421 aa] {ON} YIR004W
          (DJP1) - involved in peroxisome biogenesis [contig 135]
          FULL
          Length = 421

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 50/74 (67%), Gaps = 3/74 (4%)

Query: 2  VKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSDS 58
          V +T  YDLLGV  SA   +IKK YRK +++ HPDK   D   TE+F+ IS+A+++LS  
Sbjct: 3  VIDTTYYDLLGVDPSAKAIDIKKAYRKKSVQEHPDKNPNDPTATERFQAISQAYQVLSKE 62

Query: 59 NKRSVYDQYGLDAA 72
          + R+ YD+YG + A
Sbjct: 63 DLRAKYDKYGKEEA 76

>YNL227C Chr14 complement(220659..222431) [1773 bp, 590 aa] {ON}
          JJJ1Co-chaperone that stimulates the ATPase activity of
          Ssa1p, required for a late step of ribosome biogenesis;
          associated with the cytosolic large ribosomal subunit;
          contains a J-domain; mutation causes defects in
          fluid-phase endocytosis
          Length = 590

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 45/67 (67%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILSDSNK 60
          T  Y+LLGV + ASD E+KK YRK AL+YHPDK   +    T+KF  I  A+E+LSD  +
Sbjct: 3  TCYYELLGVETHASDLELKKAYRKKALQYHPDKNPDNVEEATQKFAVIRAAYEVLSDPQE 62

Query: 61 RSVYDQY 67
          R+ YD +
Sbjct: 63 RAWYDSH 69

>Skud_12.158 Chr12 (303908..305275) [1368 bp, 455 aa] {ON} YLR090W
          (REAL)
          Length = 455

 Score = 66.2 bits (160), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 45/74 (60%), Gaps = 6/74 (8%)

Query: 3  KETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILS 56
          +  +LY +LGV+  A   EIK  YRK ALK+HPDK            KFKEI+ A+EILS
Sbjct: 6  RNNRLYGVLGVTRDADVQEIKTAYRKLALKHHPDKYVDQDSKDVNEIKFKEITAAYEILS 65

Query: 57 DSNKRSVYDQYGLD 70
          D  K+S YD YG D
Sbjct: 66 DPEKKSHYDLYGDD 79

>NDAI0H03180 Chr8 (757990..758679) [690 bp, 229 aa] {ON} Anc_2.350
          Length = 229

 Score = 63.9 bits (154), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 46/67 (68%), Gaps = 4/67 (5%)

Query: 7  LYDLLGVSSSASDAEIKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILSDSNKRSV 63
           Y++L V  ++++ EIKK YRK A++ HPDK   P   +E FK I+ AFE+LSD+ KR +
Sbjct: 22 FYEILKVERTSTENEIKKAYRKLAIRLHPDKNPHPKA-SEAFKIINRAFEVLSDNEKRRI 80

Query: 64 YDQYGLD 70
          +DQ G D
Sbjct: 81 FDQLGRD 87

>ZYRO0F15400g Chr6 (1261048..1262625) [1578 bp, 525 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 525

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 46/67 (68%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILSDSNK 60
          T  Y+LLGVSS+A D E+KK +R+ AL+YHPDK   +    TE F +I  A+E+L+D  +
Sbjct: 3  TCYYELLGVSSTADDLELKKAFRRKALQYHPDKNRDNVEEATETFAQIRAAYEVLNDPQE 62

Query: 61 RSVYDQY 67
          R+ YD +
Sbjct: 63 RAWYDSH 69

>TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}
          Anc_2.15 YNL227C
          Length = 659

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 43/67 (64%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSSSASDAEIKKGYRKAALKYHPDK----PTGDTEKFKEISEAFEILSDSNK 60
          T  Y+LL VS  ASD E+KK YRK AL+YHPDK    P   T  F EI  A+E+LSD  +
Sbjct: 3  TCYYELLEVSEYASDLELKKAYRKKALQYHPDKNRENPEEATAIFSEIRAAYEVLSDPQE 62

Query: 61 RSVYDQY 67
          R+ YD +
Sbjct: 63 RAWYDSH 69

>SAKL0E14234g Chr5 (1172804..1174840) [2037 bp, 678 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 678

 Score = 65.9 bits (159), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 44/67 (65%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTEK----FKEISEAFEILSDSNK 60
          T  Y+LLGV S ASD E+KK YRK ALKYHPDK   + E+    F  I  A+E+LSD  +
Sbjct: 3  TCYYELLGVESIASDLELKKAYRKKALKYHPDKNPNNVEEATQAFATIRLAYEVLSDPQE 62

Query: 61 RSVYDQY 67
          R+ YD +
Sbjct: 63 RAWYDSH 69

>KAFR0B04890 Chr2 complement(1020109..1020771) [663 bp, 220 aa]
          {ON} Anc_2.350 YMR161W
          Length = 220

 Score = 63.5 bits (153), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 46/67 (68%), Gaps = 4/67 (5%)

Query: 7  LYDLLGVSSSASDAEIKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILSDSNKRSV 63
           Y++L V+ +A+D+EIKK YRK A+K HPDK   P    E FK I+ AFE+L +S KR +
Sbjct: 23 FYEILKVNRTANDSEIKKAYRKLAIKLHPDKNPHPKA-AEAFKLINRAFEVLGNSEKREI 81

Query: 64 YDQYGLD 70
          +++ G D
Sbjct: 82 FNRIGRD 88

>Suva_13.340 Chr13 (556991..557668) [678 bp, 225 aa] {ON} YMR161W
          (REAL)
          Length = 225

 Score = 63.5 bits (153), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 44/68 (64%), Gaps = 4/68 (5%)

Query: 6  KLYDLLGVSSSASDAEIKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILSDSNKRS 62
          + Y +L V   A+D EIKK YRK A+K HPDK   P   +E FK I+ AFE+LS+  KR 
Sbjct: 21 EFYQILKVDKKATDGEIKKAYRKLAIKLHPDKNPHPKA-SEAFKIINRAFEVLSNEEKRG 79

Query: 63 VYDQYGLD 70
          +YD+ G D
Sbjct: 80 LYDRIGRD 87

>Kpol_526.6 s526 (7574..8260) [687 bp, 228 aa] {ON} (7574..8260)
          [687 nt, 229 aa]
          Length = 228

 Score = 63.2 bits (152), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 45/67 (67%), Gaps = 4/67 (5%)

Query: 7  LYDLLGVSSSASDAEIKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILSDSNKRSV 63
           Y++L V  S+ + EIKK YRK A+K HPDK   P   +E FK I+ AFE+LSD+ KR +
Sbjct: 23 FYNVLKVERSSDETEIKKSYRKLAIKLHPDKNPHPKA-SEAFKVINRAFEVLSDNEKREI 81

Query: 64 YDQYGLD 70
          +D+ G D
Sbjct: 82 FDRIGRD 88

>CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227c
          Length = 623

 Score = 65.1 bits (157), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 44/67 (65%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTEK----FKEISEAFEILSDSNK 60
          T  YDLL V S ASD ++KK YR+ AL+YHPDK   + E+    F EI  A+E+LSD  +
Sbjct: 3  TCYYDLLEVRSDASDLDLKKAYRRKALQYHPDKNPDNVEEATTIFAEIRAAYEVLSDPQE 62

Query: 61 RSVYDQY 67
          R+ YD +
Sbjct: 63 RAWYDSH 69

>KLLA0D19602g Chr4 (1653096..1654958) [1863 bp, 620 aa] {ON}
          similar to uniprot|P53863 Saccharomyces cerevisiae
          YNL227C JJJ1 Protein that may function as a cochaperone
          as suggested by the presence of a DnaJ-like domain
          Length = 620

 Score = 65.1 bits (157), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 44/67 (65%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILSDSNK 60
          T  YDLL V S A+D ++K+ YRK AL YHPDK   +    TE F +I  A+E+LSD+ +
Sbjct: 3  TCYYDLLDVKSDATDTDLKRAYRKKALLYHPDKNRNNIEEATEVFAQIRAAYEVLSDAQE 62

Query: 61 RSVYDQY 67
          R+ YD +
Sbjct: 63 RAWYDAH 69

>Kwal_56.23782 s56 complement(703853..705097) [1245 bp, 414 aa]
          {ON} YLR090W (XDJ1) - Homolog of E. coli DnaJ [contig
          173] FULL
          Length = 414

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 45/67 (67%), Gaps = 6/67 (8%)

Query: 8  YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDSNKR 61
          YD LGV+  A+  EIKK YR+ AL++HPDK + ++       KFKE++ A+E+LS+  KR
Sbjct: 4  YDTLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLREESEIKFKEVAAAYELLSNEEKR 63

Query: 62 SVYDQYG 68
            YD YG
Sbjct: 64 RNYDTYG 70

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 64/148 (43%), Gaps = 9/148 (6%)

Query: 208 GMRGEPEKVQIDINLKPGWKEGTKLTYKNHGDYNPSTGGRKT--LQFIIKEKKHPL-YKR 264
           G R  PE   +++ +  G +   ++  +   D  P   G+ T  L F I E       +R
Sbjct: 209 GKRVTPETKNLNVYIPRGSRHNDRIVLEGEADEEP---GKLTGDLVFDISEDSTTSNLER 265

Query: 265 DGDNIIYTLPLTFKESLLGFSK-TLQTLDGRTLPLS--RSQPVQPTEENTYPGQGMPISK 321
            G ++   + ++  ++L GF K    TLDGR L L     Q ++P        +G P+  
Sbjct: 266 RGSDLHTKIIISLSDALTGFEKEVCTTLDGRDLRLKIPTGQVIRPGNYICLKNEGWPLDD 325

Query: 322 NPGQRGNLIIKYKINYPISLTDSQRRAI 349
              + GN+ ++  I +P     S+R  I
Sbjct: 326 EGKKFGNMYVQINIEFPPDHWYSERGEI 353

>Kwal_23.4420 s23 complement(711673..713451) [1779 bp, 592 aa]
          {ON} YNL227C - Hypothetical ORF [contig 1] FULL
          Length = 592

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 45/67 (67%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTEK----FKEISEAFEILSDSNK 60
          T  Y+LLGV ++ASDA++KK YRK AL YHPDK   + E+    F  I  A+E+L+D  +
Sbjct: 3  TCYYELLGVETTASDADLKKAYRKKALVYHPDKNRDNVEEATAIFATIRAAYEVLADPQE 62

