Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0B069602.286ON50850824620.0
NDAI0G006602.286ON49651016700.0
TPHA0C034002.286ON49450816240.0
Kpol_1003.382.286ON49650816150.0
KAFR0H033102.286ON48850816030.0
Skud_14.3072.286ON49050615890.0
YNL022C2.286ON49051015660.0
Suva_14.3252.286ON49050715600.0
KNAG0H020002.286ON49850915560.0
KLLA0E08361g2.286ON49150815480.0
NCAS0G037902.286ON49250915440.0
Smik_14.3092.286ON49050615330.0
TDEL0G021702.286ON48450615190.0
KLTH0G10362g2.286ON52950815080.0
SAKL0E07678g2.286ON47750714970.0
Kwal_27.115322.286ON47950714940.0
ZYRO0A01892g2.286ON46551014770.0
CAGL0M06941g2.286ON49250914790.0
Ecym_33252.286ON49650714740.0
ADL215W2.286ON48450814150.0
SAKL0E08624g2.247ON6112491581e-10
ADL254W2.247ON6032851582e-10
ZYRO0A01562g2.247ON6172571562e-10
TDEL0B043908.171ON6733141553e-10
KNAG0I018702.247ON6292571545e-10
KAFR0J009702.247ON6102571535e-10
ZYRO0G08998g8.171ON6833111537e-10
AFR179C8.171ON7003091528e-10
KLLA0F03399g2.247ON6192571511e-09
CAGL0J10032g2.247ON6192571501e-09
Kpol_1003.152.247ON6332581501e-09
YNL061W (NOP2)2.247ON6182571482e-09
Kpol_1002.1098.171ON6703101482e-09
Smik_14.2662.247ON6182571482e-09
Ecym_32842.247ON6062581473e-09
NDAI0B018308.171ON6863121473e-09
NCAS0G030302.247ON4902571463e-09
KLTH0G09460g2.247ON6372541473e-09
NDAI0D010502.247ON6252571474e-09
TDEL0C041502.247ON6142571464e-09
KNAG0D020508.171ON6823101464e-09
TPHA0C031502.247ON6082541455e-09
Suva_14.2802.247ON6202571456e-09
Skud_14.2712.247ON6192461439e-09
NCAS0B043908.171ON6713131439e-09
KNAG0G015108.171ON6663081439e-09
Kwal_23.48412.247ON6272541431e-08
TPHA0H001508.171ON6493161421e-08
Suva_2.978.171ON6703141421e-08
TBLA0E038502.247ON6322571412e-08
NCAS0B056408.171ON6593101393e-08
KAFR0B022208.171ON6863101375e-08
Skud_2.818.171ON6813111376e-08
Smik_2.928.171ON6743141359e-08
YBL024W (NCL1)8.171ON6843141351e-07
Ecym_23538.171ON6903071332e-07
SAKL0H19448g8.171ON6913071322e-07
KLTH0H08096g8.171ON6883091286e-07
KLLA0F12562g8.171ON7043121261e-06
TPHA0C028708.171ON6743121261e-06
CAGL0K01991g8.171ON6723071252e-06
TBLA0A087408.171ON6863141223e-06
NDAI0B029808.171ON6793121224e-06
Kwal_14.20818.171ON272124940.005
SAKL0D08712g1.401ON312117800.31
TPHA0A019208.237ON77356790.48
Ecym_30036.1ON31978770.59
CAGL0L11924g8.237ON77556780.75
ZYRO0B11836g8.237ON77056770.97
SAKL0E00660g6.1ON32278751.1
Smik_5.3438.237ON77556761.3
Suva_5.3058.237ON77756761.3
Skud_5.3108.237ON77556751.3
YER171W (RAD3)8.237ON77856751.3
TBLA0A014408.453ON52231751.5
TBLA0H018805.370ON170862751.5
Kpol_449.126.1ON31981731.9
Smik_6.4746.1ON31878732.0
Skud_16.116.1ON31878732.3
KNAG0D002606.362ON39775732.3
YPL266W (DIM1)6.1ON31878722.4
Suva_16.396.1ON31878722.8
