Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0B069902.293ON53653626700.0
NDAI0B035202.293ON50153611791e-157
Suva_9.1092.293ON49153011721e-156
TDEL0G022302.293ON48853511671e-155
Smik_9.892.293ON49153011661e-155
Skud_9.832.293ON49153011631e-154
YIL090W (ICE2)2.293ON49153011601e-154
ZYRO0A02024g2.293ON48652811601e-154
KNAG0A053902.293ON49752711471e-152
SAKL0E07524g2.293ON47953011251e-149
NCAS0B062202.293ON48652811221e-148
KAFR0J013302.293ON49153511221e-148
CAGL0D04202g2.293ON49954311121e-147
Kpol_1003.422.293ON49053510531e-138
KLTH0G10516g2.293ON47453210131e-132
Kwal_27.115002.293ON47553310101e-132
Ecym_33322.293ON5135389451e-121
TPHA0C034402.293ON5795589361e-119
ADL208W2.293ON5025469241e-118
TBLA0B059802.293ON4935449011e-115
KLLA0E08207g2.293ON4865358881e-113
Ecym_25823.553ON296137820.16
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0B06990
         (536 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0B06990 Chr2 (1649581..1651191) [1611 bp, 536 aa] {ON}           1033   0.0  
NDAI0B03520 Chr2 complement(885459..886964) [1506 bp, 501 aa] {O...   458   e-157
Suva_9.109 Chr9 (187818..189293) [1476 bp, 491 aa] {ON} YIL090W ...   456   e-156
TDEL0G02230 Chr7 (437121..438587) [1467 bp, 488 aa] {ON} Anc_2.2...   454   e-155
Smik_9.89 Chr9 (172734..174209) [1476 bp, 491 aa] {ON} YIL090W (...   453   e-155
Skud_9.83 Chr9 (170322..171797) [1476 bp, 491 aa] {ON} YIL090W (...   452   e-154
YIL090W Chr9 (193595..195070) [1476 bp, 491 aa] {ON}  ICE2Integr...   451   e-154
ZYRO0A02024g Chr1 (167059..168519) [1461 bp, 486 aa] {ON} simila...   451   e-154
KNAG0A05390 Chr1 complement(793701..795194) [1494 bp, 497 aa] {O...   446   e-152
SAKL0E07524g Chr5 complement(609285..610724) [1440 bp, 479 aa] {...   437   e-149
NCAS0B06220 Chr2 complement(1173970..1175430) [1461 bp, 486 aa] ...   436   e-148
KAFR0J01330 Chr10 complement(243571..245046) [1476 bp, 491 aa] {...   436   e-148
CAGL0D04202g Chr4 (414049..415548) [1500 bp, 499 aa] {ON} simila...   432   e-147
Kpol_1003.42 s1003 (100704..102176) [1473 bp, 490 aa] {ON} (1007...   410   e-138
KLTH0G10516g Chr7 (889468..890892) [1425 bp, 474 aa] {ON} simila...   394   e-132
Kwal_27.11500 s27 complement(825779..827206) [1428 bp, 475 aa] {...   393   e-132
Ecym_3332 Chr3 (634314..635855) [1542 bp, 513 aa] {ON} similar t...   368   e-121
TPHA0C03440 Chr3 (752685..754424) [1740 bp, 579 aa] {ON} Anc_2.2...   365   e-119
ADL208W Chr4 (337118..338626) [1509 bp, 502 aa] {ON} Syntenic ho...   360   e-118
TBLA0B05980 Chr2 (1412745..1414226) [1482 bp, 493 aa] {ON} Anc_2...   351   e-115
KLLA0E08207g Chr5 complement(740213..741673) [1461 bp, 486 aa] {...   346   e-113
Ecym_2582 Chr2 complement(1134823..1135713) [891 bp, 296 aa] {ON...    36   0.16 

>TBLA0B06990 Chr2 (1649581..1651191) [1611 bp, 536 aa] {ON} 
          Length = 536

 Score = 1033 bits (2670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/536 (95%), Positives = 513/536 (95%)

Query: 1   MPWVVKSVKQSIRMLWGCFYLISVLITIPSAFKIGGLYCGLSFTMTLFHLYFLSTTMHLI 60
           MPWVVKSVKQSIRMLWGCFYLISVLITIPSAFKIGGLYCGLSFTMTLFHLYFLSTTMHLI
Sbjct: 1   MPWVVKSVKQSIRMLWGCFYLISVLITIPSAFKIGGLYCGLSFTMTLFHLYFLSTTMHLI 60

Query: 61  AKRTLNNFYILLSTLVYYLQHIVIASLLYIFITIFSDGNLNEILSNNKTDQLPSLLYYIK 120
           AKRTLNNFYILLSTLVYYLQHIVIASLLYIFITIFSDGNLNEILSNNKTDQLPSLLYYIK
Sbjct: 61  AKRTLNNFYILLSTLVYYLQHIVIASLLYIFITIFSDGNLNEILSNNKTDQLPSLLYYIK 120

Query: 121 NDTSKSVSQNFHXXXXXXXXXXAVQPWNYLLSHSTPFFTLLEGFFTILGIQAIGETYCWX 180
           NDTSKSVSQNFH          AVQPWNYLLSHSTPFFTLLEGFFTILGIQAIGETYCW 
Sbjct: 121 NDTSKSVSQNFHYLLFYYYYYYAVQPWNYLLSHSTPFFTLLEGFFTILGIQAIGETYCWL 180

Query: 181 XXXXXXXXXXXXTWLISVGVIFTAIHFLYKIYEFQVWELSIQTASLLGVTMSLVLTVGIF 240
                       TWLISVGVIFTAIHFLYKIYEFQVWELSIQTASLLGVTMSLVLTVGIF
Sbjct: 181 LLKKQKKIFKLLTWLISVGVIFTAIHFLYKIYEFQVWELSIQTASLLGVTMSLVLTVGIF 240

Query: 241 GIFSTNGSLIESSLFLGYIIRCFYEISPELSTSATTEILDNIKEAWQNHQGSITVTEHIL 300
           GIFSTNGSLIESSLFLGYIIRCFYEISPELSTSATTEILDNIKEAWQNHQGSITVTEHIL
Sbjct: 241 GIFSTNGSLIESSLFLGYIIRCFYEISPELSTSATTEILDNIKEAWQNHQGSITVTEHIL 300

Query: 301 FYYNNVLLKNINSSYLFNSNFSKSNDTSAKNRTLAEIQRSTNNYTLTDITKPSDLIHLIG 360
           FYYNNVLLKNINSSYLFNSNFSKSNDTSAKNRTLAEIQRSTNNYTLTDITKPSDLIHLIG
Sbjct: 301 FYYNNVLLKNINSSYLFNSNFSKSNDTSAKNRTLAEIQRSTNNYTLTDITKPSDLIHLIG 360

Query: 361 FKSIYQNWLIYATPIYELLKDFVLNIPTSLANLSQVTYKLAYDSVSPSIVINLCFRVLIF 420
           FKSIYQNWLIYATPIYELLKDFVLNIPTSLANLSQVTYKLAYDSVSPSIVINLCFRVLIF
Sbjct: 361 FKSIYQNWLIYATPIYELLKDFVLNIPTSLANLSQVTYKLAYDSVSPSIVINLCFRVLIF 420

Query: 421 YSATRIIPAVQRKNHLETKRSRNFLKAFYLFSPCIVIAMYTNLILQYSGELKNDLCIWGC 480
           YSATRIIPAVQRKNHLETKRSRNFLKAFYLFSPCIVIAMYTNLILQYSGELKNDLCIWGC
Sbjct: 421 YSATRIIPAVQRKNHLETKRSRNFLKAFYLFSPCIVIAMYTNLILQYSGELKNDLCIWGC 480

Query: 481 DIISKSISQRMSTINMDVGSDDTYPNREFIVNSWGFWNWCNIFCTIFIYGCELMGL 536
           DIISKSISQRMSTINMDVGSDDTYPNREFIVNSWGFWNWCNIFCTIFIYGCELMGL
Sbjct: 481 DIISKSISQRMSTINMDVGSDDTYPNREFIVNSWGFWNWCNIFCTIFIYGCELMGL 536

>NDAI0B03520 Chr2 complement(885459..886964) [1506 bp, 501 aa] {ON}
           Anc_2.293 YIL090W
          Length = 501

 Score =  458 bits (1179), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 257/536 (47%), Positives = 351/536 (65%), Gaps = 48/536 (8%)

Query: 4   VVKSVKQSIRMLWGCFYLISVLITIPSAFKIGGLYCGLSFTMTLFHLYFLSTTMHLIAKR 63
           +  S  + +R     FYL+  LI+IP +FKIGGL CGL+FT TLF +YFLSTT+ L+A++
Sbjct: 2   ISSSFMRGVRTFSAAFYLLFTLISIPISFKIGGLQCGLAFTATLFTIYFLSTTLSLLARK 61

Query: 64  TLNNFYILLSTLVYYLQHIVIASLLYIFITIFSDGNLNEILSNN--KTDQLPSLLYYIKN 121
             +NF I L+  +YY QH++IASLLY+F++ FS  +L   LS++  K D +  ++   +N
Sbjct: 62  YGSNFSIFLTGFLYYSQHLIIASLLYLFLSGFSHEDLTIPLSDDTQKVDIISDVVR--RN 119

Query: 122 DTSKSVSQNFHXXXXXXXXXXAVQPWNYLLSHSTPFFTLLEGFFTILGIQAIGETYCWXX 181
            +S + + N +           VQPW YLLS+STPFFTL EGFFTIL IQA+GET  W  
Sbjct: 120 LSSTNSNWNLYHNYYTFF----VQPWKYLLSYSTPFFTLSEGFFTILAIQAVGETNKWLV 175

Query: 182 XXXXXXXXXXXTWLISVGVIFTAIHFLYKIYEFQVWELSIQTASLLGVTMSLVLTVGIFG 241
                      + L S GVI  ++++LY+IY   +W+LSIQTASLLG T+SLV  +G++G
Sbjct: 176 NEINSNTWIISSLLTSGGVITASLYYLYRIYVTPIWQLSIQTASLLGFTLSLVGGLGLYG 235

Query: 242 IFSTNGSLIESSLFLGYIIRCFYEISPELSTSATTEILDNIKEAWQNHQGSITVTEHILF 301
           I +  GS+IESSLF  YI+RC YEISP+L+T+AT EIL+  KE WQ HQG++  T+++LF
Sbjct: 236 IVTEKGSVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEVWQRHQGNLPTTDNLLF 295

Query: 302 YYNNVLLKNINSSYLFNSNFSKSNDTSAKNRTLAEIQRSTN-NYTLTDITKPSDLIHLIG 360
           YYNN +L++I+   L+    SK N     N     +  S N N+  T ++K  DL+  I 
Sbjct: 296 YYNNFVLRHID--MLWELLVSKINQNDPNN----TLPSSFNINFLTTFLSK--DLLLRI- 346

Query: 361 FKSIYQNWLIYATPIYELLKDFVLNIPTSLANLSQVTYKLAYDSVSPSIVINLCFRVLIF 420
                        PI++L K+F +++P+S++ L  VTY++A +SVSP++VINLCFRVLIF
Sbjct: 347 -----------CKPIWKLFKNFTVSVPSSISELVLVTYQMARESVSPAVVINLCFRVLIF 395