Query: 61 RSVYDQY 67
          R+ YD +
Sbjct: 63 RAWYDSH 69

>KNAG0G01130 Chr7 (244979..246481) [1503 bp, 500 aa] {ON} Anc_8.61
          YFL016C
          Length = 500

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 41/61 (67%), Gaps = 2/61 (3%)

Query: 8  YDLLGVSSSASDAEIKKGYRKAALKYHPD--KPTGDTEKFKEISEAFEILSDSNKRSVYD 65
          Y +LGV SSAS  EIKK Y K A +YHPD  K  G  +KF ++  A+EILSD +KR  +D
Sbjct: 37 YGVLGVKSSASQGEIKKAYYKLAKQYHPDINKEAGAEKKFHDLQNAYEILSDESKRKQFD 96

Query: 66 Q 66
          Q
Sbjct: 97 Q 97

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/130 (24%), Positives = 60/130 (46%), Gaps = 11/130 (8%)

Query: 217 QIDINLKPGWKEGTKLTYKNHGDY-----NPSTGG-----RKTLQFIIKEKKHPLYK-RD 265
           +I ++L  G ++G  +     G Y     +PS  G     R  +   ++ ++ P +  RD
Sbjct: 284 EITVDLPHGLQDGDVIRIPGQGSYPEVALDPSLAGSVKLTRGDVLVNVRVEEDPTFTIRD 343

Query: 266 GDNIIYTLPLTFKESLLGFSKTLQTLDGRTLPLSRSQPVQPTEENTYPGQGMPISKNPGQ 325
             +I YT+ +    + LG +  + T+DG  + L  +   Q  +  T P  G+P S     
Sbjct: 344 KSDIWYTMEIPITTAALGGTVQVPTVDGSHIRLKVAPGTQSGDVITVPNMGVPRSNLTRS 403

Query: 326 RGNLIIKYKI 335
           RG + ++Y+I
Sbjct: 404 RGAMKVQYRI 413

>KLTH0B08338g Chr2 (676591..678363) [1773 bp, 590 aa] {ON} similar
          to uniprot|P53863 Saccharomyces cerevisiae YNL227C JJJ1
          Protein that may function as a cochaperone as suggested
          by the presence of a DnaJ-like domain
          Length = 590

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 46/67 (68%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTEK----FKEISEAFEILSDSNK 60
          T  Y+LLGV ++ASD+++KK YR+ AL+YHPDK   + E+    F  I  A+E+L+D  +
Sbjct: 3  TCYYELLGVETTASDSDLKKAYRRKALQYHPDKNPDNVEEATTVFATIRSAYEVLADPQE 62

Query: 61 RSVYDQY 67
          R+ YD +
Sbjct: 63 RAWYDSH 69

>KLTH0G13640g Chr7 complement(1167336..1168580) [1245 bp, 414 aa]
          {ON} similar to uniprot|P39102 Saccharomyces cerevisiae
          YLR090W XDJ1 Putative homolog of E. coli DnaJ closely
          related to Ydj1p
          Length = 414

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 45/67 (67%), Gaps = 6/67 (8%)

Query: 8  YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDSNKR 61
          Y+ LGV+  A+  EIKK YR+ AL++HPDK + ++       KFKE++ A+E+LS+  KR
Sbjct: 4  YETLGVAPDATQDEIKKAYRRLALQHHPDKVSDESLRDESEIKFKEVAAAYELLSNEEKR 63

Query: 62 SVYDQYG 68
            YD YG
Sbjct: 64 QNYDTYG 70

>NCAS0G01360 Chr7 complement(242638..244488) [1851 bp, 616 aa]
          {ON} Anc_2.15
          Length = 616

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 44/67 (65%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILSDSNK 60
          T  Y+LLGV  +A+D E+KK YRK AL++HPDK   +    TE F  I  A+E+LSD  +
Sbjct: 3  TCYYELLGVDVTATDLELKKAYRKKALQFHPDKNPDNVDEATEIFATIRSAYEVLSDPQE 62

Query: 61 RSVYDQY 67
          R+ YD +
Sbjct: 63 RAWYDAH 69

>Kpol_529.21 s529 (62384..64252) [1869 bp, 622 aa] {ON}
          (62384..64252) [1869 nt, 623 aa]
          Length = 622

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 44/67 (65%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILSDSNK 60
          T  Y+LLGV  +A+D E+KK YRK AL++HPDK   +    TE F  I  A+E+LSD  +
Sbjct: 3  TCYYELLGVDITATDIELKKAYRKKALQFHPDKNPDNVEEATEIFATIRSAYEVLSDPQE 62

Query: 61 RSVYDQY 67
          R+ YD +
Sbjct: 63 RAWYDAH 69

>Kpol_543.40 s543 (89534..90778) [1245 bp, 414 aa] {ON}
          (89534..90778) [1245 nt, 415 aa]
          Length = 414

 Score = 62.0 bits (149), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 44/65 (67%), Gaps = 6/65 (9%)

Query: 8  YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSDSNKR 61
          Y++LGV+  A+  EIKK YRK AL+YHPDK   + +      KFK+I+ A++ LSD +KR
Sbjct: 14 YEILGVAEDATHEEIKKTYRKLALQYHPDKSIDEGQKLINEIKFKDITAAYQTLSDEDKR 73

Query: 62 SVYDQ 66
          + YD 
Sbjct: 74 NEYDN 78

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 41/80 (51%), Gaps = 4/80 (5%)

Query: 263 KRDGDNIIYTLPLTFKESLLGFSK--TLQTLDGRTLPLS--RSQPVQPTEENTYPGQGMP 318
           +R G+++I    ++  E++ GF     ++T D R L LS  + + ++P +      +G P
Sbjct: 269 ERYGNHLINHTHISLAEAITGFENKFIVKTFDDRDLYLSTPKGKVIRPGDILEVKNEGWP 328

Query: 319 ISKNPGQRGNLIIKYKINYP 338
           + K     GNL +  +I +P
Sbjct: 329 MDKYGASFGNLYVILEIEFP 348

>AFR507W Chr6 (1348057..1349481) [1425 bp, 474 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFL016C (MDJ1)
          Length = 474

 Score = 62.0 bits (149), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 42/62 (67%), Gaps = 2/62 (3%)

Query: 8   YDLLGVSSSASDAEIKKGYRKAALKYHPD--KPTGDTEKFKEISEAFEILSDSNKRSVYD 65
           Y+ LGV+  AS ++IKK Y K A ++HPD  K  G  +KF ++  A+EILSD NKR  YD
Sbjct: 43  YETLGVAKDASASQIKKAYYKLAKQFHPDINKDEGAEKKFHDLQNAYEILSDENKRRQYD 102

Query: 66  QY 67
           Q+
Sbjct: 103 QF 104

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 36/68 (52%), Gaps = 1/68 (1%)

Query: 268 NIIYTLPLTFKESLLGFSKTLQTLDGRTLPLSRSQPVQPTEENTYPGQGMPISKNPGQRG 327
           +I Y   +    + LG + ++ T+DG  + L      QP +  + P +G+P   + G RG
Sbjct: 335 DIWYVQEIPITTAALGGTVSIPTVDGDQIRLKVIPGTQPDQVVSIPNKGVPRGLS-GARG 393

Query: 328 NLIIKYKI 335
           ++ ++Y+I
Sbjct: 394 DMKVQYRI 401

>KNAG0F00860 Chr6 complement(155142..157022) [1881 bp, 626 aa]
          {ON} Anc_2.15 YNL227C
          Length = 626

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 45/67 (67%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTEK----FKEISEAFEILSDSNK 60
          T  Y+LLGV ++A+D E+KK YR+ AL++HPDK   + E+    F  +  A+E+L+D  +
Sbjct: 3  TCYYELLGVETNATDVELKKAYRRKALQFHPDKNPDNVEETTAIFASVRAAYEVLADPQE 62

Query: 61 RSVYDQY 67
          R+ YD +
Sbjct: 63 RAWYDDH 69

>TPHA0O01940 Chr15 (386610..388406) [1797 bp, 598 aa] {ON}
          Anc_2.15 YNL227C
          Length = 598

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 43/67 (64%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILSDSNK 60
          T  Y+LL V  +ASDA++KK YR+ AL+YHPDK   +    T+ F  I  A+EILSD  +
Sbjct: 3  TCYYELLDVEMTASDADLKKAYRRKALQYHPDKNINNIKEATDIFANIRTAYEILSDPQE 62

Query: 61 RSVYDQY 67
          R  YD +
Sbjct: 63 RVWYDSH 69

>Kpol_1072.4 s1072 (8361..10346) [1986 bp, 661 aa] {ON}
           (8361..10346) [1986 nt, 662 aa]
          Length = 661

 Score = 62.0 bits (149), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 42/70 (60%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILSDS 58
           YDLLGVS +ASD EIK  YRK +LK+HPDK   D          E + +IS+A+E L+D 
Sbjct: 122 YDLLGVSVTASDKEIKSAYRKLSLKFHPDKVAKDITEEEKNSLEEMYVQISKAYEALTDE 181

Query: 59  NKRSVYDQYG 68
             +  Y  YG
Sbjct: 182 LVKQNYLMYG 191

>CAGL0L12276g Chr12 (1329467..1330825) [1359 bp, 452 aa] {ON}
          similar to uniprot|Q12014 Saccharomyces cerevisiae
          YLR090w
          Length = 452

 Score = 60.8 bits (146), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 43/70 (61%), Gaps = 11/70 (15%)

Query: 8  YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE-----------KFKEISEAFEILS 56
          Y LLGV   AS  EIK+ YRK AL++HPDK  G+              FKE++ A+++LS
Sbjct: 4  YGLLGVGQDASQDEIKRAYRKLALRHHPDKARGNEGGEDSSDDLPDVDFKEVTAAYQVLS 63

Query: 57 DSNKRSVYDQ 66
          D++ R+ YDQ
Sbjct: 64 DASLRAEYDQ 73

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 61/133 (45%), Gaps = 12/133 (9%)

Query: 218 IDINLKPGWKEGTKLTYKNHGDYNPSTGGRKTLQFIIKEKKHPLYK--RDGDNIIYTLPL 275
           + IN+K G  +G K+  K   D +  +     L   I+E K P Y   R+G ++I    +
Sbjct: 239 VTINIKKGTLDGDKIVLKGEADEDLESTEVGDLVIKIQEVKEPQYDIVRNGYDLIIKKQI 298

Query: 276 TFKESLLGFSK--TLQTLDGRTLPLS--RSQPVQPTEENTYPGQGMPISKNPG------Q 325
              +++ GF +   ++T DGR L  S  R + ++P +      +G P  ++        +
Sbjct: 299 DLADAICGFDEKPLMETYDGRVLKWSSKRGKVIRPNDIVRIQNEGWPRREDANDNNTLLK 358