Skud_4.6965.527ON81173714.4
CAGL0L07678g6.1ON31778704.5
KAFR0B064506.1ON31881704.5
YGR090W (UTP22)3.426ON1237150714.7
KAFR0B066506.174ON57248705.0
Kwal_55.204613.456ON40040705.2
KNAG0L024406.1ON31785696.2
ZYRO0F00308g6.1ON31978687.2
Kwal_26.79142.506ON54786697.3
KLLA0D04884g1.401ON318113688.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0B06960
         (508 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0B06960 Chr2 (1646966..1648492) [1527 bp, 508 aa] {ON} Anc_2...   952   0.0  
NDAI0G00660 Chr7 (144471..145961) [1491 bp, 496 aa] {ON} Anc_2.2...   647   0.0  
TPHA0C03400 Chr3 (747016..748500) [1485 bp, 494 aa] {ON} Anc_2.2...   630   0.0  
Kpol_1003.38 s1003 (94479..95969) [1491 bp, 496 aa] {ON} (94479....   626   0.0  
KAFR0H03310 Chr8 complement(630597..632063) [1467 bp, 488 aa] {O...   622   0.0  
Skud_14.307 Chr14 complement(562104..563576) [1473 bp, 490 aa] {...   616   0.0  
YNL022C Chr14 complement(591427..592899) [1473 bp, 490 aa] {ON} ...   607   0.0  
Suva_14.325 Chr14 complement(574309..575781) [1473 bp, 490 aa] {...   605   0.0  
KNAG0H02000 Chr8 complement(353074..354570) [1497 bp, 498 aa] {O...   603   0.0  
KLLA0E08361g Chr5 complement(751889..753364) [1476 bp, 491 aa] {...   600   0.0  
NCAS0G03790 Chr7 complement(699962..701440) [1479 bp, 492 aa] {O...   599   0.0  
Smik_14.309 Chr14 complement(553805..555277) [1473 bp, 490 aa] {...   595   0.0  
TDEL0G02170 Chr7 (427274..428728) [1455 bp, 484 aa] {ON} Anc_2.2...   589   0.0  
KLTH0G10362g Chr7 (876756..878345) [1590 bp, 529 aa] {ON} highly...   585   0.0  
SAKL0E07678g Chr5 complement(621183..622616) [1434 bp, 477 aa] {...   581   0.0  
Kwal_27.11532 s27 complement(837572..839011) [1440 bp, 479 aa] {...   580   0.0  
ZYRO0A01892g Chr1 (156967..158364) [1398 bp, 465 aa] {ON} simila...   573   0.0  
CAGL0M06941g Chr13 complement(706878..708356) [1479 bp, 492 aa] ...   574   0.0  
Ecym_3325 Chr3 (623214..624704) [1491 bp, 496 aa] {ON} similar t...   572   0.0  
ADL215W Chr4 (326584..328038) [1455 bp, 484 aa] {ON} Syntenic ho...   549   0.0  
SAKL0E08624g Chr5 complement(704579..706414) [1836 bp, 611 aa] {...    65   1e-10
ADL254W Chr4 (253602..255413) [1812 bp, 603 aa] {ON} Syntenic ho...    65   2e-10
ZYRO0A01562g Chr1 (128145..129998) [1854 bp, 617 aa] {ON} simila...    65   2e-10
TDEL0B04390 Chr2 (769749..771770) [2022 bp, 673 aa] {ON} Anc_8.1...    64   3e-10
KNAG0I01870 Chr9 complement(366800..368689) [1890 bp, 629 aa] {O...    64   5e-10
KAFR0J00970 Chr10 (174873..176705) [1833 bp, 610 aa] {ON} Anc_2....    64   5e-10
ZYRO0G08998g Chr7 complement(726070..728121) [2052 bp, 683 aa] {...    64   7e-10