Query: 421 YSATRIIPAVQRKNHLETKRSRNFLKAFYLFSPCIVIAMYTNLILQYSGELKNDLCIWGC 480
           YSATRIIPA+QR+N  E K+SR  +K  Y +SPC++IAMYT+LILQYSGELK DLC+WGC
Sbjct: 396 YSATRIIPALQRRNDSELKKSRRIMKILYWYSPCVLIAMYTHLILQYSGELKKDLCLWGC 455

Query: 481 DIISKSISQRMSTINMDVGSDDTYPNR-EFIVNSWGFWNWCNIFCTIFIYGCELMG 535
           ++                      PN+ E IV+SWGFWNWCNIF TI IY  EL G
Sbjct: 456 NL------------------KWLIPNQPELIVDSWGFWNWCNIFFTIIIYASELFG 493

>Suva_9.109 Chr9 (187818..189293) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  456 bits (1172), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 244/530 (46%), Positives = 340/530 (64%), Gaps = 47/530 (8%)

Query: 6   KSVKQSIRMLWGCFYLISVLITIPSAFKIGGLYCGLSFTMTLFHLYFLSTTMHLIAKRTL 65
           KS  QS R+   CFYL+  L++IP +FK+GGL CGLSFT+TLF LYF++TT++++A+R  
Sbjct: 6   KSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLARRNG 65

Query: 66  NNFYILLSTLVYYLQHIVIASLLYIFITIFSDGNLNEILSNNKTDQLPSLLYYIKNDTSK 125
              YI L++ +YY QH VIASLL++F++ FS+  L  +L  N++++  S L  +KN  + 
Sbjct: 66  GRLYIFLTSCLYYSQHFVIASLLFLFLSGFSNDELGNVL-KNRSNESESFLEALKNSLN- 123

Query: 126 SVSQNFHXXXXXXXXXXAVQPWNYLLSHSTPFFTLLEGFFTILGIQAIGETYCWXXXXXX 185
             S   +           VQPW ++L+ STPFFTL EGFFTIL IQA+GET  W      
Sbjct: 124 --SNQINYVLYYYYYRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLN 181

Query: 186 XXXXXXXTWLISVGVIFTAIHFLYKIYEFQVWELSIQTASLLGVTMSLVLTVGIFGIFST 245
                  + L S GVI  ++++LY+IY   +W LSIQTASLLG  +S+V  +G++GI S 
Sbjct: 182 SNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQ 241

Query: 246 NGSLIESSLFLGYIIRCFYEISPELSTSATTEILDNIKEAWQNHQGSITVTEHILFYYNN 305
            GS+IESSLF  YI+RC YEISP+L+T+AT EILD  K+ WQ HQ ++   +++L Y++N
Sbjct: 242 RGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHN 301

Query: 306 VLLKNINSSYLFNSNFSKSNDTSAKNRTLAEIQRSTNNYTLTDITKPSDLIHLIGFKSIY 365
           V+LK  N+  L+ S   +   T++                  D+ +   +I ++ F+ + 
Sbjct: 302 VILK--NAEVLWGSFIPRRRKTTS------------------DLHE--KIISILSFEKVS 339

Query: 366 QNWLIYATPIYELLKDFVLNIPTSLANLSQVTYKLAYDSVSPSIVINLCFRVLIFYSATR 425
               + + P +   K+F  ++P S+    QVT K+A +SVSP+IVINLCFRVL+FYSATR
Sbjct: 340 ----LISKPFWRFCKNFTFSVPLSINEFCQVTIKMASESVSPAIVINLCFRVLMFYSATR 395

Query: 426 IIPAVQRKNHLETKRSRNFLKAFYLFSPCIVIAMYTNLILQYSGELKNDLCIWGCDIISK 485
           IIPA+QRKN  + ++SR  +K  Y +SPCI+IAMYT+LILQYSGELK DLCIWGC     
Sbjct: 396 IIPALQRKNDKQLRKSRRIMKGLYWYSPCILIAMYTHLILQYSGELKKDLCIWGC----- 450

Query: 486 SISQRMSTINMDVGSDDTYPNREFIVNSWGFWNWCNIFCTIFIYGCELMG 535
             S++        G D      E IV+SWGFWNWCNIFCTI +Y  EL+G
Sbjct: 451 --SEKW------FGPDQP----EIIVDSWGFWNWCNIFCTILVYATELVG 488

>TDEL0G02230 Chr7 (437121..438587) [1467 bp, 488 aa] {ON} Anc_2.293
           YIL090W
          Length = 488

 Score =  454 bits (1167), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 250/535 (46%), Positives = 342/535 (63%), Gaps = 50/535 (9%)

Query: 1   MPWVVKSVKQSIRMLWGCFYLISVLITIPSAFKIGGLYCGLSFTMTLFHLYFLSTTMHLI 60
           M  + KS  Q  RM    FYL+S L+TIP +FK+GGLYCGLSFT+TLF+LY ++TT+ ++
Sbjct: 1   MTTISKSFLQGTRMALAGFYLLSTLVTIPISFKVGGLYCGLSFTVTLFNLYLITTTLSMV 60

Query: 61  AKRTLNNFYILLSTLVYYLQHIVIASLLYIFITIFSDGNLNEILSNNKTDQLPSLLYYIK 120
           A+   N  YI+ +T +YYLQH +IASLLY+F++ FS+  L ++L +    +  SL+  ++
Sbjct: 61  AQSYGNKCYIVGTTFIYYLQHFMIASLLYLFLSGFSNEELTKVLEDGSQPE-QSLVNVLR 119

Query: 121 NDTSKSVSQNFHXXXXXXXXXXAVQPWNYLLSHSTPFFTLLEGFFTILGIQAIGETYCWX 180
           N+     S +             VQPW  +L+HST FF L EGFFT+LGIQAIGET  W 
Sbjct: 120 NNV---FSNHSSWMLYYYYYRYVVQPWQSVLTHSTAFFALSEGFFTVLGIQAIGETNRWL 176

Query: 181 XXXXXXXXXXXXTWLISVGVIFTAIHFLYKIYEFQVWELSIQTASLLGVTMSLVLTVGIF 240
                       + L S GVI  ++++LY+IY   +W LS+QTASLLG T+S+V  +G+F
Sbjct: 177 LDEMNSNTWIIASLLTSGGVITASLYYLYRIYVTPIWNLSVQTASLLGFTLSIVCGIGLF 236

Query: 241 GIFSTNGSLIESSLFLGYIIRCFYEISPELSTSATTEILDNIKEAWQNHQGSITVTEHIL 300
           GI S NGS+IESSLF  YI+RC YEISP+L+T+AT EIL+ IK AWQ HQ +++ T ++L
Sbjct: 237 GIVSKNGSVIESSLFFAYIVRCIYEISPKLATTATDEILEVIKVAWQKHQKNLSTTNNLL 296

Query: 301 FYYNNVLLKNINSSYLFNSNFSKSNDTSAKNRTLAEIQRSTNNYTLTDITKPSDLIHLIG 360
            YY +V+LK  N+  ++ S   ++ ++ A               T T I   + L H   
Sbjct: 297 SYYQDVVLK--NAEMVWESIVLRTKNSDAT--------------TFTAIQPLNKLWHAF- 339

Query: 361 FKSIYQNWLIYATPIYELLKDFVLNIPTSLANLSQVTYKLAYDSVSPSIVINLCFRVLIF 420
                       TPI++  K FVL++P+S+  + QVT KLA +SVSP+IV+NLCFRVL+F
Sbjct: 340 ------------TPIWKFFKGFVLSVPSSIGGVFQVTLKLASESVSPAIVLNLCFRVLVF 387

Query: 421 YSATRIIPAVQRKNHLETKRSRNFLKAFYLFSPCIVIAMYTNLILQYSGELKNDLCIWGC 480
           YSATRIIPA+QRKN  E ++SR  +   Y +SPCI+IAMYT+LILQYSGEL +DLC+WGC
Sbjct: 388 YSATRIIPALQRKNTRELRKSRRIMNVLYWYSPCILIAMYTHLILQYSGELNSDLCLWGC 447

Query: 481 DIISKSISQRMSTINMDVGSDDTYPNREFIVNSWGFWNWCNIFCTIFIYGCELMG 535
                  S++        GS    P  E  +N+W FWNWCNIF T+ IYG EL+G
Sbjct: 448 -------SEKW------FGSGQ--PKIE--INTWVFWNWCNIFWTVLIYGSELIG 485

>Smik_9.89 Chr9 (172734..174209) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  453 bits (1166), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 243/530 (45%), Positives = 339/530 (63%), Gaps = 47/530 (8%)

Query: 6   KSVKQSIRMLWGCFYLISVLITIPSAFKIGGLYCGLSFTMTLFHLYFLSTTMHLIAKRTL 65
           KS  QS R+   CFYL+  L++IP +FK+GGL CGLSFT+TLF LYF++TT++++A+R  
Sbjct: 6   KSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLARRYG 65

Query: 66  NNFYILLSTLVYYLQHIVIASLLYIFITIFSDGNLNEILSNNKTDQLPSLLYYIKNDTSK 125
              YI L++ +YY QH +IASLLY+F++ FS+  L  +L   + ++  S L  +KN  + 
Sbjct: 66  GKLYIFLTSCLYYSQHFIIASLLYLFLSGFSNDELGNVL-KKRPNESESFLEALKNSLN- 123

Query: 126 SVSQNFHXXXXXXXXXXAVQPWNYLLSHSTPFFTLLEGFFTILGIQAIGETYCWXXXXXX 185
             S   +           VQPW ++L+ STPFFTL EGFFTIL IQA+GET  W      
Sbjct: 124 --SNQINYVLYYYYFRFVVQPWQFILTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLN 181

Query: 186 XXXXXXXTWLISVGVIFTAIHFLYKIYEFQVWELSIQTASLLGVTMSLVLTVGIFGIFST 245
                  + L S GVI  ++++LY+IY   +W LSIQTASLLG  +S+V  +G++GI S 
Sbjct: 182 SNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQ 241

Query: 246 NGSLIESSLFLGYIIRCFYEISPELSTSATTEILDNIKEAWQNHQGSITVTEHILFYYNN 305
            GS+IESSLF  YI+RC YEISP+L+T+AT EILD  K+ WQ HQ ++   +++L Y++N
Sbjct: 242 KGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHN 301

Query: 306 VLLKNINSSYLFNSNFSKSNDTSAKNRTLAEIQRSTNNYTLTDITKPSDLIHLIGFKSIY 365
           V+LKN  +  L+ S   +              ++ T ++          LI ++ F+ + 
Sbjct: 302 VILKN--AEMLWGSFIPRG-------------RKKTGDFH-------DKLISVLSFEKVS 339

Query: 366 QNWLIYATPIYELLKDFVLNIPTSLANLSQVTYKLAYDSVSPSIVINLCFRVLIFYSATR 425
               + + P ++  K+F  ++P S+    QVT K+A +SVSP+IV+NLCFRVL+FYSATR
Sbjct: 340 ----LISKPFWKFFKNFTFSVPLSINEFCQVTIKMASESVSPAIVVNLCFRVLMFYSATR 395