Query: 326 RGNLIIKYKINYP 338
            G+L +   I +P
Sbjct: 359 NGDLYVIVDIVFP 371

>NDAI0E00870 Chr5 complement(176292..177422) [1131 bp, 376 aa]
          {ON} Anc_8.730
          Length = 376

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 41/64 (64%), Gaps = 3/64 (4%)

Query: 8  YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSDSNKRSVY 64
          Y +L +   A+D +I+  YR+ + KYHPDK   D +   KF E+ +A+EILSD  KR  Y
Sbjct: 24 YKILELDKDATDKDIRSAYRQLSKKYHPDKNPNDEDAHHKFIEVGQAYEILSDPEKRQRY 83

Query: 65 DQYG 68
          DQ+G
Sbjct: 84 DQFG 87

 Score = 38.5 bits (88), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 55/124 (44%), Gaps = 7/124 (5%)

Query: 231 KLTYKNHG--DYNPS-TGGRKTLQFIIKEKKHPLYKRDGDNIIYTLPLTFKESLLG-FSK 286
           K  +  HG  D +P    G   ++F   +K +  Y+R G ++  T  L   E+L G + +
Sbjct: 248 KFVHAEHGAADKHPDYDSGDVYIEFTENDKDNMGYRRRGPHLYRTEVLNATEALYGGWER 307

Query: 287 TLQTLDGRTLPLSRSQP---VQPTEENTYPGQGMPISKNPGQRGNLIIKYKINYPISLTD 343
            L  LD   +   + +P   +Q  E     G GMP+       G+L I Y +  P SL+ 
Sbjct: 308 QLAFLDSSKIVTIKREPNKIIQNGETERIAGFGMPLGNGRKGFGDLFIDYVVVMPESLSG 367

Query: 344 SQRR 347
            + R
Sbjct: 368 EELR 371

>SAKL0C02904g Chr3 complement(275106..275951) [846 bp, 281 aa]
          {ON} weakly similar to uniprot|P52868 Saccharomyces
          cerevisiae YGL128C
          Length = 281

 Score = 58.5 bits (140), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 44/73 (60%), Gaps = 10/73 (13%)

Query: 5  TKLYDLLGVSSSASDA-------EIKKGYRKAALKYHPDKPTGDT---EKFKEISEAFEI 54
            LY +LG S  + DA       +++K YRK AL+YHPDK   DT    KF ++S A +I
Sbjct: 13 VNLYSVLGFSPGSLDAVRAVSTLQVRKQYRKLALQYHPDKNPHDTSLIHKFHQVSVATKI 72

Query: 55 LSDSNKRSVYDQY 67
          LSDS  RS+YD +
Sbjct: 73 LSDSRLRSLYDSW 85

>TPHA0D00550 Chr4 complement(95500..96960) [1461 bp, 486 aa] {ON}
           Anc_8.61 YFL016C
          Length = 486

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 40/66 (60%), Gaps = 2/66 (3%)

Query: 8   YDLLGVSSSASDAEIKKGYRKAALKYHPD--KPTGDTEKFKEISEAFEILSDSNKRSVYD 65
           Y  LGVS  AS ++IK+ Y K A KYHPD  K  G  + F  +  A+EILSD  K+  YD
Sbjct: 50  YKTLGVSRDASPSDIKRAYYKLAKKYHPDINKEPGADKTFHNLQNAYEILSDEKKKLQYD 109

Query: 66  QYGLDA 71
           QYG  A
Sbjct: 110 QYGSSA 115

 Score = 36.6 bits (83), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 58/133 (43%), Gaps = 15/133 (11%)

Query: 215 KVQIDINLKPGWKEGTKLTYKNHGDY-NPSTG--------GRKTLQFIIKEKKHPLYKRD 265
           K  +++N   G  +G  +     G Y N + G         R  L   I+ K  P +   
Sbjct: 283 KKSLNVNFPSGLSDGDVIRIPGEGSYPNIAVGENDKSIKLSRGDLLVRIRVKSDPKFFVK 342

Query: 266 GDNIIYTL---PLTFKESLLGFSKTLQTLDGRTLPLSRSQPVQPTEENTYPGQGMPISKN 322
               I+T+   P+T   + LG +  ++T+DG+ + L      Q  +  + P  G+P    
Sbjct: 343 NKYDIWTIKEIPIT--TAALGGTVEIETVDGKNIRLKVISGTQHDQVTSIPNMGIPYRNG 400

Query: 323 PGQRGNLIIKYKI 335
            G RGN+ ++YKI
Sbjct: 401 TG-RGNMNVQYKI 412

>ZYRO0D10934g Chr4 complement(921917..923908) [1992 bp, 663 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 663

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 46/70 (65%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSSSASDAEIKKGYRKAALKYHPDK------PTGDT---EKFKEISEAFEILSDS 58
           Y++LGVS+SA+D EIK  YRK ++K+HPDK      P   T   E + +I++A+E L+D 
Sbjct: 124 YEILGVSASAADREIKSAYRKLSVKFHPDKLGHDLAPEARTKMEEMYVQITKAYESLTDE 183

Query: 59  NKRSVYDQYG 68
           N +  Y +YG
Sbjct: 184 NVKENYLRYG 193

>KNAG0G02050 Chr7 (466752..468050) [1299 bp, 432 aa] {ON}
          Anc_8.264 YLR090W
          Length = 432

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/56 (53%), Positives = 38/56 (67%), Gaps = 6/56 (10%)

Query: 8  YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILSD 57
          YD+LGV   ++D EI+K YRK ALK+HPDK     E      KFKEI+ A+EILS+
Sbjct: 7  YDILGVDRDSTDDEIRKAYRKLALKFHPDKVIDPEEKASNEMKFKEITTAYEILSN 62

 Score = 33.9 bits (76), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 70/170 (41%), Gaps = 14/170 (8%)

Query: 195 FTGKKKSFKIGRKGMRGE---PEKVQIDINLKPGWKEGTKLTYKNHGDYNPSTGGRKTLQ 251
           +T K  S K   K   GE    EK Q+ + +  G +    + +K  GD +  T     + 
Sbjct: 201 YTAKPTSDKNKCKLCHGEGLIKEKQQLLVTIPRGSENSNTIIFKEKGDEDLRTRRAGDIV 260

Query: 252 FIIKEKKHP-------LYKRDGDNIIYTLPLTFKESLLGFSKTL--QTLDGRTLPLSRSQ 302
           F +K    P       L  ++G ++   + +   E++ G       +T D R L L+  Q
Sbjct: 261 FRLKLHDEPNGGDPDILVTKEGTDLHMNIEIPLIEAISGTQGRFLTKTFDDRVLKLTMPQ 320

Query: 303 --PVQPTEENTYPGQGMPISKNPGQRGNLIIKYKINYPISLTDSQRRAIA 350
              ++P +     G+G P + N  + G++ +   + +P     S+R  I 
Sbjct: 321 GKVLRPGDTIVIKGEGWPKTPNGTEFGDMFVHVNVEFPPDNWISERNDIT 370

>KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {ON}
           Anc_8.698 YOR254C
          Length = 650

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 46/70 (65%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSSSASDAEIKKGYRKAALKYHPDK-PTGDTE--------KFKEISEAFEILSDS 58
           Y+LLG+SSSASD +IK  YRK +LK+HPDK P G +E        ++ +I++A+E L+D 
Sbjct: 123 YELLGISSSASDKDIKSAYRKLSLKFHPDKLPKGLSEADREGLEAQYVQITKAYESLTDE 182

Query: 59  NKRSVYDQYG 68
             R  Y  YG
Sbjct: 183 LIRFNYLTYG 192

>CAGL0G07469g Chr7 complement(708261..710267) [2007 bp, 668 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254c SEC63
          Length = 668

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 42/70 (60%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSSSASDAEIKKGYRKAALKYHPDKP---------TGDTEKFKEISEAFEILSDS 58
           YDLLG+S SASD +IK  YR+ +LK+HPDK          T   E + +IS+A E L+D 
Sbjct: 127 YDLLGISPSASDKDIKSAYRRLSLKFHPDKMSKELSAEERTAMEEMYVQISKAHEALTDP 186

Query: 59  NKRSVYDQYG 68
             R  Y +YG
Sbjct: 187 IVRENYLKYG 196

>TPHA0A01790 Chr1 complement(362209..363528) [1320 bp, 439 aa]
          {ON} Anc_8.264 YLR090W
          Length = 439

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 41/70 (58%), Gaps = 11/70 (15%)

Query: 7  LYDLLGVSSSASDAEIKKGYRKAALKYHPDK---PTGDTE--------KFKEISEAFEIL 55
          LY +L V  + +  E+KK YRK ALKYHPDK     GD +        KFKEI  A+EIL
Sbjct: 12 LYAILEVDETITQDELKKQYRKLALKYHPDKVQTTDGDEDDVKLEYELKFKEIISAYEIL 71

Query: 56 SDSNKRSVYD 65
          SD  KR  YD
Sbjct: 72 SDEEKRKQYD 81

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 68/139 (48%), Gaps = 7/139 (5%)

Query: 218 IDINLKPGWKEGTKLTYKNHGDYNPSTGGRKTLQFIIKE--KKHPLYKRDGD-NIIYTLP 274
           I +N+  G  +   +   N  D          L F+++E   +    KR GD ++I  L 
Sbjct: 224 ITVNIPRGSSDKDTIIIDNKADQELGKFKTGDLIFVLEEIDDEQTALKRYGDKDLITELT 283

Query: 275 LTFKESLLGFSK--TLQTLDGRTLPLS--RSQPVQPTEENTYPGQGMPISKNPGQRGNLI 330
           ++  +++ GF +   ++TLDGR L LS    + ++  +     G+G P++KN  + G+L 
Sbjct: 284 ISLADAITGFKEKPIVKTLDGRLLRLSIPVGKVIRFGDILKVEGEGWPLNKNATRSGDLY 343

Query: 331 IKYKINYPISLTDSQRRAI 349
           IK+ I +P    +S+   I
Sbjct: 344 IKFNIEFPADNWNSEMNDI 362

>TDEL0E00500 Chr5 complement(112459..114204) [1746 bp, 581 aa]
          {ON} Anc_2.15 YNL227C
          Length = 581

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 41/67 (61%), Gaps = 4/67 (5%)