AFR179C Chr6 complement(766458..768560) [2103 bp, 700 aa] {ON} S...    63   8e-10
KLLA0F03399g Chr6 (319007..320866) [1860 bp, 619 aa] {ON} simila...    63   1e-09
CAGL0J10032g Chr10 (983405..985264) [1860 bp, 619 aa] {ON} highl...    62   1e-09
Kpol_1003.15 s1003 (41683..43584) [1902 bp, 633 aa] {ON} (41683....    62   1e-09
YNL061W Chr14 (510540..512396) [1857 bp, 618 aa] {ON}  NOP2Proba...    62   2e-09
Kpol_1002.109 s1002 (272892..274904) [2013 bp, 670 aa] {ON} (272...    62   2e-09
Smik_14.266 Chr14 (490908..492764) [1857 bp, 618 aa] {ON} YNL061...    62   2e-09
Ecym_3284 Chr3 (537227..539047) [1821 bp, 606 aa] {ON} similar t...    61   3e-09
NDAI0B01830 Chr2 (436254..438314) [2061 bp, 686 aa] {ON} Anc_8.1...    61   3e-09
NCAS0G03030 Chr7 (556908..558380) [1473 bp, 490 aa] {ON} Anc_2.2...    61   3e-09
KLTH0G09460g Chr7 (787197..789110) [1914 bp, 637 aa] {ON} simila...    61   3e-09
NDAI0D01050 Chr4 (236435..238312) [1878 bp, 625 aa] {ON} Anc_2.2...    61   4e-09
TDEL0C04150 Chr3 complement(734914..736758) [1845 bp, 614 aa] {O...    61   4e-09
KNAG0D02050 Chr4 (339873..341921) [2049 bp, 682 aa] {ON} Anc_8.1...    61   4e-09
TPHA0C03150 Chr3 (697508..699334) [1827 bp, 608 aa] {ON} Anc_2.2...    60   5e-09
Suva_14.280 Chr14 (509488..511350) [1863 bp, 620 aa] {ON} YNL061...    60   6e-09
Skud_14.271 Chr14 (500809..502668) [1860 bp, 619 aa] {ON} YNL061...    60   9e-09
NCAS0B04390 Chr2 complement(795633..797648) [2016 bp, 671 aa] {O...    60   9e-09
KNAG0G01510 Chr7 complement(341469..343469) [2001 bp, 666 aa] {O...    60   9e-09
Kwal_23.4841 s23 (890138..892021) [1884 bp, 627 aa] {ON} YNL061W...    60   1e-08
TPHA0H00150 Chr8 (15977..17926) [1950 bp, 649 aa] {ON} Anc_8.171...    59   1e-08
Suva_2.97 Chr2 (172667..174679) [2013 bp, 670 aa] {ON} YBL024W (...    59   1e-08
TBLA0E03850 Chr5 (967569..969467) [1899 bp, 632 aa] {ON} Anc_2.2...    59   2e-08
NCAS0B05640 Chr2 complement(1068983..1070962) [1980 bp, 659 aa] ...    58   3e-08
KAFR0B02220 Chr2 complement(438809..440869) [2061 bp, 686 aa] {O...    57   5e-08
Skud_2.81 Chr2 (156273..158318) [2046 bp, 681 aa] {ON} YBL024W (...    57   6e-08
Smik_2.92 Chr2 (166201..168225) [2025 bp, 674 aa] {ON} YBL024W (...    57   9e-08
YBL024W Chr2 (172534..174588) [2055 bp, 684 aa] {ON}  NCL1S-aden...    57   1e-07
Ecym_2353 Chr2 complement(691422..693494) [2073 bp, 690 aa] {ON}...    56   2e-07
SAKL0H19448g Chr8 (1713663..1715738) [2076 bp, 691 aa] {ON} high...    55   2e-07
KLTH0H08096g Chr8 (706261..708327) [2067 bp, 688 aa] {ON} simila...    54   6e-07
KLLA0F12562g Chr6 (1163366..1165480) [2115 bp, 704 aa] {ON} high...    53   1e-06
TPHA0C02870 Chr3 (620913..622937) [2025 bp, 674 aa] {ON} Anc_8.1...    53   1e-06