Query: 426 IIPAVQRKNHLETKRSRNFLKAFYLFSPCIVIAMYTNLILQYSGELKNDLCIWGCDIISK 485
           IIPA+QRKN  + ++SR  +K  Y +SPCI+IAMYT+LILQYSGELK DLCIWGC     
Sbjct: 396 IIPALQRKNDKQLRKSRRIMKGLYWYSPCILIAMYTHLILQYSGELKKDLCIWGC----- 450

Query: 486 SISQRMSTINMDVGSDDTYPNREFIVNSWGFWNWCNIFCTIFIYGCELMG 535
             S++        GSD      E IV+SWGFWNWCNIFCTI +Y  EL+G
Sbjct: 451 --SEKW------FGSDQP----EIIVDSWGFWNWCNIFCTILVYATELIG 488

>Skud_9.83 Chr9 (170322..171797) [1476 bp, 491 aa] {ON} YIL090W
           (REAL)
          Length = 491

 Score =  452 bits (1163), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 242/530 (45%), Positives = 340/530 (64%), Gaps = 47/530 (8%)

Query: 6   KSVKQSIRMLWGCFYLISVLITIPSAFKIGGLYCGLSFTMTLFHLYFLSTTMHLIAKRTL 65
           KS  QS R+   CFYL+  L++IP +FK+GGL CGLSFT+TLF LYF++TT++++AKR  
Sbjct: 6   KSFMQSGRVCAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLAKRHG 65

Query: 66  NNFYILLSTLVYYLQHIVIASLLYIFITIFSDGNLNEILSNNKTDQLPSLLYYIKNDTSK 125
              YI L+  +YY QH VIASLLY+F++ FS+  L  +L  N++++  S L  +K+  + 
Sbjct: 66  GKLYIFLTNCLYYSQHFVIASLLYLFLSGFSNDELGNVL-KNRSNESESFLDALKDSLN- 123

Query: 126 SVSQNFHXXXXXXXXXXAVQPWNYLLSHSTPFFTLLEGFFTILGIQAIGETYCWXXXXXX 185
             S   +           VQPW ++L+ STPFFTL EGFFTIL IQA+GET  W      
Sbjct: 124 --SNQINYVLYYYYYRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLN 181

Query: 186 XXXXXXXTWLISVGVIFTAIHFLYKIYEFQVWELSIQTASLLGVTMSLVLTVGIFGIFST 245
                  + L S GVI  ++++LY+IY   +W LSIQTASLLG  +S+V  +G++GI S 
Sbjct: 182 SNTWIISSLLASGGVITASLYYLYRIYVTPIWPLSIQTASLLGFVLSMVCGLGLYGIVSQ 241

Query: 246 NGSLIESSLFLGYIIRCFYEISPELSTSATTEILDNIKEAWQNHQGSITVTEHILFYYNN 305
            GS+IESSLF  YI+RC YEISP+L+T+AT EILD  K+ WQ HQ ++   +++L Y++N
Sbjct: 242 KGSVIESSLFFAYIVRCIYEISPKLATTATDEILDLFKDVWQKHQRNLPTADNLLCYFHN 301

Query: 306 VLLKNINSSYLFNSNFSKSNDTSAKNRTLAEIQRSTNNYTLTDITKPSDLIHLIGFKSIY 365
           V+LKN  +  L+ S   +              ++ T ++          +I ++ F+ + 
Sbjct: 302 VVLKN--AEMLWGSFIPRG-------------RKKTGDFH-------DKIISILSFEKVS 339

Query: 366 QNWLIYATPIYELLKDFVLNIPTSLANLSQVTYKLAYDSVSPSIVINLCFRVLIFYSATR 425
               + + P ++  K+F  ++P S+    QVT K+A +SVSP+IVINLCFRVL+FYSATR
Sbjct: 340 ----LISRPFWKFFKNFTFSVPLSINEFCQVTIKMASESVSPAIVINLCFRVLMFYSATR 395

Query: 426 IIPAVQRKNHLETKRSRNFLKAFYLFSPCIVIAMYTNLILQYSGELKNDLCIWGCDIISK 485
           IIPA+QRKN  + ++SR  ++  Y +SPCI+IAMYT+LILQYSGELK DLCIWGC     
Sbjct: 396 IIPALQRKNDKQLRKSRRIMRGLYWYSPCILIAMYTHLILQYSGELKKDLCIWGC----- 450

Query: 486 SISQRMSTINMDVGSDDTYPNREFIVNSWGFWNWCNIFCTIFIYGCELMG 535
             S++        G++      E IV+SWGFWNWCNIFCTI +Y  EL+G
Sbjct: 451 --SEKW------FGAEQP----EIIVDSWGFWNWCNIFCTILVYATELIG 488

>YIL090W Chr9 (193595..195070) [1476 bp, 491 aa] {ON}  ICE2Integral
           ER membrane protein with type-III transmembrane domains;
           required for ER zinc homeostasis; mutations cause
           defects in cortical ER morphology in both the mother and
           daughter cells
          Length = 491

 Score =  451 bits (1160), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 241/530 (45%), Positives = 338/530 (63%), Gaps = 47/530 (8%)

Query: 6   KSVKQSIRMLWGCFYLISVLITIPSAFKIGGLYCGLSFTMTLFHLYFLSTTMHLIAKRTL 65
           KS  QS R+   CFYL+  L++IP +FK+GGL CGLSFT+TLF LYF++TT++++A+R  
Sbjct: 6   KSFMQSGRICAACFYLLFTLLSIPISFKVGGLECGLSFTVTLFTLYFITTTLNVLARRHG 65

Query: 66  NNFYILLSTLVYYLQHIVIASLLYIFITIFSDGNLNEILSNNKTDQLPSLLYYIKNDTSK 125
              YI  +  +YY QH +IASLLY+F++ FS+  L  +L  NK ++  S L  +KN  + 
Sbjct: 66  GRLYIFFTNCLYYSQHFIIASLLYLFLSGFSNDELGNVL-KNKYNESESFLEALKNSLN- 123

Query: 126 SVSQNFHXXXXXXXXXXAVQPWNYLLSHSTPFFTLLEGFFTILGIQAIGETYCWXXXXXX 185
             S   +           VQPW ++L+ STPFFTL EGFFTIL IQA+GET  W      
Sbjct: 124 --SNQINYVLYYYYYRFVVQPWQFVLTKSTPFFTLSEGFFTILAIQAVGETNRWLSNDLN 181

Query: 186 XXXXXXXTWLISVGVIFTAIHFLYKIYEFQVWELSIQTASLLGVTMSLVLTVGIFGIFST 245
                  + L S GVI  ++++LY+IY   +W LSIQTASLLG+ +S+V  +G++GI S 
Sbjct: 182 SNTWIISSLLTSGGVITASLYYLYRIYVTPIWPLSIQTASLLGLVLSMVCGLGLYGIVSQ 241

Query: 246 NGSLIESSLFLGYIIRCFYEISPELSTSATTEILDNIKEAWQNHQGSITVTEHILFYYNN 305
            GS+IESSLF  YI+RC YEISP+L+T+AT EIL+  K+ WQ HQ ++   +++L Y++N
Sbjct: 242 KGSVIESSLFFAYIVRCIYEISPKLATTATDEILNLFKDVWQKHQRNLPTADNLLCYFHN 301

Query: 306 VLLKNINSSYLFNSNFSKSNDTSAKNRTLAEIQRSTNNYTLTDITKPSDLIHLIGFKSIY 365
           V+LKN  +  L+ S   +              ++ T ++          LI ++ F+ + 
Sbjct: 302 VILKN--AEVLWGSFIPRG-------------RKKTGDFH-------DKLISILSFEKVS 339

Query: 366 QNWLIYATPIYELLKDFVLNIPTSLANLSQVTYKLAYDSVSPSIVINLCFRVLIFYSATR 425
               + + P ++  K+F  ++P S+    QVT K+A +SVSP+IVINLCFRVL+FYSATR
Sbjct: 340 ----LISKPFWKFFKNFTFSVPLSINEFCQVTIKMASESVSPAIVINLCFRVLMFYSATR 395

Query: 426 IIPAVQRKNHLETKRSRNFLKAFYLFSPCIVIAMYTNLILQYSGELKNDLCIWGCDIISK 485
           IIPA+QRKN  + ++SR  +K  Y +SPCI+IAMYT+LILQYSGELK DLCIWGC     
Sbjct: 396 IIPALQRKNDKQLRKSRRIMKGLYWYSPCILIAMYTHLILQYSGELKKDLCIWGC----- 450

Query: 486 SISQRMSTINMDVGSDDTYPNREFIVNSWGFWNWCNIFCTIFIYGCELMG 535
             S++   ++            E IV+SWGFWNWCNIFCTI +Y  EL+G
Sbjct: 451 --SEKWFGVDQP----------EIIVDSWGFWNWCNIFCTILVYATELIG 488

>ZYRO0A02024g Chr1 (167059..168519) [1461 bp, 486 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090W ICE2
           Integral ER membrane protein with type-III transmembrane
           domains mutations cause defects in cortical ER
           morphology in both the mother and daughter cells
          Length = 486

 Score =  451 bits (1160), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 250/528 (47%), Positives = 342/528 (64%), Gaps = 48/528 (9%)

Query: 8   VKQSIRMLWGCFYLISVLITIPSAFKIGGLYCGLSFTMTLFHLYFLSTTMHLIAKRTLNN 67
           V QS+R+L  CFYL+S+LITIP +FK+GGLYCGLSFT+TLF+LYF+STT+ L  +   + 
Sbjct: 4   VVQSVRVLLACFYLLSILITIPISFKVGGLYCGLSFTVTLFNLYFMSTTLSLFVRGYASR 63

Query: 68  FYILLSTLVYYLQHIVIASLLYIFITIFSDGNLNEILSNNKTDQLPSLLYYIKNDTSKSV 127
           FY+  +  +YY QH +IASLLY+F++ FS+  L +IL +    +  SLL  +K   S   
Sbjct: 64  FYVFSTATIYYSQHCIIASLLYLFLSGFSNEELTKILESGSQPE-QSLLEVLK---SNPF 119

Query: 128 SQNFHXXXXXXXXXXAVQPWNYLLSHSTPFFTLLEGFFTILGIQAIGETYCWXXXXXXXX 187
           S + +           VQPW ++LSHST FF+L EGFFTIL IQA+GE++ W        
Sbjct: 120 SAHSNWILYYYYYCYIVQPWQWILSHSTAFFSLSEGFFTILAIQAVGESHRWLLYEINSN 179

Query: 188 XXXXXTWLISVGVIFTAIHFLYKIYEFQVWELSIQTASLLGVTMSLVLTVGIFGIFSTNG 247
                + LIS GVI  A+++LY+IY   VWELSIQTASLLG T+SLV  +G++GI S NG
Sbjct: 180 IWNITSLLISGGVITAALYYLYRIYVTPVWELSIQTASLLGFTLSLVCGLGLYGIVSKNG 239

Query: 248 SLIESSLFLGYIIRCFYEISPELSTSATTEILDNIKEAWQNHQGSITVTEHILFYYNNVL 307
           S+IESSLF  YI+RC YEISP+L+T+AT EIL+  KEAWQ HQ + + T ++L YY++V+
Sbjct: 240 SVIESSLFFAYIVRCIYEISPKLATTATDEILEIFKEAWQKHQRNYSSTNNLLSYYHDVV 299