Query: 5  TKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD----TEKFKEISEAFEILSDSNK 60
          T  Y+LL V   A D E+KK YR+ AL+YHPDK   +    TE F  I  A+E+LSD  +
Sbjct: 3  TCYYELLDVQPFADDNELKKAYRRKALQYHPDKNPENVEEATEIFASIRAAYEVLSDPQE 62

Query: 61 RSVYDQY 67
          R+ YD +
Sbjct: 63 RAWYDSH 69

>NCAS0C01220 Chr3 (225905..227914) [2010 bp, 669 aa] {ON} Anc_8.698
          Length = 669

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 45/70 (64%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILSDS 58
           Y+LLG+S SASD +IK  YRK ++K+HPDK + D          EK+ +I++A+E L+D 
Sbjct: 123 YELLGISVSASDRDIKSAYRKLSVKFHPDKLSKDLSQEERTSMEEKYVQITKAYEALTDE 182

Query: 59  NKRSVYDQYG 68
             +  + +YG
Sbjct: 183 VIKENFLKYG 192

>KAFR0H02310 Chr8 (441168..443135) [1968 bp, 655 aa] {ON} Anc_8.698
           YOR254C
          Length = 655

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 44/70 (62%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSSSASDAEIKKGYRKAALKYHPDK---------PTGDTEKFKEISEAFEILSDS 58
           YD+LG+SSSAS+ EIK  YRK ++K+HPDK          T   E + +I++A+E L+D 
Sbjct: 121 YDILGISSSASEREIKSAYRKLSVKFHPDKLAKELTEQERTTMEEAYVQITKAYEALTDE 180

Query: 59  NKRSVYDQYG 68
             R  + +YG
Sbjct: 181 LTRQNFLKYG 190

>Ecym_1097 Chr1 complement(203901..204713) [813 bp, 270 aa] {ON}
          similar to Ashbya gossypii AFR659W
          Length = 270

 Score = 55.8 bits (133), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 45/70 (64%), Gaps = 9/70 (12%)

Query: 7  LYDLLGVS-------SSASDAEIKKGYRKAALKYHPDKPTG--DTEKFKEISEAFEILSD 57
          LYD L ++       ++ S ++++K YR+ ALKYHPDK T     EKF +I  AF++LSD
Sbjct: 14 LYDELQIAILSKEDLNNVSISQLRKQYRQMALKYHPDKSTAPNAQEKFLKIKLAFDVLSD 73

Query: 58 SNKRSVYDQY 67
          S+ R  Y+Q+
Sbjct: 74 SDSRKRYNQW 83

>KNAG0B01890 Chr2 (358819..359931) [1113 bp, 370 aa] {ON} Anc_1.92
           YGL128C
          Length = 370

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 42/72 (58%), Gaps = 11/72 (15%)

Query: 7   LYDLLGVSSSASDA----EIKKGYRKAALKYHPDKPTGDTE-------KFKEISEAFEIL 55
           LYD+LG+ S+  D     E+K+ Y+K  L+YHPDK     E       +F  +  AF+IL
Sbjct: 83  LYDVLGLDSAKLDEITVEEVKRCYKKLVLQYHPDKNVSGAEDASFVASRFHSLRSAFQIL 142

Query: 56  SDSNKRSVYDQY 67
            DS+ R+ YDQ+
Sbjct: 143 CDSSLRTQYDQW 154

>TBLA0B03730 Chr2 (860167..862248) [2082 bp, 693 aa] {ON} Anc_8.698
           YOR254C
          Length = 693

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 45/70 (64%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILSDS 58
           Y+LLG+S+SAS+ +IK  YRK ++K+HPDK + D          E + +I++A+E L+D 
Sbjct: 131 YELLGISTSASERDIKSAYRKLSVKFHPDKLSKDLSEKERTTMEEMYVQITKAYEALTDE 190

Query: 59  NKRSVYDQYG 68
             R  + +YG
Sbjct: 191 AMRENFLKYG 200

>TBLA0A05560 Chr1 complement(1380366..1381304) [939 bp, 312 aa]
          {ON} Anc_1.92 YGL128C
          Length = 312

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 44/70 (62%), Gaps = 6/70 (8%)

Query: 4  ETKLYDLLGV---SSSASDAEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSD 57
          +  LYD+LG    +S+ +  EIKK YR  ALKYHPDK   D    EKF +I+ A  IL++
Sbjct: 12 KVNLYDILGFHNNNSTITSNEIKKRYRSLALKYHPDKTPNDLTLVEKFHKITIALNILTN 71

Query: 58 SNKRSVYDQY 67
          +  ++ YD++
Sbjct: 72 NQLKTEYDKW 81

>ADL111W Chr4 (487949..489685) [1737 bp, 578 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YER048C (CAJ1)
          Length = 578

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 48/76 (63%), Gaps = 3/76 (3%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPD-KPTG--DTEKFKEISEAFEILSD 57
          MV +T  YD+LGV+ SA   +  K YR  A++ HPD  PT      KF+E+S+A+++LSD
Sbjct: 1  MVLDTTYYDILGVTPSAFAEQNNKAYRMKAIQTHPDMNPTHPYAHAKFQEVSKAYKVLSD 60

Query: 58 SNKRSVYDQYGLDAAR 73
           + ++ Y ++GL   R
Sbjct: 61 PDLKNRYTEFGLSDER 76

>TDEL0A06430 Chr1 complement(1125394..1127394) [2001 bp, 666 aa]
           {ON} Anc_8.698 YOR254C
          Length = 666

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 30/70 (42%), Positives = 43/70 (61%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILSDS 58
           Y LLGVS SA+D +IK  YRK ++K+HPDK + D          E + +IS+A+E L+D 
Sbjct: 125 YALLGVSPSATDRDIKSAYRKLSVKFHPDKLSKDLGGEERARIEEMYVQISKAYEALTDE 184

Query: 59  NKRSVYDQYG 68
             ++ Y  YG
Sbjct: 185 ITKANYLTYG 194

>KNAG0A05650 Chr1 complement(842844..843371) [528 bp, 175 aa] {ON}
          Anc_2.350 YMR161W
          Length = 175

 Score = 53.5 bits (127), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 41/66 (62%), Gaps = 2/66 (3%)

Query: 8  YDLLGVSSSASDAEIKKGYRKAALKYHPDKPT--GDTEKFKEISEAFEILSDSNKRSVYD 65
          YD++GV    S  ++K  Y++   K HPDK +  G  E F  + +A++ LS+  KR++YD
Sbjct: 25 YDVIGVDIGVSQRQLKMSYKELITKLHPDKNSSPGAKEAFALVHKAYKTLSNKQKRAMYD 84

Query: 66 QYGLDA 71
          +YG DA
Sbjct: 85 KYGNDA 90

>SAKL0H00858g Chr8 complement(101231..102529) [1299 bp, 432 aa] {ON}
           highly similar to uniprot|P32527 Saccharomyces
           cerevisiae YGR285C ZUO1 Cytosolic ribosome-associated
           chaperone contains a DnaJ domain together with Ssz1p
           acts as a chaperone for nascent polypeptide chains
          Length = 432

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 47/77 (61%), Gaps = 8/77 (10%)

Query: 3   KETKLYDLLGVSS---SASDAEIKKGYRKAALKYHPDK--PTGDTEK---FKEISEAFEI 54
           K   LY  +G+S     A+DA+I K +RK  LK+HPDK   +G  E+   FK I +A+E 
Sbjct: 94  KTADLYAAMGISKLRYKATDAQIIKAHRKQVLKHHPDKKSASGGLEEDGFFKIIQKAYET 153

Query: 55  LSDSNKRSVYDQYGLDA 71
           L+DSNKR+ YD    +A
Sbjct: 154 LTDSNKRAQYDSCDFNA 170

>Smik_15.437 Chr15 complement(754736..756727) [1992 bp, 663 aa] {ON}
           YOR254C (REAL)
          Length = 663

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 12/76 (15%)

Query: 5   TKLYD---LLGVSSSASDAEIKKGYRKAALKYHPDKP----TGD-----TEKFKEISEAF 52
           TKL+D   +LG+S+SASD +IK  YRK ++K+HPDK     T D      E + +I++A+
Sbjct: 121 TKLFDPYEILGISTSASDRDIKSAYRKLSVKFHPDKVAKGLTSDEKSVMEETYVQITKAY 180

Query: 53  EILSDSNKRSVYDQYG 68
           E L+D   R  Y +YG
Sbjct: 181 ESLTDELVRQNYLKYG 196

>Suva_8.303 Chr8 complement(544176..546170) [1995 bp, 664 aa] {ON}
           YOR254C (REAL)
          Length = 664

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 45/70 (64%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSSSASDAEIKKGYRKAALKYHPDK----PTGD-----TEKFKEISEAFEILSDS 58
           Y++LG+SSSASD +IK  YRK ++K+HPDK     T D      E + +I++A+E L+D 
Sbjct: 127 YEILGISSSASDRDIKSAYRKLSVKFHPDKLAKGLTTDEKDVMEETYVQITKAYESLTDE 186

Query: 59  NKRSVYDQYG 68
             R  Y +YG
Sbjct: 187 LVRQNYLKYG 196

>ZYRO0G18436g Chr7 (1520605..1522116) [1512 bp, 503 aa] {ON}
          similar to uniprot|Q757X4 Ashbya gossypii AEL112C
          AEL112Cp and weakly similar to YJL162C uniprot|P46997
          Saccharomyces cerevisiae YJL162C JJJ2 Protein that may
          function as a cochaperone as suggested by the presence
          of a DnaJ-like domain
          Length = 503

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 38/65 (58%), Gaps = 2/65 (3%)

Query: 4  ETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILSDSNKR 61
          ET  Y  LG+S++ASD EI K Y K A + HPDK   D   E FK IS A  +L D  K+
Sbjct: 11 ETTYYSTLGLSTNASDKEIHKSYVKLARELHPDKSKSDGAAELFKLISHAHSVLMDKEKK 70

Query: 62 SVYDQ 66
            YD+
Sbjct: 71 DAYDK 75

>Skud_15.420 Chr15 complement(743976..745973) [1998 bp, 665 aa] {ON}
           YOR254C (REAL)
          Length = 665

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/76 (44%), Positives = 48/76 (63%), Gaps = 12/76 (15%)

Query: 5   TKLYD---LLGVSSSASDAEIKKGYRKAALKYHPDK-PTGDT--------EKFKEISEAF 52
           TKL+D   +LGVS+SASD +IK  YRK ++K+HPDK   G T        E + +I++A+
Sbjct: 121 TKLFDPYEILGVSTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKNVVEEAYVQITKAY 180

Query: 53  EILSDSNKRSVYDQYG 68
           E L+D   R  Y +YG
Sbjct: 181 ESLTDELVRQNYLKYG 196

>AFR639W Chr6 (1604427..1604897) [471 bp, 156 aa] {ON}
          Non-syntenic homolog of Saccharomyces cerevisiae
          YJR097W (JJJ3)
          Length = 156

 Score = 52.0 bits (123), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 36/59 (61%), Gaps = 1/59 (1%)

Query: 8  YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTG-DTEKFKEISEAFEILSDSNKRSVYD 65
          YD+LG++  A   E+++ YR+  L+ HPDK  G D      I +A+ +LSD  +RS YD
Sbjct: 6  YDILGIAVDAEPLEVRQAYRQRLLEAHPDKQGGVDKGAVTRIQQAYRVLSDPTQRSAYD 64

>Kpol_1060.3 s1060 (4445..5743) [1299 bp, 432 aa] {ON} (4445..5743)
           [1299 nt, 433 aa]
          Length = 432

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 45/77 (58%), Gaps = 8/77 (10%)

Query: 3   KETKLYDLLGVSS---SASDAEIKKGYRKAALKYHPDK--PTGDTEK---FKEISEAFEI 54
           K   LY  +G+S     ASDA+I K +RK  LK+HPDK   +G   +   FK I +AFE 
Sbjct: 94  KSADLYAAMGLSKLRFKASDAQIIKAHRKQVLKHHPDKISASGGLNQDGFFKIIQKAFET 153

Query: 55  LSDSNKRSVYDQYGLDA 71
           L+DS KRS YD    +A
Sbjct: 154 LTDSTKRSQYDSCDFEA 170

>TBLA0B03490 Chr2 complement(814731..815885) [1155 bp, 384 aa]
          {ON} Anc_8.730 YMR214W
          Length = 384

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 43/71 (60%), Gaps = 4/71 (5%)

Query: 8  YDLLGVSSSAS-DAEIKKGYRKAALKYHPDKPTGD---TEKFKEISEAFEILSDSNKRSV 63
          Y +LG++ +   + EIK  YRK + KYHPDK   D    + F ++ EA+++L D +K+  
Sbjct: 26 YKILGINKNYKYEKEIKSAYRKLSKKYHPDKNKNDKDAQQNFIKVGEAYDVLGDPDKKRQ 85

Query: 64 YDQYGLDAARN 74
          YDQ G DA  N
Sbjct: 86 YDQMGHDAFVN 96

 Score = 36.2 bits (82), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 41/81 (50%), Gaps = 4/81 (4%)

Query: 262 YKRDGDNIIYTLPLTFKESLLG-FSKTLQTLD-GRTLPLSRSQPVQ--PTEENTYPGQGM 317
           Y+R G+N+  T  ++  E+L G + +TL  LD  + + L RS  V     E     G GM
Sbjct: 294 YRRRGNNLFRTEYISLNEALYGNWERTLDFLDPKKRINLKRSPNVTIYDGEIEILKGFGM 353

Query: 318 PISKNPGQRGNLIIKYKINYP 338
           PI     + G+L I YK+  P
Sbjct: 354 PIPNKKNKFGDLYIDYKVIIP 374

>YOR254C Chr15 complement(805032..807023) [1992 bp, 663 aa] {ON}
           SEC63Essential subunit of Sec63 complex (Sec63p, Sec62p,
           Sec66p and Sec72p); with Sec61 complex, Kar2p/BiP and
           Lhs1p forms a channel competent for SRP-dependent and
           post-translational SRP-independent protein targeting and
           import into the ER
          Length = 663

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 12/76 (15%)

Query: 5   TKLYD---LLGVSSSASDAEIKKGYRKAALKYHPDK-PTGDT--------EKFKEISEAF 52
           TKL+D   +LG+S+SASD +IK  YRK ++K+HPDK   G T        E + +I++A+
Sbjct: 121 TKLFDPYEILGISTSASDRDIKSAYRKLSVKFHPDKLAKGLTPDEKSVMEETYVQITKAY 180

Query: 53  EILSDSNKRSVYDQYG 68
           E L+D   R  Y +YG
Sbjct: 181 ESLTDELVRQNYLKYG 196

>TDEL0C03680 Chr3 (646797..648467) [1671 bp, 556 aa] {ON}
          Anc_1.185 YJL162C
          Length = 556

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 41/68 (60%), Gaps = 2/68 (2%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILSDS 58
          ++ ET  Y  LG+SS+A++AEI K Y   A + HPDK   +   E+FK IS A  +L D 
Sbjct: 8  ILDETTYYSTLGLSSNANEAEIHKSYMMLARQLHPDKSKSEASAEQFKLISHAHSVLMDE 67

Query: 59 NKRSVYDQ 66
           KR  YD+
Sbjct: 68 AKRLKYDE 75

>Kwal_33.13860 s33 complement(427243..428979) [1737 bp, 578 aa]
          {ON} YJL162C - Hypothetical ORF [contig 108] FULL
          Length = 578

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 41/67 (61%), Gaps = 2/67 (2%)

Query: 2  VKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPD--KPTGDTEKFKEISEAFEILSDSN 59
          + +T  Y +LG++S A++A+IKK YRK A+  HPD  K     E FK +S A  +L D  
Sbjct: 8  IDQTTHYSMLGLTSDATEAQIKKAYRKIAMAIHPDKNKSVSAAELFKLVSHAQSVLIDKE 67

Query: 60 KRSVYDQ 66
          +R  Y++
Sbjct: 68 QRQSYNR 74

>KAFR0A01530 Chr1 (306299..307132) [834 bp, 277 aa] {ON} Anc_1.92
          YGL128C
          Length = 277

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 38/54 (70%), Gaps = 1/54 (1%)

Query: 15 SSASDAEIKKGYRKAALKYHPDKPTG-DTEKFKEISEAFEILSDSNKRSVYDQY 67
          +  S A++K+ YRK +LKYHPDK T  + E+F  +S A +IL + + RSVYD++
Sbjct: 28 TKISTADLKRQYRKLSLKYHPDKTTDQNAERFHAVSMAMQILGEDHLRSVYDKW 81

>KLLA0C09823g Chr3 (848641..850650) [2010 bp, 669 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 669

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 44/70 (62%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILSDS 58
           Y+LLGV+ S++D EIK  YRK ++K+HPDK + D          E+F  I++A++ L+D 
Sbjct: 113 YELLGVTLSSTDKEIKSAYRKLSVKFHPDKLSKDLNEIERTAMEEQFVMINKAYKALTDE 172

Query: 59  NKRSVYDQYG 68
             +  Y +YG
Sbjct: 173 ITKENYRKYG 182

>YJL073W Chr10 (303181..305118) [1938 bp, 645 aa] {ON}
           JEM1DnaJ-like chaperone required for nuclear membrane
           fusion during mating, localizes to the ER membrane;
           exhibits genetic interactions with KAR2
          Length = 645

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/75 (42%), Positives = 40/75 (53%), Gaps = 8/75 (10%)

Query: 8   YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD--------TEKFKEISEAFEILSDSN 59
           Y +LGVS SAS  EI+K Y     KYHPDK   +         E   +I+EA+E LSD +
Sbjct: 540 YKILGVSPSASSKEIRKAYLNLTKKYHPDKIKANHNDKQESIHETMSQINEAYETLSDDD 599

Query: 60  KRSVYDQYGLDAARN 74
           KR  YD    +  RN
Sbjct: 600 KRKEYDLSRSNPRRN 614

>Ecym_1450 Chr1 (930504..931982) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AFR507W
          Length = 492

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 36/66 (54%), Positives = 45/66 (68%), Gaps = 2/66 (3%)

Query: 8   YDLLGVSSSASDAEIKKGYRKAALKYHPD--KPTGDTEKFKEISEAFEILSDSNKRSVYD 65
           Y+ LGVS  AS ++IKK Y K A KYHPD  K  G  +KF ++  A+EILSD +KRS YD
Sbjct: 53  YETLGVSRDASTSQIKKAYYKLAKKYHPDINKDEGAEKKFHDLQNAYEILSDESKRSQYD 112

Query: 66  QYGLDA 71
           Q+G  A
Sbjct: 113 QFGAAA 118

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 61/131 (46%), Gaps = 12/131 (9%)

Query: 217 QIDINLKPGWKEGTKLTYKNHGDY-----NPSTGG-----RKTLQFIIKEKKHPLYK-RD 265
           +ID++L  G ++G  +   + G +     +P         R  L   I+ ++ P ++ R+
Sbjct: 289 EIDVDLPHGLQDGDVVKVPSQGSFPHVQVDPEMSHTIRTRRGDLLIQIRVERDPRFQIRN 348

Query: 266 GDNIIYTLPLTFKESLLGFSKTLQTLDGRTLPLSRSQPVQPTEENTYPGQGMPISKNPGQ 325
             +I YT  +    + LG    + T+DG  L L  +   Q  +  + P +G+P       
Sbjct: 349 NYDIWYTQDIPITTAALGGVVNIPTVDGEQLRLKIAPGTQHEQVVSVPNKGVPKGLT-AS 407

Query: 326 RGNLIIKYKIN 336
           RG++ ++YKI+
Sbjct: 408 RGDMKVQYKIS 418

>KLTH0F04906g Chr6 complement(434195..435967) [1773 bp, 590 aa]
          {ON} weakly similar to uniprot|P46997 Saccharomyces
          cerevisiae YJL162C JJJ2 Protein that may function as a
          cochaperone as suggested by the presence of a DnaJ-like
          domain
          Length = 590

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 39/67 (58%), Gaps = 2/67 (2%)

Query: 2  VKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPD--KPTGDTEKFKEISEAFEILSDSN 59
          V ET  Y +LG+ S AS+++IKK YR+ A+  HPD  K     E FK +S A  +L D  
Sbjct: 8  VDETTHYSVLGLKSDASESQIKKAYRRIAMAIHPDKNKSASAAEMFKLVSHAQSVLIDKE 67

Query: 60 KRSVYDQ 66
           R  Y++
Sbjct: 68 LRRTYNR 74

>AFR659W Chr6 (1640624..1641445) [822 bp, 273 aa] {ON}
          Non-syntenic homolog of Saccharomyces cerevisiae
          YGL128C (CWC23)
          Length = 273

 Score = 51.6 bits (122), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 46/71 (64%), Gaps = 10/71 (14%)