CAGL0K01991g Chr11 (173969..175987) [2019 bp, 672 aa] {ON} highl...    53   2e-06
TBLA0A08740 Chr1 (2141750..2143810) [2061 bp, 686 aa] {ON} Anc_8...    52   3e-06
NDAI0B02980 Chr2 complement(757926..759965) [2040 bp, 679 aa] {O...    52   4e-06
Kwal_14.2081 s14 (598648..599463) [816 bp, 272 aa] {ON} YBL024W ...    41   0.005
SAKL0D08712g Chr4 complement(724741..725679) [939 bp, 312 aa] {O...    35   0.31 
TPHA0A01920 Chr1 complement(387645..389966) [2322 bp, 773 aa] {O...    35   0.48 
Ecym_3003 Chr3 complement(6934..7893) [960 bp, 319 aa] {ON} simi...    34   0.59 
CAGL0L11924g Chr12 (1279776..1282103) [2328 bp, 775 aa] {ON} hig...    35   0.75 
ZYRO0B11836g Chr2 (940987..943299) [2313 bp, 770 aa] {ON} highly...    34   0.97 
SAKL0E00660g Chr5 complement(42779..43747) [969 bp, 322 aa] {ON}...    33   1.1  
Smik_5.343 Chr5 (526697..529024) [2328 bp, 775 aa] {ON} YER171W ...    34   1.3  
Suva_5.305 Chr5 (494912..497245) [2334 bp, 777 aa] {ON} YER171W ...    34   1.3  
Skud_5.310 Chr5 (512188..514515) [2328 bp, 775 aa] {ON} YER171W ...    33   1.3  
YER171W Chr5 (527082..529418) [2337 bp, 778 aa] {ON}  RAD35' to ...    33   1.3  
TBLA0A01440 Chr1 (336642..338210) [1569 bp, 522 aa] {ON} Anc_8.4...    33   1.5  
TBLA0H01880 Chr8 (441695..446821) [5127 bp, 1708 aa] {ON} Anc_5....    33   1.5  
Kpol_449.12 s449 complement(42834..43793) [960 bp, 319 aa] {ON} ...    33   1.9  
Smik_6.474 Chr6 complement(781184..782140) [957 bp, 318 aa] {ON}...    33   2.0  
Skud_16.11 Chr16 (18214..19170) [957 bp, 318 aa] {ON} YPL266W (R...    33   2.3  
KNAG0D00260 Chr4 complement(35036..36229) [1194 bp, 397 aa] {ON}...    33   2.3  
YPL266W Chr16 (39121..40077) [957 bp, 318 aa] {ON}  DIM1Essentia...    32   2.4  
Suva_16.39 Chr16 (54705..55661) [957 bp, 318 aa] {ON} YPL266W (R...    32   2.8  
Skud_4.696 Chr4 complement(1236293..1238728) [2436 bp, 811 aa] {...    32   4.4  
CAGL0L07678g Chr12 complement(846285..847238) [954 bp, 317 aa] {...    32   4.5  
KAFR0B06450 Chr2 complement(1337903..1338859) [957 bp, 318 aa] {...    32   4.5  
YGR090W Chr7 (662358..666071) [3714 bp, 1237 aa] {ON}  UTP22Poss...    32   4.7  
KAFR0B06650 Chr2 complement(1386066..1387784) [1719 bp, 572 aa] ...    32   5.0  
Kwal_55.20461 s55 complement(412840..414042) [1203 bp, 400 aa] {...    32   5.2  
KNAG0L02440 Chr12 (434232..435185) [954 bp, 317 aa] {ON} Anc_6.1...    31   6.2  
ZYRO0F00308g Chr6 complement(32198..33157) [960 bp, 319 aa] {ON}...    31   7.2  
Kwal_26.7914 s26 complement(565158..566801) [1644 bp, 547 aa] {O...    31   7.3  
KLLA0D04884g Chr4 (419435..420391) [957 bp, 318 aa] {ON} similar...    31   8.0  