Query: 308 LKNINSSYLFNSNFSKSNDTSAKNRTLAEIQRSTNNYTLTDITKPSDLIHLIGFKSIYQN 367
           L   ++  ++ S  SK+  TS             + +  T +  P     L  F  I++ 
Sbjct: 300 LD--SAEMMWESIVSKTVTTS-------------DPFYHTSMFPP-----LRKFTDIFK- 338

Query: 368 WLIYATPIYELLKDFVLNIPTSLANLSQVTYKLAYDSVSPSIVINLCFRVLIFYSATRII 427
                 P+    K+F +++P+S+  L QVT K+A DSVSP+IV+NL FRVLIFYSAT+II
Sbjct: 339 ------PVGIFFKNFTISVPSSIEGLFQVTLKMASDSVSPAIVVNLFFRVLIFYSATKII 392

Query: 428 PAVQRKNHLETKRSRNFLKAFYLFSPCIVIAMYTNLILQYSGELKNDLCIWGCDIISKSI 487
           PA+Q K   +  +SR  +   Y +SPCI+IAMYT+LILQYSGEL  DLC+WGC+ +  S+
Sbjct: 393 PALQGKGDRQLNKSRRIMNVLYWYSPCILIAMYTHLILQYSGELNRDLCLWGCNSMWFSL 452

Query: 488 SQRMSTINMDVGSDDTYPNREFIVNSWGFWNWCNIFCTIFIYGCELMG 535
           +Q                  + +V+SWGFWNWCNIF TI +YG EL+G
Sbjct: 453 NQ-----------------TKIVVDSWGFWNWCNIFWTILVYGSELIG 483

>KNAG0A05390 Chr1 complement(793701..795194) [1494 bp, 497 aa] {ON}
           Anc_2.293 YIL090W
          Length = 497

 Score =  446 bits (1147), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 242/527 (45%), Positives = 341/527 (64%), Gaps = 49/527 (9%)

Query: 10  QSIRMLWGCFYLISVLITIPSAFKIGGLYCGLSFTMTLFHLYFLSTTMHLIAKRTLNNFY 69
           +  R+  G  YL+  LI+IP +FK+GGLYCGL+FT TLF LYF+STT+ +IA++  N  Y
Sbjct: 11  RGCRICSGALYLLLTLISIPISFKVGGLYCGLAFTATLFILYFVSTTLSIIARKNGNRIY 70

Query: 70  ILLSTLVYYLQHIVIASLLYIFITIFSDGNLNEILSNNKTDQLP-SLLYYIKNDTSKSVS 128
           I+LS+++YY QH +IASLL++F++ FS+  L++I+ N   D +P   L  I N +  S  
Sbjct: 71  IVLSSILYYCQHFIIASLLHLFLSGFSNAELHKIIEN---DAIPIESLTSILNVSMSSSE 127

Query: 129 QNFHXXXXXXXXXXAVQPWNYLLSHSTPFFTLLEGFFTILGIQAIGETYCWXXXXXXXXX 188
            N+            V PW ++LSHSTPFFTL EGFFTIL IQAIGET  W         
Sbjct: 128 ANW--IFYYYYYKYVVTPWKFVLSHSTPFFTLSEGFFTILAIQAIGETNKWLCYEKNSNA 185

Query: 189 XXXXTWLISVGVIFTAIHFLYKIYEFQVWELSIQTASLLGVTMSLVLTVGIFGIFSTNGS 248
               + L S  VI  A+++LY+IY   +WEL++QTASLLG  +SLV  +GI+GI S +GS
Sbjct: 186 WIISSLLTSSAVISAALYYLYRIYVTPIWELTVQTASLLGFVLSLVSGLGIYGIVSDSGS 245

Query: 249 LIESSLFLGYIIRCFYEISPELSTSATTEILDNIKEAWQNHQGSITVTEHILFYYNNVLL 308
           +IESSLF  YI+RC YEISP+L+T+AT E+L+  K+ WQ  QG++ +  +++FYYNNV+L
Sbjct: 246 VIESSLFFAYIVRCIYEISPKLATTATDELLELFKDVWQKRQGNLPIRNNLIFYYNNVIL 305

Query: 309 KNINSSYLFNSNFSKSNDTSAKNRTLAEIQRSTNNYTLTDITKPSDLIHLIGFKSIYQNW 368
           KNI  ++    NF     TS            T NY       PS L++         N 
Sbjct: 306 KNIEMAW---DNFILRTGTSG-----------TFNY------NPSLLLN---------NT 336

Query: 369 LIYATPIYELLKDFVLNIPTSLANLSQVTYKLAYDSVSPSIVINLCFRVLIFYSATRIIP 428
             +  PI++  K+F L++P S+  +  +T+K++ +SVSP++VINLCFR+LIFYSATRI+P
Sbjct: 337 WKFCKPIWKFFKNFTLSVPFSIREILLMTWKMSLESVSPAVVINLCFRILIFYSATRIVP 396

Query: 429 AVQRKNHLETKRSRNFLKAFYLFSPCIVIAMYTNLILQYSGELKNDLCIWGCDIISKSIS 488
           ++QRK+  E +RSR  ++  Y +SPCI+IAMY +LILQYS ELKN+LC+WGC+       
Sbjct: 397 SLQRKDAREQRRSRKVMELVYWYSPCILIAMYAHLILQYSSELKNELCLWGCN------- 449

Query: 489 QRMSTINMDVGSDDTYPNREFIVNSWGFWNWCNIFCTIFIYGCELMG 535
                 N+ +G  +T  N   +V++W FWNWCN+FCTI +Y  EL+G
Sbjct: 450 ------NILLGY-NTDQNETVVVDAWRFWNWCNVFCTILVYANELIG 489

>SAKL0E07524g Chr5 complement(609285..610724) [1440 bp, 479 aa] {ON}
           similar to uniprot|P40499 Saccharomyces cerevisiae
           YIL090W ICE2 Integral ER membrane protein with type-III
           transmembrane domains mutations cause defects in
           cortical ER morphology in both the mother and daughter
           cells
          Length = 479

 Score =  437 bits (1125), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 238/530 (44%), Positives = 340/530 (64%), Gaps = 58/530 (10%)

Query: 6   KSVKQSIRMLWGCFYLISVLITIPSAFKIGGLYCGLSFTMTLFHLYFLSTTMHLIAKRTL 65
           +S+ QSIR     FYL+ VLITIP +F++GGLYCGLSFT+TLF+LYFL+TT+ +++K+  
Sbjct: 4   RSLIQSIRGCLTTFYLLLVLITIPISFQVGGLYCGLSFTVTLFNLYFLTTTLKIVSKK-Y 62

Query: 66  NNFYILLSTLVYYLQHIVIASLLYIFITIFSDGNLNEILSNNKTDQLPSLLYYIKNDTSK 125
           N  Y  +++ VYYLQH +I SLL++F++ F++  L   +  +      SL+ +++N + K
Sbjct: 63  NRLYYSITSFVYYLQHFIIPSLLFLFLSGFNNDELKRQIDGDVNLPRESLVNFLRNKSGK 122

Query: 126 SVSQNFHXXXXXXXXXXAVQPWNYLLSHSTPFFTLLEGFFTILGIQAIGETYCWXXXXXX 185
             S  F+           V+PW ++L HSTP+FTLLEGFFT+LGIQAIGET  W      
Sbjct: 123 H-SWIFYYYYYKF----TVKPWQFVLLHSTPYFTLLEGFFTVLGIQAIGETNKWLRYHKN 177

Query: 186 XXXXXXXTWLISVGVIFTAIHFLYKIYEFQVWELSIQTASLLGVTMSLVLTVGIFGIFST 245
                  + LIS GVI T++++LY+IY   VWELSIQTASLLG T+S+V  +G++GI S 
Sbjct: 178 SNTWIIVSLLISGGVITTSLYYLYRIYVTPVWELSIQTASLLGFTLSIVCGLGLYGIVSG 237

Query: 246 NGSLIESSLFLGYIIRCFYEISPELSTSATTEILDNIKEAWQNHQGSITVTEHILFYYNN 305
            GS+IESSLF  YI+RC YEISP+L+TSA  EI   +K+ WQ HQG++  T+++L YY N
Sbjct: 238 KGSVIESSLFFAYIVRCIYEISPQLATSAMDEIFKIVKDTWQKHQGNLP-TDNLLSYYRN 296

Query: 306 VLLKNINSSYLFNSNFSKSNDTSAKNRTLAEIQRSTNNYTLTDITKPSDLIHLIGFKSIY 365
           V+LK  N   ++++   K+  TS     +                               
Sbjct: 297 VVLK--NGEMIWDAIVQKTGTTSPSTTQMV------------------------------ 324

Query: 366 QNWLIYATPIYELLKDFVLNIPTSLANLSQVTYKLAYDSVSPSIVINLCFRVLIFYSATR 425
             WL    P+++  K+F +++P+S+  + +VT K+A +SV+P++VINL FR+L+FYSATR
Sbjct: 325 --WL-RLQPLWKFTKNFTISVPSSIREIFRVTLKMATESVTPTVVINLVFRILVFYSATR 381

Query: 426 IIPAVQRKNHLETKRSRNFLKAFYLFSPCIVIAMYTNLILQYSGELKNDLCIWGCDIISK 485
           IIPA+Q+ +    K SR  ++  Y +SPCIVIAMYT+LILQYSGEL NDLC+WGC   S 
Sbjct: 382 IIPALQKDDSNGRKSSRRLMRLIYWYSPCIVIAMYTHLILQYSGELNNDLCLWGCFPWSH 441

Query: 486 SISQRMSTINMDVGSDDTYPNREFIVNSWGFWNWCNIFCTIFIYGCELMG 535
                         ++D  P+ + +V++WGFWNWCN+FCT+ IYG EL+G
Sbjct: 442 --------------TND--PSSKVVVDAWGFWNWCNVFCTLAIYGLELIG 475

>NCAS0B06220 Chr2 complement(1173970..1175430) [1461 bp, 486 aa]
           {ON} Anc_2.293 YIL090W
          Length = 486

 Score =  436 bits (1122), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 237/528 (44%), Positives = 333/528 (63%), Gaps = 58/528 (10%)

Query: 10  QSIRMLWGCFYLISVLITIPSAFKIGGLYCGLSFTMTLFHLYFLSTTMHLIAKRTLNNFY 69
           + IR+    FYL+  LI+IP +FKIGGL+CGL+FT++LF LYFLSTT+ + A++  +  +
Sbjct: 8   RGIRICSATFYLLFTLISIPISFKIGGLHCGLAFTVSLFILYFLSTTLSIWARKYGSRIH 67

Query: 70  ILLSTLVYYLQHIVIASLLYIFITIFSDGNLNEIL--SNNKTDQLPSLLYYIKNDTSKSV 127
           ILL+ ++YY QH +IASLLY+F++ FS+  L+ +L   N   D +  +    K + + S 
Sbjct: 68  ILLTNILYYFQHFIIASLLYLFLSGFSNEQLSSMLRDGNKPIDSIADIF---KKNVASST 124