Query: 7  LYDLLGVSSSASD-------AEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILS 56
          LY LL VS S+ +       A+++  +R+ AL+YHPDK   DT+   KF  + +A++ILS
Sbjct: 16 LYALLEVSISSPEELEAVDAAQLRAQFRRLALRYHPDKRRDDTQQNDKFVSVQKAYDILS 75

Query: 57 DSNKRSVYDQY 67
          +S+ R+ Y+++
Sbjct: 76 NSSLRATYNRW 86

>KLLA0D06402g Chr4 (547385..549280) [1896 bp, 631 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 631

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 40/66 (60%), Gaps = 8/66 (12%)

Query: 8   YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTG--------DTEKFKEISEAFEILSDSN 59
           Y +LGV  SA+  ++++ Y +   K+HPDK           + EK  EI+EA+EILSD +
Sbjct: 530 YKILGVDKSATPKDVRRSYLQLTKKFHPDKQKNLNDEQRQKNEEKMAEINEAYEILSDDD 589

Query: 60  KRSVYD 65
           KR+ YD
Sbjct: 590 KRTKYD 595

>TPHA0I01110 Chr9 (259489..261489) [2001 bp, 666 aa] {ON} Anc_1.297
           YJL073W
          Length = 666

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 37/67 (55%), Gaps = 8/67 (11%)

Query: 7   LYDLLGVSSSASDAEIKKGYRKAALKYHPDK--------PTGDTEKFKEISEAFEILSDS 58
            Y +L + +SA+D EI+K Y     KYHPDK           +  K   I+EA+EILSD 
Sbjct: 561 FYKVLSIPTSATDKEIRKAYLLLTKKYHPDKQGQLSPKQQAKNHAKMIAINEAYEILSDE 620

Query: 59  NKRSVYD 65
           NKR  YD
Sbjct: 621 NKRRDYD 627

>Kwal_26.9495 s26 (1242662..1243948) [1287 bp, 428 aa] {ON} YGR285C
           (ZUO1) - Zuotin, putative Z-DNA binding protein [contig
           73] FULL
          Length = 428

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 47/77 (61%), Gaps = 8/77 (10%)

Query: 3   KETKLYDLLGVSS---SASDAEIKKGYRKAALKYHPDK--PTGDTEK---FKEISEAFEI 54
           K   LY  +G+S     A++A+I K +RK  LK+HPDK   +G  E+   FK I +A+E 
Sbjct: 93  KTADLYAAMGLSKLRYRATEAQIIKAHRKQVLKHHPDKKSASGGLEQDGFFKIIQKAYET 152

Query: 55  LSDSNKRSVYDQYGLDA 71
           L+DSNKR+ YD    +A
Sbjct: 153 LTDSNKRAQYDSCDSNA 169

>Skud_10.169 Chr10 complement(313783..315717) [1935 bp, 644 aa] {ON}
           YJL073W (REAL)
          Length = 644

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 39/75 (52%), Gaps = 8/75 (10%)

Query: 8   YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD--------TEKFKEISEAFEILSDSN 59
           Y  LGV+ SA+  EI+K Y     KYHPDK   +         E   +I+EA+E LSD N
Sbjct: 540 YKTLGVTPSATSKEIRKAYLNLTKKYHPDKIKANHNDKKESIHETMSQINEAYEALSDDN 599

Query: 60  KRSVYDQYGLDAARN 74
           KR  YD    +  RN
Sbjct: 600 KRKEYDLSRSNPHRN 614

>Kwal_14.2452 s14 (763303..765126) [1824 bp, 607 aa] {ON} YJL073W
           (JEM1) - ER chaperone [contig 224] FULL
          Length = 607

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 36/66 (54%), Gaps = 8/66 (12%)

Query: 8   YDLLGVSSSASDAEIKKGYRKAALKYHPDKP--------TGDTEKFKEISEAFEILSDSN 59
           Y +LGV   A+  +I+K Y     KYHPDK           + EK  EI+EA+EILSD  
Sbjct: 507 YKVLGVPQQATGKDIRKSYLSMTRKYHPDKQGQLSEAQKIKNQEKMSEINEAYEILSDEG 566

Query: 60  KRSVYD 65
           KR  YD
Sbjct: 567 KRKEYD 572

>Kwal_26.8879 s26 complement(988264..990234) [1971 bp, 656 aa] {ON}
           YOR254C (SEC63) - ER protein translocation subcomplex
           subunit [contig 68] FULL
          Length = 656

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 43/70 (61%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILSDS 58
           Y LL VS+S++D EI+  YRK ++K+HPDK + D          E++  I++A++ L+D 
Sbjct: 119 YALLDVSASSTDREIRSAYRKLSVKFHPDKLSKDLSANERSILEEQYVMITKAYKALTDE 178

Query: 59  NKRSVYDQYG 68
             R  Y +YG
Sbjct: 179 VTRENYLKYG 188

>TBLA0C07160 Chr3 complement(1737406..1738698) [1293 bp, 430 aa]
           {ON} Anc_5.4 YGR285C
          Length = 430

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 42/78 (53%), Gaps = 9/78 (11%)

Query: 3   KETKLYDLLGVSS---SASDAEIKKGYRKAALKYHPDKPTGDTEK------FKEISEAFE 53
           K   LY  +G+S     A+D ++ K +RK  LKYHPDK + +         FK I +AFE
Sbjct: 94  KTADLYAAMGLSKLRYRANDTQVIKAHRKQVLKYHPDKTSAEGGSLDQDGIFKIIQKAFE 153

Query: 54  ILSDSNKRSVYDQYGLDA 71
            L+DS KR+ YD     A
Sbjct: 154 TLTDSTKRAQYDSCDFQA 171

>NDAI0B00200 Chr2 (25694..27478) [1785 bp, 594 aa] {ON} Anc_1.185
          Length = 594

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 38/67 (56%), Gaps = 2/67 (2%)

Query: 2  VKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDT--EKFKEISEAFEILSDSN 59
          + ET  Y +LG+   A+D EI+K Y K A K HPDK   DT  E FK +  A  IL+D  
Sbjct: 14 LDETTYYSILGLHPQATDNEIRKSYMKFARKLHPDKSKSDTCAELFKLVVHAHSILTDKE 73

Query: 60 KRSVYDQ 66
           +  YD+
Sbjct: 74 LKLEYDR 80

>YGR285C Chr7 complement(1061852..1063153) [1302 bp, 433 aa] {ON}
           ZUO1Ribosome-associated chaperone, functions in ribosome
           biogenesis and, in partnership with Ssz1p and SSb1/2, as
           a chaperone for nascent polypeptide chains; contains a
           DnaJ domain and functions as a J-protein partner for
           Ssb1p and Ssb2p
          Length = 433

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 45/72 (62%), Gaps = 9/72 (12%)

Query: 3   KETKLYDLLGVSS---SASDAEIKKGYRKAALKYHPDKPT---GDTEK---FKEISEAFE 53
           K   LY  +G+S     A++++I K +RK  +KYHPDK +   G  ++   FK I +AFE
Sbjct: 94  KTADLYAAMGLSKLRFRATESQIIKAHRKQVVKYHPDKQSAAGGSLDQDGFFKIIQKAFE 153

Query: 54  ILSDSNKRSVYD 65
            L+DSNKR+ YD
Sbjct: 154 TLTDSNKRAQYD 165

>Kpol_1027.13 s1027 complement(27738..29663) [1926 bp, 641 aa] {ON}
           complement(27738..29663) [1926 nt, 642 aa]
          Length = 641

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/66 (43%), Positives = 39/66 (59%), Gaps = 8/66 (12%)

Query: 8   YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTEKFKE--------ISEAFEILSDSN 59
           Y +LG+S +AS  EI+K Y     KYHPDK    +EK +E        ++EA+EILSD  
Sbjct: 524 YKVLGISKAASSKEIRKAYLDLTKKYHPDKQGQLSEKEQEKIHEKMSQVNEAYEILSDEG 583

Query: 60  KRSVYD 65
           K+  YD
Sbjct: 584 KKRDYD 589

>KAFR0A01620 Chr1 (331073..333070) [1998 bp, 665 aa] {ON} Anc_1.297
           YJL073W
          Length = 665

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 38/66 (57%), Gaps = 8/66 (12%)

Query: 8   YDLLGVSSSASDAEIKKGYRKAALKYHPDK--------PTGDTEKFKEISEAFEILSDSN 59
           Y +LG+S  A+  +I+K Y +   +YHPDK           + EK  EI+EA+E LSD  
Sbjct: 561 YKILGISKEATSKDIRKAYLQLTKRYHPDKQGHLSESEQKKNHEKMSEINEAYETLSDEA 620

Query: 60  KRSVYD 65
           K+S YD
Sbjct: 621 KKSEYD 626

>NCAS0G02850 Chr7 (522548..524032) [1485 bp, 494 aa] {ON}
          Anc_2.218
          Length = 494

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/72 (45%), Positives = 49/72 (68%), Gaps = 3/72 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTE---KFKEISEAFEILSD 57
          MV++TKLY+ L V  +A+  +IKK Y+K ALKYHPDK     +   KF+ + +A+EIL+D
Sbjct: 1  MVRDTKLYETLNVPITATTLDIKKAYKKLALKYHPDKNNHSEDSKTKFQAVCQAYEILND 60

Query: 58 SNKRSVYDQYGL 69
             R++YD  G+
Sbjct: 61 KQSRAIYDALGI 72

>Smik_10.168 Chr10 (294947..296896) [1950 bp, 649 aa] {ON} YJL073W
           (REAL)
          Length = 649

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 40/75 (53%), Gaps = 8/75 (10%)

Query: 8   YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD--------TEKFKEISEAFEILSDSN 59
           Y +LGVS +A+  EI+K Y     KYHPDK   +         E   +I+EA+E LSD +
Sbjct: 544 YKILGVSPNANSKEIRKAYLNLTKKYHPDKIKANHNDKKESIHETMSQINEAYETLSDED 603

Query: 60  KRSVYDQYGLDAARN 74
           KR  YD    +  RN
Sbjct: 604 KRKEYDLSKSNPRRN 618

>KLTH0D11770g Chr4 complement(961180..963138) [1959 bp, 652 aa] {ON}
           similar to uniprot|P14906 Saccharomyces cerevisiae
           YOR254C SEC63 Essential subunit of Sec63 complex (Sec63p
           Sec62p Sec66p and Sec72p) with Sec61 complex Kar2p/BiP
           and Lhs1p forms a channel competent for SRP-dependent
           and post- translational SRP-independent protein
           targeting and import into the ER
          Length = 652

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 43/70 (61%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILSDS 58
           Y LL +S+S++D EI+  YRK ++K+HPDK + D          E++  I++A++ L+D 
Sbjct: 117 YALLDISASSTDREIRSAYRKLSVKFHPDKLSKDLSADERTVLEEQYVMITKAYKALTDE 176

Query: 59  NKRSVYDQYG 68
             R  Y +YG
Sbjct: 177 ITRENYLRYG 186

>Suva_12.185 Chr12 (290829..291335) [507 bp, 168 aa] {ON} YJR097W
          (REAL)
          Length = 168

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 40/69 (57%), Gaps = 6/69 (8%)

Query: 8  YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDTEK------FKEISEAFEILSDSNKR 61
          Y++L + S A+  EIKK YR   L  HPDK T +T          +I +A++ILS++ KR
Sbjct: 10 YEILRIPSDATQEEIKKAYRDRLLNTHPDKLTKNTNNRVNSVTINKIQDAYKILSNNQKR 69

Query: 62 SVYDQYGLD 70
            YD+  L+
Sbjct: 70 GEYDKTILE 78

>TPHA0G01480 Chr7 (304449..306431) [1983 bp, 660 aa] {ON} Anc_8.698
           YOR254C
          Length = 660

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 42/70 (60%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILSDS 58
           Y++LGV+ S+++ EIKK YR  +LK+HPDK   +          E F +IS+A+E L++ 
Sbjct: 123 YEILGVTVSSTEKEIKKAYRNLSLKFHPDKLDRNLSEKERLSMEEIFVQISKAYEALTNP 182

Query: 59  NKRSVYDQYG 68
             +  Y  YG
Sbjct: 183 ATKENYLLYG 192

>TPHA0A05650 Chr1 complement(1281376..1282677) [1302 bp, 433 aa]
           {ON} Anc_5.4 YGR285C
          Length = 433

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 42/78 (53%), Gaps = 9/78 (11%)

Query: 3   KETKLYDLLGVSS---SASDAEIKKGYRKAALKYHPDKPTGDTEK------FKEISEAFE 53
           K   LY  +G+S     A++++I K +RK  LKYHPDK +           FK I +AFE
Sbjct: 94  KTADLYAAMGLSKLRYRATESQIIKAHRKQVLKYHPDKKSASGASLDQDGFFKIIQKAFE 153

Query: 54  ILSDSNKRSVYDQYGLDA 71
            L+D  KRS YD    +A
Sbjct: 154 TLTDPTKRSQYDSCDFEA 171

>KLLA0F03124g Chr6 complement(289514..290815) [1302 bp, 433 aa] {ON}
           highly similar to uniprot|P32527 Saccharomyces
           cerevisiae YGR285C ZUO1 Cytosolic ribosome-associated
           chaperone contains a DnaJ domain together with Ssz1p
           acts as a chaperone for nascent polypeptide chains
          Length = 433

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 42/78 (53%), Gaps = 9/78 (11%)

Query: 3   KETKLYDLLGVSS---SASDAEIKKGYRKAALKYHPDKPTGDTEK------FKEISEAFE 53
           K   LY  +G+S     A++ +I K +RK  LKYHPDK +           FK I +A+E
Sbjct: 94  KTADLYAAMGLSKLRYRATNQQIIKAHRKQVLKYHPDKTSASGASLDQDGFFKIIQKAYE 153

Query: 54  ILSDSNKRSVYDQYGLDA 71
            L+DSNKR  YD    +A
Sbjct: 154 TLTDSNKRPQYDSCDFEA 171

>SAKL0H05984g Chr8 (530194..532170) [1977 bp, 658 aa] {ON} similar
           to uniprot|P14906 Saccharomyces cerevisiae YOR254C SEC63
           Essential subunit of Sec63 complex (Sec63p Sec62p Sec66p
           and Sec72p) with Sec61 complex Kar2p/BiP and Lhs1p forms
           a channel competent for SRP-dependent and post-
           translational SRP-independent protein targeting and
           import into the ER
          Length = 658

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 43/70 (61%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILSDS 58
           Y LLGV++SA+D E++  YRK ++K+HPDK   D          E++  I++A++ L+D 
Sbjct: 118 YTLLGVATSATDKEVRSAYRKLSVKFHPDKLAKDLTQEQRSELEEQYVLITKAYKALTDE 177

Query: 59  NKRSVYDQYG 68
             +  Y ++G
Sbjct: 178 ITKENYLKFG 187

>Kwal_47.17957 s47 (626415..627851) [1437 bp, 478 aa] {ON} YFL016C
           (MDJ1) - DnaJ homolog involved in mitochondrial
           biogenesis and protein folding [contig 202] FULL
          Length = 478

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 34/63 (53%), Positives = 42/63 (66%), Gaps = 2/63 (3%)

Query: 8   YDLLGVSSSASDAEIKKGYRKAALKYHPD--KPTGDTEKFKEISEAFEILSDSNKRSVYD 65
           Y  LGVS+SA+ +EIKK Y K A KYHPD  K     +KF ++  A+EILSD  KR  +D
Sbjct: 41  YSTLGVSNSATSSEIKKAYYKLAKKYHPDINKAADAQKKFHDLQNAYEILSDDCKRQQWD 100

Query: 66  QYG 68
           QYG
Sbjct: 101 QYG 103

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 61/130 (46%), Gaps = 12/130 (9%)

Query: 217 QIDINLKPGWKEGTKLTYKNHGDY-----NPSTG-----GRKTLQFIIKEKKHPLYK-RD 265
           ++ ++L  G ++G  +     G Y     +P+        R  L   I+  K P ++ ++
Sbjct: 280 ELKVDLPHGLQDGDVIRISGKGSYPNIAVDPAMKDTVRLSRGDLLLRIRVDKDPRFQIKN 339

Query: 266 GDNIIYTLPLTFKESLLGFSKTLQTLDGRTLPLSRSQPVQPTEENTYPGQGMPISKNPGQ 325
             +I +T  +    + LG   T+ T+DG  + L  S   Q  +  + P +G+P   + G 
Sbjct: 340 KYDIWFTQDIPITTAALGGVVTIPTVDGEQVRLKVSPGTQHHDVVSIPQKGVP-RGSFGT 398

Query: 326 RGNLIIKYKI 335
           RG++ ++Y++
Sbjct: 399 RGDMKVQYRV 408

>NDAI0G03280 Chr7 complement(769822..771480) [1659 bp, 552 aa] {ON}
           Anc_8.61
          Length = 552

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 44/66 (66%), Gaps = 2/66 (3%)

Query: 8   YDLLGVSSSASDAEIKKGYRKAALKYHPD--KPTGDTEKFKEISEAFEILSDSNKRSVYD 65
           Y +LGV++SAS +EIKK Y K A KYHPD  K     +KF ++  A+EILSD NKR  YD
Sbjct: 81  YSVLGVNNSASTSEIKKAYYKLAKKYHPDINKQPDAEKKFHDLQNAYEILSDENKRKQYD 140

Query: 66  QYGLDA 71
            +G  A
Sbjct: 141 TFGPSA 146

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 60/133 (45%), Gaps = 16/133 (12%)

Query: 218 IDINLKPGWKEGTKLTYKNHGDYNPSTGG-------------RKTLQFIIKEKKHPLYK- 263
           ID+NL  G ++G  +     G+Y P TG              R  L   ++  K P +  
Sbjct: 323 IDVNLPNGLQDGDVIRVPGQGNY-PQTGASIDPAMMNSIKLSRGDLLVRVRVNKDPNFSI 381

Query: 264 RDGDNIIYTLPLTFKESLLGFSKTLQTLDGRTLPLSRSQPVQPTEENTYPGQGMPISK-N 322
           RD  +I +T  +    ++LG    + T+DG  + L  S   +  +  + P  G+P S  N
Sbjct: 382 RDKYDIWFTKQIPITTAILGGVVKIPTVDGTQIRLKVSPGTKHDQIISIPNLGVPRSSIN 441

Query: 323 PGQRGNLIIKYKI 335
              RGN+ ++YKI
Sbjct: 442 KDNRGNMKVQYKI 454

>Kwal_33.13533 s33 (271635..272120) [486 bp, 161 aa] {ON} YJR097W
          - Hypothetical ORF [contig 116] FULL
          Length = 161

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 38/69 (55%), Gaps = 3/69 (4%)

Query: 1  MVKETKLYDLLGVSSSASDAEIKKGYRKAALKYHPD---KPTGDTEKFKEISEAFEILSD 57
          MV     Y++LGV +  ++ +IKK Y+   L  HPD   K  G+    +EI EA+ +L +
Sbjct: 1  MVNNRSFYEILGVEADCNEVDIKKAYKAKLLSTHPDKVGKDVGNKVLIEEIKEAYRVLIE 60

Query: 58 SNKRSVYDQ 66
          S  R  YD+
Sbjct: 61 SPSREKYDK 69

>TDEL0C00870 Chr3 complement(140420..141832) [1413 bp, 470 aa] {ON}
           Anc_8.61 YFL016C
          Length = 470

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 33/69 (47%), Positives = 42/69 (60%), Gaps = 2/69 (2%)

Query: 8   YDLLGVSSSASDAEIKKGYRKAALKYHPD--KPTGDTEKFKEISEAFEILSDSNKRSVYD 65
           Y+ LGV  +AS +EIKK Y K A K+HPD  K      KF ++  A+EILSD  K+  YD
Sbjct: 38  YETLGVGKNASSSEIKKAYYKLAKKFHPDINKEPNAEAKFHDLQNAYEILSDDTKKQQYD 97

Query: 66  QYGLDAARN 74
           Q+G  A  N
Sbjct: 98  QFGAAAFNN 106

>CAGL0H02827g Chr8 (261006..262976) [1971 bp, 656 aa] {ON} similar
           to uniprot|P40358 Saccharomyces cerevisiae YJL073w JEM
          Length = 656

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 37/67 (55%), Gaps = 9/67 (13%)

Query: 8   YDLLGVSSSASDAEIKKGYRKAALKYHPDKP---------TGDTEKFKEISEAFEILSDS 58
           Y +LG+   ASD EI+K Y     KYHPDK            + EK  EI+EA+E+L+D 
Sbjct: 543 YQILGIKPEASDKEIRKAYLSLTKKYHPDKQGKQLSEEEEKKNDEKMSEINEAYEVLNDE 602