Query: 128 SQNFHXXXXXXXXXXAVQPWNYLLSHSTPFFTLLEGFFTILGIQAIGETYCWXXXXXXXX 187
             N+            VQPW ++LS+STPFFTL EGFFTIL IQAIGET  W        
Sbjct: 125 QANW--VLYYYYYRFFVQPWQFILSYSTPFFTLSEGFFTILAIQAIGETNKWLVYEINSN 182

Query: 188 XXXXXTWLISVGVIFTAIHFLYKIYEFQVWELSIQTASLLGVTMSLVLTVGIFGIFSTNG 247
                + L S GVI  ++++LY+IY   +W+LS+QTASLLG T+SLV  +GI+GI +  G
Sbjct: 183 TWVISSLLASGGVITASLYYLYRIYVTPIWQLSVQTASLLGFTLSLVGGLGIYGIVTDKG 242

Query: 248 SLIESSLFLGYIIRCFYEISPELSTSATTEILDNIKEAWQNHQGSITVTEHILFYYNNVL 307
           S+IESS+F  YI+RC YEISP+L+T+AT EIL+  KE WQ HQ ++T   ++L YY+NV+
Sbjct: 243 SVIESSVFFAYIVRCIYEISPKLATTATEEILEVFKEVWQRHQANLTSPNNLLSYYHNVV 302

Query: 308 LKNINSSYLFNSNFSKSNDTSAKNRTLAEIQRSTNNYTLTDITKPSDLIHLIGFKSIYQN 367
           LKNI                     T+ E  +  +N  +T  +    +   +        
Sbjct: 303 LKNI--------------------ETIWESFKINDNSFITSFSTERVITIFM-------- 334

Query: 368 WLIYATPIYELLKDFVLNIPTSLANLSQVTYKLAYDSVSPSIVINLCFRVLIFYSATRII 427
                 PI++LLK F + +P+S+  L  VTYK+A +S+SP++++NLCFRVLIFYSATRII
Sbjct: 335 ------PIWKLLKTFTITVPSSINELCFVTYKMACESISPAVIVNLCFRVLIFYSATRII 388

Query: 428 PAVQRKNHLETKRSRNFLKAFYLFSPCIVIAMYTNLILQYSGELKNDLCIWGCDIISKSI 487
           PA+QR++  E ++SR  +K  Y +SPCI+IAMY +LILQYSGELK++LC+WGC       
Sbjct: 389 PALQRRDDNELRKSRRIMKVLYWYSPCILIAMYAHLILQYSGELKDELCLWGC------- 441

Query: 488 SQRMSTINMDVGSDDTYPNREFIVNSWGFWNWCNIFCTIFIYGCELMG 535
                  N  +   D     + IV+SWGFWNWCNIF TI +Y  EL+G
Sbjct: 442 -------NSKIFPSD---QPKIIVDSWGFWNWCNIFFTILVYASELIG 479

>KAFR0J01330 Chr10 complement(243571..245046) [1476 bp, 491 aa] {ON}
           Anc_2.293 YIL090W
          Length = 491

 Score =  436 bits (1122), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 235/535 (43%), Positives = 342/535 (63%), Gaps = 49/535 (9%)

Query: 1   MPWVVKSVKQSIRMLWGCFYLISVLITIPSAFKIGGLYCGLSFTMTLFHLYFLSTTMHLI 60
           M  + KS+ + +R+  G FYL+  LI+IP +FKIGG++CGLSFT+TLF  YFLSTT+ ++
Sbjct: 1   MTLLSKSIIRGLRIFSGTFYLLFTLISIPMSFKIGGMHCGLSFTVTLFIAYFLSTTLSIL 60

Query: 61  AKRTLNNFYILLSTLVYYLQHIVIASLLYIFITIFSDGNLNEILSNNKTDQLPSLLYYIK 120
           A+++ + FYI+L++L+YY QH++IASLLY F++ FS+  L+ +L +  T+++  L   + 
Sbjct: 61  ARQSGSRFYIVLTSLIYYCQHLIIASLLYFFLSGFSNDELHRVLKDG-TEKIEVL---VA 116

Query: 121 NDTSKSVSQNFHXXXXXXXXXXAVQPWNYLLSHSTPFFTLLEGFFTILGIQAIGETYCWX 180
           N        N+            V+PW ++LS+STPFF L EGFFTIL IQAIGET  W 
Sbjct: 117 NQDLMVSESNW--LLYCYYYSYVVKPWKFVLSYSTPFFALAEGFFTILAIQAIGETNRWL 174

Query: 181 XXXXXXXXXXXXTWLISVGVIFTAIHFLYKIYEFQVWELSIQTASLLGVTMSLVLTVGIF 240
                       + L S GV+  ++++LY+IY   +WELS QTA+LLG  +SL   +GI 
Sbjct: 175 SDEKNSNSWIISSLLASSGVVTASLYYLYRIYVTPIWELSAQTATLLGCVLSLTFGLGIH 234

Query: 241 GIFSTNGSLIESSLFLGYIIRCFYEISPELSTSATTEILDNIKEAWQNHQGSITVTEHIL 300
           GI S  GS++ESSLF  YI+RC YEISP+L+T+AT EIL+  KE WQ HQG + +T++IL
Sbjct: 235 GIISERGSVVESSLFFAYIVRCIYEISPKLATTATDEILELFKEVWQEHQGKLPITDNIL 294

Query: 301 FYYNNVLLKNINSSYLFNSNFSKSNDTSAKNRTLAEIQRSTNNYTLTDITKPSDLIHLIG 360
            YY +V+LK  N+  ++ +  SK+   S              N+TL              
Sbjct: 295 NYYRSVILK--NTEMIWEAFLSKTKQHS--------------NHTLNSFFTA-------- 330

Query: 361 FKSIYQNWLIYATPIYELLKDFVLNIPTSLANLSQVTYKLAYDSVSPSIVINLCFRVLIF 420
                +N+ I+  P+++  K+F +++P S++ LS +  ++A +S+SP++V+NLCFRVLIF
Sbjct: 331 -----ENFWIHFNPLWKFFKNFTISVPFSISELSGMMLQMASESISPAVVVNLCFRVLIF 385

Query: 421 YSATRIIPAVQRKNHLETKRSRNFLKAFYLFSPCIVIAMYTNLILQYSGELKNDLCIWGC 480
           YSATRIIP++QRK   ++++SR  +K  Y +SPCI+IAMYT+LILQYSGELK +L +WG 
Sbjct: 386 YSATRIIPSLQRKEVRDSRKSRRIMKVLYWYSPCILIAMYTHLILQYSGELKRELYLWGP 445

Query: 481 DIISKSISQRMSTINMDVGSDDTYPNREFIVNSWGFWNWCNIFCTIFIYGCELMG 535
           D          S ++  V  ++       +V+SW FWNWCNIF TI IYG EL G
Sbjct: 446 D----------SKLSFLVDKEEN----NIVVDSWSFWNWCNIFWTILIYGGELFG 486

>CAGL0D04202g Chr4 (414049..415548) [1500 bp, 499 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090w
          Length = 499

 Score =  432 bits (1112), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 237/543 (43%), Positives = 343/543 (63%), Gaps = 60/543 (11%)

Query: 1   MPWVVKSVKQSIRMLWGCFYLISVLITIPSAFKIGGLYCGLSFTMTLFHLYFLSTTMHLI 60
           M  + + V++SIR+     YL+  L++IP +FKIGGL CGLSFT+TLF+LY +STT+ ++
Sbjct: 1   MGLITEGVQRSIRISSAALYLVLTLVSIPISFKIGGLQCGLSFTVTLFNLYLISTTLSVL 60

Query: 61  AKRTLNNFYILLSTLVYYLQHIVIASLLYIFITIFSDGNLNEILSN----NKTDQLPSLL 116
           A+R+ N  Y+  ++++YY QH+VIA LL++F++ FS+   N  LS      + D   S L
Sbjct: 61  ARRSCNRGYVFATSILYYSQHLVIAPLLFLFLSGFSNEEFNRFLSPVGSYQELDPDGSFL 120

Query: 117 YYIKND----TSKSVSQNFHXXXXXXXXXXAVQPWNYLLSHSTPFFTLLEGFFTILGIQA 172
             +K+     T+   S+N+            VQPW +LLS+STPFFTLLEGFFTIL IQA
Sbjct: 121 DLLKHRILMATTAENSKNW--TLYYYYFKFIVQPWQWLLSYSTPFFTLLEGFFTILAIQA 178

Query: 173 IGETYCWXXXXXXXXXXXXXTWLISVGVIFTAIHFLYKIYEFQVWELSIQTASLLGVTMS 232
           IGET  W             + L+S GVI  ++++LY+IY   +W+L+IQ+ASLLG  +S
Sbjct: 179 IGETNKWLSYEMNSNTWIITSLLVSGGVITGSLYYLYRIYVTPIWKLTIQSASLLGFVLS 238

Query: 233 LVLTVGIFGIFSTNGSLIESSLFLGYIIRCFYEISPELSTSATTEILDNIKEAWQNHQGS 292
           +V  +G++GI S  GS+IESSLF  YI+RC YEISP+L+T AT EILD +K+ WQ HQ +
Sbjct: 239 IVFCLGLYGIISRKGSVIESSLFFAYIVRCIYEISPKLATRATEEILDLVKDVWQTHQRN 298

Query: 293 ITVTEHILFYYNNVLLKNINSSYLFNSNFSKSNDTSAKNRTLAEIQRSTNNYTLTDITKP 352
           +   +++L YY+NV+LKN    +         +    ++R+L  +++             
Sbjct: 299 LLNRDNLLAYYHNVVLKNAEMVW--------ESFILPRSRSLNAMEK------------- 337

Query: 353 SDLIHLIGFKSIYQNWLIYATPIYELLKDFVLNIPTSLANLSQVTYKLAYDSVSPSIVIN 412
                 I F      WL   TP+++  K+F +++P+S+  L  VTYK+A +S+SP++++N
Sbjct: 338 ------IRF------WLD-VTPVWKFFKNFTVSVPSSIVELVSVTYKMASESLSPAVIVN 384

Query: 413 LCFRVLIFYSATRIIPAVQRKNHLETKRSRNFLKAFYLFSPCIVIAMYTNLILQYSGELK 472
           LCFR+LIFYSATRIIPA+QR ++ E ++SR  LK  Y +SPC++IAMYT+LILQYSGELK
Sbjct: 385 LCFRILIFYSATRIIPALQRSSYKEQRQSRRILKLLYWYSPCVLIAMYTHLILQYSGELK 444

Query: 473 NDLCIWGCDIISKSISQRMSTINMDVGSDDTYPNREFIVNSWGFWNWCNIFCTIFIYGCE 532
            +LC+WGC            T N   GS D       + +SW FWNWCNIF T+ +Y  E
Sbjct: 445 RELCLWGC------------TSNW-FGSKD---QPRIVTDSWSFWNWCNIFWTVLVYANE 488

Query: 533 LMG 535
           L+G
Sbjct: 489 LIG 491

>Kpol_1003.42 s1003 (100704..102176) [1473 bp, 490 aa] {ON}
           (100704..102176) [1473 nt, 491 aa]
          Length = 490

 Score =  410 bits (1053), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 226/535 (42%), Positives = 333/535 (62%), Gaps = 48/535 (8%)