Query: 59  NKRSVYD 65
            KR  YD
Sbjct: 603 EKRKEYD 609

>SAKL0C05456g Chr3 complement(519700..521451) [1752 bp, 583 aa]
          {ON} similar to uniprot|Q757X4 Ashbya gossypii AEL112C
          AEL112Cp and some similarites with YJL162C
          uniprot|P46997 Saccharomyces cerevisiae YJL162C JJJ2
          Protein that may function as a cochaperone as suggested
          by the presence of a DnaJ-like domain
          Length = 583

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 39/65 (60%), Gaps = 2/65 (3%)

Query: 4  ETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILSDSNKR 61
          +T  Y +LG+   A+DA+I+K Y K A + HPDK   +   E FK ++ A  IL+D  KR
Sbjct: 10 QTTYYSVLGLPFDATDAQIRKSYMKLARELHPDKSKSEVAAELFKVVAHAHSILTDREKR 69

Query: 62 SVYDQ 66
            YD+
Sbjct: 70 LKYDR 74

>NCAS0I02830 Chr9 (526309..527784) [1476 bp, 491 aa] {ON}
          Anc_1.185 YJL162C
          Length = 491

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 37/64 (57%), Gaps = 2/64 (3%)

Query: 4  ETKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDT--EKFKEISEAFEILSDSNKR 61
          ET  Y +LG++  A+D EI+K Y K A + HPDK   D+  E FK +  A  IL+D   +
Sbjct: 5  ETTYYSILGLTPKATDNEIRKSYMKLARQLHPDKSKSDSCAELFKLVVHAHSILTDEETK 64

Query: 62 SVYD 65
            YD
Sbjct: 65 RKYD 68

>KNAG0C02450 Chr3 complement(477576..479210) [1635 bp, 544 aa]
          {ON} Anc_1.185 YJL162C
          Length = 544

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 38/64 (59%), Gaps = 2/64 (3%)

Query: 5  TKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILSDSNKRS 62
          T  Y LLGV   A++ EI K YRK A+K HPDK   D   E FK +  A  +L++  +R+
Sbjct: 8  TTHYSLLGVHFDATNEEISKSYRKLAMKLHPDKSKSDKCEELFKLVVHAHSVLTNGEERA 67

Query: 63 VYDQ 66
           Y++
Sbjct: 68 KYNK 71

>Smik_16.23 Chr16 (34403..35704) [1302 bp, 433 aa] {ON} YGR285C
           (REAL)
          Length = 433

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 44/72 (61%), Gaps = 9/72 (12%)

Query: 3   KETKLYDLLGVSS---SASDAEIKKGYRKAALKYHPDKPT---GDTEK---FKEISEAFE 53
           K   LY  +G+S     A++ +I K +RK  +KYHPDK +   G  ++   FK I +AFE
Sbjct: 94  KTADLYAAMGLSKLRFRATENQIIKAHRKQVVKYHPDKQSAAGGSLDQDGFFKIIQKAFE 153

Query: 54  ILSDSNKRSVYD 65
            L+DSNKR+ YD
Sbjct: 154 TLTDSNKRAQYD 165

>Ecym_2374 Chr2 (727001..728986) [1986 bp, 661 aa] {ON} similar to
           Ashbya gossypii AAL103W
          Length = 661

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 44/70 (62%), Gaps = 9/70 (12%)

Query: 8   YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGDT---------EKFKEISEAFEILSDS 58
           Y+LLG+ +SA++ E++  YRK ++K+HPDK + D          E++  I++A++ L++ 
Sbjct: 117 YELLGIGTSATEREVRSSYRKLSVKFHPDKLSKDLSQEERLQLEEQYVLITKAYKALTEE 176

Query: 59  NKRSVYDQYG 68
             R  Y +YG
Sbjct: 177 VTRENYLKYG 186

>Skud_7.618 Chr7 complement(1036280..1037581) [1302 bp, 433 aa] {ON}
           YGR285C (REAL)
          Length = 433

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 44/72 (61%), Gaps = 9/72 (12%)

Query: 3   KETKLYDLLGVSS---SASDAEIKKGYRKAALKYHPDKPT---GDTEK---FKEISEAFE 53
           K   LY  +G+S     A++ +I K +RK  +KYHPDK +   G  ++   FK I +AFE
Sbjct: 94  KTADLYAAMGLSKLRFRATENQIIKAHRKQVVKYHPDKQSAAGGSLDQDGFFKIIQKAFE 153

Query: 54  ILSDSNKRSVYD 65
            L+DSNKR+ YD
Sbjct: 154 TLTDSNKRAQYD 165

>ZYRO0F03652g Chr6 complement(306692..308080) [1389 bp, 462 aa]
          {ON} similar to uniprot|Q752R6 Ashbya gossypii AFR507W
          AFR507Wp and some similarites with YFL016C
          uniprot|P35191 Saccharomyces cerevisiae YFL016C MDJ1
          Protein involved in folding of mitochondrially
          synthesized proteins in the mitochondrial matrix
          localizes to the mitochondrial inner membrane member of
          the DnaJ family of molecular chaperones
          Length = 462

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 34/60 (56%), Positives = 42/60 (70%), Gaps = 2/60 (3%)

Query: 8  YDLLGVSSSASDAEIKKGYRKAALKYHPD--KPTGDTEKFKEISEAFEILSDSNKRSVYD 65
          YD LGV  SAS +EIKK Y K A KYHPD  K  G  +KF ++  A+EILSD++K+S YD
Sbjct: 35 YDTLGVGKSASPSEIKKAYYKLAKKYHPDINKEQGAGDKFHDLQNAYEILSDADKKSQYD 94

>KLTH0F02596g Chr6 complement(224401..225249) [849 bp, 282 aa]
          {ON} weakly similar to uniprot|P52868 Saccharomyces
          cerevisiae YGL128C
          Length = 282

 Score = 48.9 bits (115), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 43/73 (58%), Gaps = 10/73 (13%)

Query: 7  LYDLLGVS-------SSASDAEIKKGYRKAALKYHPDK---PTGDTEKFKEISEAFEILS 56
          LY+LLG+        +  S  +I++ +R+ ALK+HPDK    +   +KF ++  A +ILS
Sbjct: 13 LYELLGIVVEGPEDLAKLSPLQIRRNFRQQALKHHPDKNRQVSDSRQKFHQLDIAAKILS 72

Query: 57 DSNKRSVYDQYGL 69
          D   RS YDQ+ +
Sbjct: 73 DPKLRSAYDQWFI 85

>Suva_6.148 Chr6 complement(246008..247936) [1929 bp, 642 aa] {ON}
           YJL073W (REAL)
          Length = 642

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 36/66 (54%), Gaps = 8/66 (12%)

Query: 8   YDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD--------TEKFKEISEAFEILSDSN 59
           Y +LGV+  A+  EI+K Y     KYHPDK   +         E   +I+EA+E LSD +
Sbjct: 537 YKVLGVAPGATSKEIRKAYLNLTKKYHPDKIKANHNDKEETIHETMSQINEAYETLSDDD 596

Query: 60  KRSVYD 65
           KR  YD
Sbjct: 597 KRKEYD 602

>NCAS0E04190 Chr5 complement(825586..826881) [1296 bp, 431 aa] {ON}
           Anc_5.4 YGR285C
          Length = 431

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 43/72 (59%), Gaps = 9/72 (12%)

Query: 3   KETKLYDLLGVSS---SASDAEIKKGYRKAALKYHPDKPTGD---TEK---FKEISEAFE 53
           K   LY  +G+S     A++ +I K +RK  +KYHPDK +      E+   FK I +AFE
Sbjct: 94  KTADLYAAMGLSQVRFKATENQIIKAHRKQVVKYHPDKQSAAGVGLEQDGFFKIIQKAFE 153

Query: 54  ILSDSNKRSVYD 65
            L+DSNKR+ YD
Sbjct: 154 TLTDSNKRAQYD 165

>KNAG0E01220 Chr5 (236127..237431) [1305 bp, 434 aa] {ON} Anc_5.4
           YGR285C
          Length = 434

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 40/71 (56%), Gaps = 8/71 (11%)

Query: 3   KETKLYDLLGVSS---SASDAEIKKGYRKAALKYHPDKPT--GDTEK---FKEISEAFEI 54
           K   LY  +G+S     A+D +I K +RK  +KYHPDK +  G  E    FK I +AFE 
Sbjct: 95  KTADLYAAMGLSQLRYRATDVQIVKAHRKQVVKYHPDKQSAAGAAENDAFFKIIQKAFET 154

Query: 55  LSDSNKRSVYD 65
           L+D  KR  YD
Sbjct: 155 LTDRTKRMQYD 165

>SAKL0D06226g Chr4 (510407..512254) [1848 bp, 615 aa] {ON} weakly
           similar to uniprot|P40358 Saccharomyces cerevisiae
           YJL073W JEM1 DnaJ-like chaperone required for nuclear
           membrane fusion during mating localizes to the ER
           membrane exhibits genetic interactions with KAR2
          Length = 615

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 27/66 (40%), Positives = 37/66 (56%), Gaps = 8/66 (12%)

Query: 8   YDLLGVSSSASDAEIKKGYRKAALKYHPDKP--------TGDTEKFKEISEAFEILSDSN 59
           Y +L V  +A+  +I+K Y +   KYHPDK           + EK   I+EA+EILSD +
Sbjct: 509 YKILEVPKNANTKDIRKAYLQLTKKYHPDKQQQLSENEQVANEEKMSAINEAYEILSDES 568

Query: 60  KRSVYD 65
           KR  YD
Sbjct: 569 KRKEYD 574

>Smik_10.68 Chr10 complement(111694..113376) [1683 bp, 560 aa]
          {ON} YJL162C (REAL)
          Length = 560

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 38/64 (59%), Gaps = 2/64 (3%)

Query: 5  TKLYDLLGVSSSASDAEIKKGYRKAALKYHPDKPTGD--TEKFKEISEAFEILSDSNKRS 62
          T  Y +LG++S+A+ +E+ K Y K A   HPDK   D   E FK +  A  IL+D N++ 
Sbjct: 12 TTYYSILGLASNATSSEVHKSYLKLARLLHPDKTKSDKCEELFKAVVHAHSILTDENQKL 71

Query: 63 VYDQ 66
           YD+
Sbjct: 72 RYDR 75

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.133    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,320,254
Number of extensions: 1263186
Number of successful extensions: 3321
Number of sequences better than 10.0: 370
Number of HSP's gapped: 3032
Number of HSP's successfully gapped: 461
Length of query: 353
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 242
Effective length of database: 40,753,473
Effective search space: 9862340466
Effective search space used: 9862340466
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 66 (30.0 bits)