Query: 1   MPWVVKSVKQSIRMLWGCFYLISVLITIPSAFKIGGLYCGLSFTMTLFHLYFLSTTMHLI 60
           M  V+K++ +S++++  CFYL++++ TIP +FKIGGLYCGL+FT+TLF+LYF STT+++I
Sbjct: 1   MRRVLKNLIRSVQVVLVCFYLLNIVTTIPISFKIGGLYCGLTFTVTLFYLYFTSTTLNII 60

Query: 61  AKRTLNNFYILLSTLVYYLQHIVIASLLYIFITIFSDGNLNEILSNNKTDQLPSLLYYIK 120
           A+R  +   I++++  +Y Q+ +I SLL++F+  F++ +L + + +    +  + L  ++
Sbjct: 61  ARRWGSKPAIIITSSFFYFQNFIIPSLLHLFLNGFANEDLIKSIRSGIQPK-ETFLDLLR 119

Query: 121 NDTSKSVSQNFHXXXXXXXXXXAVQPWNYLLSHSTPFFTLLEGFFTILGIQAIGETYCWX 180
            D   SV    +           V+PW  +LS+STP FTLLEGFFTILGIQ IGE   W 
Sbjct: 120 GDIPVSVK---NWLLFYYYYSYTVKPWQVILSYSTPVFTLLEGFFTILGIQTIGEMNTWL 176

Query: 181 XXXXXXXXXXXXTWLISVGVIFTAIHFLYKIYEFQVWELSIQTASLLGVTMSLVLTVGIF 240
                       + L S G+I  ++++LY+IY   +W LS+  A+LLG T+SLV ++GI+
Sbjct: 177 KHERNSNIWIISSLLTSGGLITGSLYYLYRIYATPIWNLSVGAATLLGFTLSLVGSLGIY 236

Query: 241 GIFSTNGSLIESSLFLGYIIRCFYEISPELSTSATTEILDNIKEAWQNHQGSITVTEHIL 300
           GI S NGS+IESSLF  YI+RC YEI+PEL+T+AT E L+ IKE WQ+H  ++ V +  +
Sbjct: 237 GIVSHNGSVIESSLFFAYIVRCIYEIAPELATTATEEFLEGIKEVWQSHHANLNVADGFI 296

Query: 301 FYYNNVLLKNINSSYLFNSNFSKSNDTSAKNRTLAEIQRSTNNYTLTDITKPSDLIHLIG 360
                        SY ++S   +++       +        +NY +       D   L+ 
Sbjct: 297 -------------SYFYDSFHMQAHKFWTLFTSRTPYYGYLHNYCM-------DYPSLVM 336

Query: 361 FKSIYQNWLIYATPIYELLKDFVLNIPTSLANLSQVTYKLAYDSVSPSIVINLCFRVLIF 420
            +S +        PI+E LK    ++PTS++ L  +T ++A DSVSP+I+INLCFR++IF
Sbjct: 337 IRSNFY-------PIWETLKTLTFSVPTSISELFHLTVRMAIDSVSPAIIINLCFRLMIF 389

Query: 421 YSATRIIPAVQRKNHLETKRSRNFLKAFYLFSPCIVIAMYTNLILQYSGELKNDLCIWGC 480
           YSATRIIPA+Q++   ET++ R  +KA Y +SPCI+IAMYT+LILQYSGELK DLC+WGC
Sbjct: 390 YSATRIIPAIQKRTRSETRKIRGIMKALYWYSPCILIAMYTHLILQYSGELKKDLCLWGC 449

Query: 481 DIISKSISQRMSTINMDVGSDDTYPNREFIVNSWGFWNWCNIFCTIFIYGCELMG 535
           D  S    +    IN+D               +W FWNWCNIF TI IYG EL+G
Sbjct: 450 D--STWFGEDQERINVD---------------AWSFWNWCNIFWTIIIYGSELIG 487

>KLTH0G10516g Chr7 (889468..890892) [1425 bp, 474 aa] {ON} similar
           to uniprot|P40499 Saccharomyces cerevisiae YIL090W ICE2
           Integral ER membrane protein with type-III transmembrane
           domains mutations cause defects in cortical ER
           morphology in both the mother and daughter cells
          Length = 474

 Score =  394 bits (1013), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 223/532 (41%), Positives = 327/532 (61%), Gaps = 66/532 (12%)

Query: 6   KSVKQSIRMLWGCFYLISVLITIPSAFKIGGLYCGLSFTMTLFHLYFLSTTMHLIAK-RT 64
           +SV QS R+    FYL+ +LITIP +F++GGLYCGLSFT+TLF+LY ++TT+ + A+ R 
Sbjct: 4   RSVIQSARVCLTSFYLLLILITIPISFQVGGLYCGLSFTVTLFNLYLITTTLKIAARARG 63

Query: 65  LNNFYILLSTLVYYLQHIVIASLLYIFITIFSDGNL-NEILSNNKTDQLPSLLYYIKNDT 123
           L      L++  YY QH  I SLL++F++ FS+  L  +I +N + D+  SL+     D 
Sbjct: 64  LAK----LASAAYYAQHFFIPSLLFLFLSGFSNDELKRQIDTNTRPDE--SLI-----DL 112

Query: 124 SKSVSQNFHXXXXXXXXXXAVQPWNYLLSHSTPFFTLLEGFFTILGIQAIGETYCWXXXX 183
            +S +Q+             V+PW ++L  STP+FTLLEGFFT+LGIQA+GET  W    
Sbjct: 113 LRSTTQSQTWVFYYYYYQYVVRPWQFMLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSRG 172

Query: 184 XXXXXXXXXTWLISVGVIFTAIHFLYKIYEFQVWELSIQTASLLGVTMSLVLTVGIFGIF 243
                      + S GVI  A+++LY+IY   +WELS+QTASLLG T S+V  +GI+GI 
Sbjct: 173 NGSNMWVISGLMASGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIYGIV 232

Query: 244 STNGSLIESSLFLGYIIRCFYEISPELSTSATTEILDNIKEAWQNHQGSITVTEHILFYY 303
           S  GS IESSLF  YI+RC YEISP+L+TSA  EI   +KE W N   S+  ++ +L YY
Sbjct: 233 SGRGSTIESSLFFAYIVRCLYEISPQLATSAMDEIFTLVKETWHNQHRSLRSSDTLLTYY 292

Query: 304 NNVLLKNINSSYLFNSNFSKSNDTSAKNRTLAEIQRSTNNYTLTDITKPSDLIHLIGFKS 363
            +++LK  N   ++++  +++N     + T                              
Sbjct: 293 RDIILK--NGEMVWDAILARTNVNVGASGT-----------------------------P 321

Query: 364 IYQNWLIYATPIYELLKDFVLNIPTSLANLSQVTYKLAYDSVSPSIVINLCFRVLIFYSA 423
           ++ +W     P+++ +K F  ++P+S+  +  +T ++A ++++P++VINLCFR+LIFYSA
Sbjct: 322 VWASW-NRVQPLWKFVKHFTSSVPSSIQEIFYLTLEMAREAIAPAVVINLCFRILIFYSA 380

Query: 424 TRIIPAVQRKNHLETKRSRNFLKAFYLFSPCIVIAMYTNLILQYSGELKNDLCIWGCDII 483
           TRIIPA+Q+K+    +RSR F++  Y +SPCIVIAMYT+LILQYSG++ NDLC+WGC   
Sbjct: 381 TRIIPALQKKHK---RRSRRFMRMLYWYSPCIVIAMYTHLILQYSGQISNDLCLWGCFPW 437

Query: 484 SKSISQRMSTINMDVGSDDTYPNREFIVNSWGFWNWCNIFCTIFIYGCELMG 535
           S   + ++                  +V+SWGFWNWCNIFCT+ IY  EL+G
Sbjct: 438 SVPDTPKV------------------VVDSWGFWNWCNIFCTMAIYASELLG 471

>Kwal_27.11500 s27 complement(825779..827206) [1428 bp, 475 aa] {ON}
           YIL090W - Hypothetical ORF [contig 27] FULL
          Length = 475

 Score =  393 bits (1010), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 223/533 (41%), Positives = 325/533 (60%), Gaps = 64/533 (12%)

Query: 4   VVKSVKQSIRMLWGCFYLISVLITIPSAFKIGGLYCGLSFTMTLFHLYFLSTTMHLIAKR 63
           + +S+ QSIR+    FYL+ +LITIP AF++GGLYCGLSFT+TLF+LY ++TT+ + A+ 
Sbjct: 2   IPRSILQSIRVCLTSFYLLLILITIPIAFQVGGLYCGLSFTVTLFNLYLITTTLKIAAR- 60

Query: 64  TLNNFYILLSTLVYYLQHIVIASLLYIFITIFSDGNL-NEILSNNKTDQLPSLLYYIKND 122
                +  L++  YY QH  I SLL++F++ FS+  L ++I +N + D+  SL+     D
Sbjct: 61  --ARGFAKLASAAYYAQHFFIPSLLFLFLSGFSNDELKHQIDTNTRPDE--SLI-----D 111

Query: 123 TSKSVSQNFHXXXXXXXXXXAVQPWNYLLSHSTPFFTLLEGFFTILGIQAIGETYCWXXX 182
             +S + +             V+PW +LL  STP+FTLLEGFFT+LGIQA+GET  W   
Sbjct: 112 LLRSSTHSQPWIFYYYYYHYVVRPWQFLLLRSTPYFTLLEGFFTVLGIQAVGETNRWLSR 171

Query: 183 XXXXXXXXXXTWLISVGVIFTAIHFLYKIYEFQVWELSIQTASLLGVTMSLVLTVGIFGI 242
                       + S GVI  A+++LY+IY   +WELS+QTASLLG T S+V  +GIFGI
Sbjct: 172 GHGSNVWVISGLMTSGGVITAALYYLYRIYVTPIWELSVQTASLLGFTFSIVSGLGIFGI 231

Query: 243 FSTNGSLIESSLFLGYIIRCFYEISPELSTSATTEILDNIKEAWQNHQGSITVTEHILFY 302
            S  GS IESSLF  YI+RC YEISP+L+TSA  EI + +K+ W N   S+  ++  L Y
Sbjct: 232 VSGRGSTIESSLFFAYIVRCLYEISPQLATSAMDEISNLVKDTWHNQHRSLRSSDTFLAY 291

Query: 303 YNNVLLKNINSSYLFNSNFSKSNDTSAKNRTLAEIQRSTNNYTLTDITKPSDLIHLIGFK 362
           Y +++LK  N   ++++  +++N   +    +A I                   H +   
Sbjct: 292 YRDIILK--NGEMIWDAVLARTNVNVSGAGPVAWIS-----------------WHRV--- 329

Query: 363 SIYQNWLIYATPIYELLKDFVLNIPTSLANLSQVTYKLAYDSVSPSIVINLCFRVLIFYS 422
                      P+++ +K F  ++P+S+  +  +T  +A ++++P++VINLCFR+LIFYS
Sbjct: 330 ----------QPLWKFVKHFTSSVPSSIQEIFLLTLSMAREAIAPAVVINLCFRILIFYS 379

Query: 423 ATRIIPAVQRKNHLETKRSRNFLKAFYLFSPCIVIAMYTNLILQYSGELKNDLCIWGCDI 482
           ATRIIPA+QRK+    +RSR F++  Y +SPCIVIAMYT+LI+QYSG++ NDLC+WGC  
Sbjct: 380 ATRIIPALQRKHK---RRSRRFMRMLYWYSPCIVIAMYTHLIMQYSGQISNDLCLWGCFP 436

Query: 483 ISKSISQRMSTINMDVGSDDTYPNREFIVNSWGFWNWCNIFCTIFIYGCELMG 535
            S     ++                  +V+SWGFWNWCNIFCT+ IY  EL G
Sbjct: 437 WSPPEGSKV------------------VVDSWGFWNWCNIFCTMAIYASELFG 471

>Ecym_3332 Chr3 (634314..635855) [1542 bp, 513 aa] {ON} similar to
           Ashbya gossypii ADL208W
          Length = 513

 Score =  368 bits (945), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 212/538 (39%), Positives = 306/538 (56%), Gaps = 38/538 (7%)

Query: 6   KSVKQSIRMLWGCFYLISVLITIPSAFKIGGLYCGLSFTMTLFHLYFLSTTMHLIAKRTL 65
           + + +SIR     FYL  VLITIP +F++GGLYCGLSFT+TLF LYF +TT+ +      
Sbjct: 4   RGLLRSIRFSLAIFYLFLVLITIPISFQVGGLYCGLSFTVTLFILYFTTTTLKITTTNGS 63

Query: 66  NNFYILLSTLVYYLQHIVIASLLYIFITIFSDGNLNEILSNNKTDQLPSLLYYIKN---- 121
             F  LL++L+YYLQH +I S+L++F++ F+   L  ++ ++          +  N    
Sbjct: 64  GKFK-LLASLIYYLQHFLIPSILFLFLSAFNSDQLQRLVDSDAVGASSKGFIFEGNVNES 122

Query: 122 ---DTSKSVSQNFHXXXXXXXXXXAVQPWNYLLSHSTPFFTLLEGFFTILGIQAIGETYC 178
                S                   V+PW Y+L H+TP+FTL EGFFT+L IQAIGET  
Sbjct: 123 LLQLLSLPPGNEGSVASYYYYYKYIVKPWQYMLLHATPYFTLTEGFFTVLAIQAIGETGR 182

Query: 179 WXXXXXXXXXXXXXTWLISVGVIFTAIHFLYKIYEFQVWELSIQTASLLGVTMSLVLTVG 238
           W             + L+S  VI T++ +LY+IY   +W LS+QTA+LLG T+SLV  +G
Sbjct: 183 WLRYKKNSNTWVILSLLVSGVVITTSMFYLYRIYVTPIWPLSVQTATLLGFTLSLVFGLG 242

Query: 239 IFGIFSTNGSLIESSLFLGYIIRCFYEISPELSTSATTEILDNIKEAWQNHQGSITVTEH 298
           ++GI S  GS IESSLF  Y++RC YEISP+L+ +A TEI   + + WQ  QG+++   +
Sbjct: 243 LYGIISGKGSTIESSLFFAYMVRCIYEISPQLALTAMTEIFQVVHDTWQLQQGTLS-KNN 301

Query: 299 ILFYYNNVLLKNINSSYLFNSNFSKSNDTSAKNRTLAEIQRSTNNYTLTDITKP-SDLIH 357
           +L YYN            F SN     D+  K   +     +   YT+   + P +  I 
Sbjct: 302 LLTYYNT-----------FVSNAESFWDSLLKKTAIGTAAAAEETYTIFGYSMPFTSTIA 350

Query: 358 LIGFKSIYQNWLIYATPIYELLKDFVLNIPTSLANLSQVTYKLAYDSVSPSIVINLCFRV 417
                 +   W +    I+   K+F + IP S+  +  VT K+A +S++P+++ NL FRV
Sbjct: 351 KDTLIILQTQWWLKCQQIWSFTKNFSVGIPRSIHEILMVTLKMAKESINPAVITNLVFRV 410

Query: 418 LIFYSATRIIPAVQRKNHLETKRSRNFLKAFYLFSPCIVIAMYTNLILQYSGELKNDLCI 477
           L+FYSATRIIPA+Q+       +SR  ++  Y +SPCIVIAMYT+LIL+YSGEL NDLCI
Sbjct: 411 LVFYSATRIIPALQKATG--ATQSRKLMRIIYWYSPCIVIAMYTHLILRYSGELNNDLCI 468

Query: 478 WGCDIISKSISQRMSTINMDVGSDDTYPNREFIVNSWGFWNWCNIFCTIFIYGCELMG 535
           WGC             +N    +       +++V++W FWNWCN+F T+ IY  EL+G
Sbjct: 469 WGC----------FPWLNFSAKTRS-----KWVVDAWSFWNWCNLFFTLLIYAVELIG 511

>TPHA0C03440 Chr3 (752685..754424) [1740 bp, 579 aa] {ON} Anc_2.293
           YIL090W
          Length = 579

 Score =  365 bits (936), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 225/558 (40%), Positives = 320/558 (57%), Gaps = 86/558 (15%)

Query: 18  CFYLISVLITIPSAFKIGGLYCGLSFTMTLFHLYFLSTTMHLIAKR-TLNNFYILLSTLV 76
            FYL+++++TIP +FKIGG+YCGLSFT TLF LYF+ST++ +I KR T N    LL++ +
Sbjct: 65  AFYLLNIVVTIPISFKIGGIYCGLSFTGTLFGLYFISTSVTIITKRLTHNTTLRLLASSL 124

Query: 77  YYLQHIVIASLLYIFITIFSDGNLNEILS---------NNKTDQLPSLLYYIK------- 120
           +Y+Q+ +I+SLL I++  F++ +L   L+          N T+    +L+ IK       
Sbjct: 125 FYIQNFIISSLLQIYLRGFNNKDLITALTFLDDYYYNEKNGTNTKYQILFIIKDYFVNIM 184

Query: 121 --------NDTSKSVSQNFHXXXXXXXXXXA--------------VQPWNYLLSHSTPFF 158
                   N  +K +                              ++PW +LL +STPFF
Sbjct: 185 NLILFREDNGLNKMLQLALKSEGNSVPDPQKLNSWILFFYYYYIFIKPWKFLLINSTPFF 244

Query: 159 TLLEGFFTILGIQAIGETYCWXXXXXXXXXXXXXTWLISVGVIFTAIHFLYKIYEFQVWE 218
           TLLEGFFTILGIQ IGET  W             + L S GVI   +++L +IY    W+
Sbjct: 245 TLLEGFFTILGIQTIGETNIWLKQQKHSSFWVILSLLSSGGVITATLYYLNRIYVTPFWD 304

Query: 219 LSIQTASLLGVTMSLVLTVGIFGIFSTNGSLIESSLFLGYIIRCFYEISPELSTSATTEI 278
           L++ TAS+LG T+S+V  +G+FGI S NGS IESSLF  YI+RC YE+SPEL+ SAT E 
Sbjct: 305 LTVSTASMLGFTLSIVGGLGVFGIVSKNGSAIESSLFFAYIVRCIYEMSPELAISATDEF 364

Query: 279 LDNIKEAWQNHQGSITVTEHILFYYNNVLLKNINS-SYLFNSNFSKSNDTSAKNRTLAEI 337
           L+   E WQ +Q  ITV +++L Y    ++   +S S + +  F K+           E+
Sbjct: 365 LEGFNEVWQMNQNRITVADNVLTYCKKYIMDAFSSFSSIEHHLFPKT----------IEL 414

Query: 338 QRSTNNYTLTDITKPSDLIHLIGFKSIYQNWLIYATPIYELLKDFVLNIPTSLANLSQVT 397
             S N            LI       + Q W+         LK+F +N+P+S+ +L Q+T
Sbjct: 415 GISKN------------LI-------VKQFWV--------FLKNFTINVPSSINDLIQIT 447

Query: 398 YKLAYDSVSPSIVINLCFRVLIFYSATRIIPAVQRKNHLETKRSRNFLKAFYLFSPCIVI 457
            ++A DS+SP+I+INL FR++IFYSATRIIPA+QR+   +      F+ A Y FSPC++I
Sbjct: 448 AQMAVDSISPAIIINLSFRLMIFYSATRIIPAIQRRTKPDAHDLTGFMSAVYWFSPCMLI 507

Query: 458 AMYTNLILQYSGELKNDLCIWGCDIISKSISQRMSTINMDVGSDDTYPNREFIVNSWGFW 517
           AMYT+LILQ+SGELK ++C+W C+    S S   ST   ++G +        IV+SW FW
Sbjct: 508 AMYTHLILQFSGELKKNICLWNCENWLSSSSDVKST---NLGDN------SIIVDSWSFW 558

Query: 518 NWCNIFCTIFIYGCELMG 535
           NWCNIF TI IY  EL+G
Sbjct: 559 NWCNIFWTIIIYASELIG 576

>ADL208W Chr4 (337118..338626) [1509 bp, 502 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL090W
          Length = 502

 Score =  360 bits (924), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 208/546 (38%), Positives = 310/546 (56%), Gaps = 61/546 (11%)

Query: 4   VVKSVKQSIRMLWGCFYLISVLITIPSAFKIGGLYCGLSFTMTLFHLYFLSTTMHLIAKR 63
           V K + +S+R     FYL  VLIT+P +F+IGGLYCGLSFT+TLF LYF++TT+ + A  
Sbjct: 2   VPKGLLRSLRFALASFYLFLVLITVPISFQIGGLYCGLSFTVTLFILYFVTTTLKITAAT 61

Query: 64  TLNNFYILLSTLVYYLQHIVIASLLYIFITIFSDGNLNE--------------ILSNNKT 109
             + +  + STL YYLQH ++ S+L++F++ F++  L +              I   N  
Sbjct: 62  RGDEWKHIASTL-YYLQHFLMPSILFLFLSGFNNDQLQKKLVGSDPKGARGGFIFDGNMN 120

Query: 110 DQLPSLLYYIKNDTSKSVSQNFHXXXXXXXXXXAVQPWNYLLSHSTPFFTLLEGFFTILG 169
           + L  LL   ++D +     +++           V+PW Y+L H+TP FTL EGFFT+L 
Sbjct: 121 ESLLQLLGRSRDDRATMAYLHYYRY--------VVRPWQYMLLHATPCFTLTEGFFTVLA 172

Query: 170 IQAIGETYCWXXXXXXXXXXXXXTWLISVGVIFTAIHFLYKIYEFQVWELSIQTASLLGV 229
           IQ IGET  W             + ++S  VI T++++LY+IY   +W LS+ TA+LLG 
Sbjct: 173 IQVIGETGRWLRYKRNSTAWVISSLMVSGVVITTSMYYLYRIYVTPIWPLSVHTATLLGF 232

Query: 230 TMSLVLTVGIFGIFSTNGSLIESSLFLGYIIRCFYEISPELSTSATTEILDNIKEAWQNH 289
           T+SLV  +G++GI S  GS IESSLF  Y++ C YEISP+L+ +A +EI   +   WQ  
Sbjct: 233 TLSLVFGLGLYGIISGKGSAIESSLFFAYMVHCIYEISPQLALTAMSEIFQVVHNTWQMQ 292

Query: 290 QGSITVTEHILFYYNNVLLKNINSSYLFNSNFSKSNDTSAKNRTLAEIQRSTNNYTLTDI 349
           QG++     +L YY N +L                   +A+N     ++++   +++   
Sbjct: 293 QGTLP-KNSLLAYYKNFIL-------------------NAENLWDVLLKKAFLLHSVELD 332

Query: 350 TKPSDLIHLIGFKSIYQNWLIYATPIYELLKDFVLNIPTSLANLSQVTYKLAYDSVSPSI 409
             PS ++       + Q W   +  ++   K+F   IP S+  +  VT  LA +S++ ++
Sbjct: 333 QAPSSVVVKDALVLVQQQWWNKSQQLWSFTKNFSAGIPRSIHEIFIVTLGLARESINAAV 392

Query: 410 VINLCFRVLIFYSATRIIPAVQRKNHLETKRSRNFLKAFYLFSPCIVIAMYTNLILQYSG 469
           V NL FRV++FYSATRIIPA+QR       +SR  ++  Y +SPCIVIAMYT++IL+YSG
Sbjct: 393 VSNLVFRVIVFYSATRIIPALQRAT--GGTQSRKLMRIIYWYSPCIVIAMYTHMILRYSG 450

Query: 470 ELKNDLCIWGCDIISKSISQRMSTINMDVGSDDTYPNREFIVNSWGFWNWCNIFCTIFIY 529
           EL N+LCIWGC           S  N D           ++V++WGFWNWCN+F T+ IY
Sbjct: 451 ELNNELCIWGC------FPWLQSEANRD----------RWVVDAWGFWNWCNLFFTLLIY 494

Query: 530 GCELMG 535
             EL+G
Sbjct: 495 AVELIG 500

>TBLA0B05980 Chr2 (1412745..1414226) [1482 bp, 493 aa] {ON}
           Anc_2.293 YIL090W
          Length = 493

 Score =  351 bits (901), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 215/544 (39%), Positives = 318/544 (58%), Gaps = 63/544 (11%)

Query: 1   MPWVVKSVKQSIRMLWGCFYLISVLITIPSAFKIGGLYCGLSFTMTLFHLYFLSTTMHLI 60
           M  V+K++ +S R  +   YL+SVL+T+P AF++GGL CGL+FT+TLF  YF++TT++ I
Sbjct: 1   MSQVLKNLGESTRFFFAGIYLLSVLMTVPIAFQLGGLQCGLAFTLTLFSSYFITTTLNAI 60

Query: 61  AKRTLNNFYILLSTLVYYLQHIVIASLLYIFITIFSDGNLNEILS--NNKTDQLPSLLYY 118
           A++     +I  +  +YY Q+  I  +L+IF+++FS   L+  +S  N   + + S+L  
Sbjct: 61  ARKLRWQRFIAWTNFLYYFQNFNIIGILHIFLSLFSHTELSISMSDENPSMETITSILK- 119

Query: 119 IKNDTSKSVSQNFHXXXXXXXXXXAVQPWNYLLSHSTPFFTLLEGFFTILGIQAIGETYC 178
             NDT  S + +F           A+  W + LS+STP F L+EGFFTIL IQ IGET  
Sbjct: 120 -NNDTYPSKTISF---IYKYFFYYAMPRWKFCLSYSTPLFALVEGFFTILAIQVIGETNI 175

Query: 179 WXXXXXXXXXXXXXTWLISVGVIFTAIHFLYKIYEFQVWELSIQTASLLGVTMSLVLTVG 238
           W             + ++S  ++ T+I+++YKIY   +W LS Q ASLL  T SLV  V 
Sbjct: 176 WLTTVKNSSIWIILSLIMSSSMVTTSIYYIYKIYVTPLWHLSNQVASLLSFTFSLVGGVA 235

Query: 239 IFGIFSTNGSLIESSLFLGYIIRCFYEISPELSTSATTEILDNIKEAWQNHQGSITVTEH 298
           I+GI S  GS++ESSLF  YI+ C YEISP ++T+A  +I D +KE+WQ HQ +  ++++
Sbjct: 236 IYGIVSHRGSVVESSLFFAYIVCCIYEISPIMATTAMDDIFDTLKESWQIHQRNFFISDN 295

Query: 299 ILFYYNNVLLKNINSSYLFNS-NFSKSNDTSAKNRTLAEIQRSTNNYTLTDITKPSDLIH 357
           +L YY N L+KN++          +  ++ S K  +L         +    I+K S    
Sbjct: 296 LLIYYYNSLIKNVDEFIKLKIIKLTTKDNFSNKFNSLL--------FQCVKISKKS---- 343

Query: 358 LIGFKSIYQNWLIYATPIYELLKDFVLNIPTSLANLSQVTYKLAYDSVSPSIVINLCFRV 417
              FK I +           L K F L IP+S+  L  +T K+A +S+SP I++NLC+RV
Sbjct: 344 ---FKFILK-----------LSKRFTLGIPSSIYELYSITLKMASESISPVILVNLCYRV 389

Query: 418 LIFYSATRIIPAVQRK------NHLETKRSRNFLKAFYLFSPCIVIAMYTNLILQYSGEL 471
           LIFY+ATRIIPA++ +      N+++TK +  F+K  Y +SPCI+IAMYTNLILQYSGEL
Sbjct: 390 LIFYAATRIIPALESRSNGFSNNNIKTKSNSKFMKVLYWYSPCILIAMYTNLILQYSGEL 449

Query: 472 KNDLCIWGCDIISKSISQRMSTINMDVGSDDTYPNREFIVNSWGFWNWCNIFCTIFIYGC 531
           K++  +W     ++                        +V+SW FWNWCNIF TI +YG 
Sbjct: 450 KSEFKLWNNSNNNEV-----------------------VVDSWRFWNWCNIFWTITLYGS 486

Query: 532 ELMG 535
           EL+G
Sbjct: 487 ELIG 490

>KLLA0E08207g Chr5 complement(740213..741673) [1461 bp, 486 aa] {ON}
           similar to uniprot|P40499 Saccharomyces cerevisiae
           YIL090W ICE2 Integral ER membrane protein with type-III
           transmembrane domains mutations cause defects in
           cortical ER morphology in both the mother and daughter
           cells
          Length = 486

 Score =  346 bits (888), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 210/535 (39%), Positives = 303/535 (56%), Gaps = 91/535 (17%)

Query: 1   MPWVVKSVKQSIRMLWGCFYLISVLITIPSAFKIGGLYCGLSFTMTLFHLYFLSTTMHLI 60
           MP + KSV Q++R+     YL  VLITIP +F++GGL CGLSFT+TLF LYF+STT  L+
Sbjct: 40  MPLIKKSVLQTLRIFLTTMYLFLVLITIPISFQVGGLNCGLSFTVTLFALYFVSTTFKLV 99

Query: 61  AKRTLNNFYILLSTLVYYLQHIVIASLLYIFITIFSDGNLNEILSNNKTDQLPSLLYYIK 120
               L +    LSTL+YYLQH++I S+L++F++ F +                     I 
Sbjct: 100 ----LLDRGSALSTLIYYLQHLLIPSILFMFLSYFEN---------------------ID 134

Query: 121 NDTSKSVSQNFHXXXXXXXXXXAVQPWNYLLSHSTPFFTLLEGFFTILGIQAIGETYCWX 180
           +DT  S                 V+PW   L HSTP FTLLEG FTIL IQAIGET  W 
Sbjct: 135 SDTVDS-------EYFKVFWNVMVKPWQLSLIHSTPVFTLLEGVFTILAIQAIGETERWL 187

Query: 181 XXXXXXXXXXXXTWLISVGVIFTAIHFLYKIYEFQVWELSIQTASLLGVTMSLVLTVGIF 240
                       + LIS G+I  ++ + Y+IY   +WELS  +ASLLG T S+V  +G++
Sbjct: 188 KMSRRSNQWVILSLLISGGIITLSLFYFYRIYVTPMWELSTPSASLLGFTFSIVCGIGLY 247

Query: 241 GIFSTNGSLIESSLFLGYIIRCFYEISPELSTSATTEILDNIKEAWQNHQGSITVTEHIL 300
           GI + +GS++ESSLF  Y++R  YEISP+++ +A  EI D +KE W+ HQ ++   +++L
Sbjct: 248 GI-NGSGSVMESSLFFAYMVRNVYEISPKMAMNAMDEIFDIVKETWKIHQANLPKKDNLL 306

Query: 301 FYYNNVLLKNINSSYLFNSNFSKSNDTSAKNRTLAEIQRSTNNYTLTDITKPSDLIHLIG 360
                ++ KN      + + +S+  + + +N    ++                       
Sbjct: 307 ----ELMTKN------YRAIWSQIVEHTPRNHKYIKMMDQCK------------------ 338

Query: 361 FKSIYQNWLIYATPIYELLKDFVLNIPTSLANLSQVTYKLAYDSVSPSIVINLCFRVLIF 420
                  W++   P++  +K+F  ++P S+  +  VT+K+A +S+ P++VINL FR+LIF
Sbjct: 339 -------WIL--NPLWNSVKNFTKSVPISIQEIFVVTFKMAKESLIPAVVINLVFRLLIF 389

Query: 421 YSATRIIPAVQRKNHLETKRSRNFLKAFYLFSPCIVIAMYTNLILQYSGELKNDLCIWGC 480
           YSATRIIP +QR N  E +  R  +   Y +SPCI+IAMYT+LIL+YSG+LKNDLCIWGC
Sbjct: 390 YSATRIIPTLQR-NTKERRSFRRIMNFVYWYSPCIIIAMYTHLILRYSGQLKNDLCIWGC 448

Query: 481 DIISKSISQRMSTINMDVGSDDTYPNREFIVNSWGFWNWCNIFCTIFIYGCELMG 535
                                +T P  + +V+SW FWNWCNI+ T+ IY  ELMG
Sbjct: 449 ------------------FPYETEP--KIVVDSWSFWNWCNIYSTMLIYALELMG 483

>Ecym_2582 Chr2 complement(1134823..1135713) [891 bp, 296 aa] {ON}
           similar to Ashbya gossypii AFR250C
          Length = 296

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 64/137 (46%), Gaps = 14/137 (10%)

Query: 293 ITVTEHILFYYNNVLLKNINSSYLFN-SNFSKSNDTSAKNRTLAEIQRSTNNYTLTDITK 351
           +++ E  L YY   L K+IN + L N S  SKS + S +++   E++   NN TL D TK
Sbjct: 56  MSLLEEKLEYYAQEL-KDINGAELDNPSENSKSEELSIEDQVKNELEELRNNATLVDRTK 114

Query: 352 PSDLIHLIGFKSIYQNWLIYATPIYELLKDFVLNIPTSLANLSQVTYKLAY-DSVSP--- 407
              ++  I  +S    +     PI    ++FVL I   LA+ +  + +  Y   ++P   
Sbjct: 115 KKPILQQIPLESECMVFFKTRKPIN--PENFVLRIIQELASPTMNSKRTRYIQKLTPITS 172

Query: 408 ------SIVINLCFRVL 418
                   +  LC RVL
Sbjct: 173 SCNASLEELTKLCQRVL 189

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.139    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,098,845
Number of extensions: 2326578
Number of successful extensions: 11524
Number of sequences better than 10.0: 59
Number of HSP's gapped: 11832
Number of HSP's successfully gapped: 68
Length of query: 536
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 422
Effective length of database: 40,409,475
Effective search space: 17052798450
Effective search space used: 17052798450
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 68 (30.8 bits)