>TBLA0B06960 Chr2 (1646966..1648492) [1527 bp, 508 aa] {ON}
           Anc_2.286 YNL022C
          Length = 508

 Score =  952 bits (2462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/508 (92%), Positives = 472/508 (92%)

Query: 1   MNFYRDATWVLEHLEAQDXXXXXXXXXXXXXXXXCKQFKIQSNPKHVYAVVESAWKFKPF 60
           MNFYRDATWVLEHLEAQD                CKQFKIQSNPKHVYAVVESAWKFKPF
Sbjct: 1   MNFYRDATWVLEHLEAQDKKGRVSGSLLSLVVKSCKQFKIQSNPKHVYAVVESAWKFKPF 60

Query: 61  IERIMAKSGILDDIPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKTR 120
           IERIMAKSGILDDIPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKTR
Sbjct: 61  IERIMAKSGILDDIPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKTR 120

Query: 121 LHSEXXXXXXXXXXTNLNDMINAXXXXXXXXXXITPVRWIRINPIRIPKQKSSDDIILEL 180
           LHSE          TNLNDMINA          ITPVRWIRINPIRIPKQKSSDDIILEL
Sbjct: 121 LHSELVKLKLKLKVTNLNDMINANSNSNDSTDDITPVRWIRINPIRIPKQKSSDDIILEL 180

Query: 181 RKKFTTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAH 240
           RKKFTTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAH
Sbjct: 181 RKKFTTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAH 240

Query: 241 ILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKM 300
           ILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKM
Sbjct: 241 ILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKM 300

Query: 301 VKIAGCKKLVEINTGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNINSNKKLTE 360
           VKIAGCKKLVEINTGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNINSNKKLTE
Sbjct: 301 VKIAGCKKLVEINTGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNINSNKKLTE 360

Query: 361 KVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYST 420
           KVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYST
Sbjct: 361 KVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYST 420

Query: 421 CSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKNDPAMDPK 480
           CSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKNDPAMDPK
Sbjct: 421 CSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKNDPAMDPK 480

Query: 481 QLAEGCIRTLPKEDGGIGFFAVCFERNI 508
           QLAEGCIRTLPKEDGGIGFFAVCFERNI
Sbjct: 481 QLAEGCIRTLPKEDGGIGFFAVCFERNI 508

>NDAI0G00660 Chr7 (144471..145961) [1491 bp, 496 aa] {ON} Anc_2.286
           YNL022C
          Length = 496

 Score =  647 bits (1670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/510 (61%), Positives = 394/510 (77%), Gaps = 18/510 (3%)

Query: 1   MNFYRDATWVLEHLEAQDXXXXXXXXXXXXXXXXCKQFKIQSNPKHVYAVVESAWKFKPF 60
           MNFYRDATWVLE++E Q+                C ++K++ NPKHVYAV++S WK+KP+
Sbjct: 1   MNFYRDATWVLEYVEQQEAKGRISGSLQTLVLQSCTKYKLKCNPKHVYAVIDSCWKYKPY 60

Query: 61  IERIMAKSGILDDIPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKTR 120
           +E++M KSGILDDIPKKKGKP+Y RLTL+LL HDL+FSKS+RIQMGKHPIK +VL +K+R
Sbjct: 61  LEKVMKKSGILDDIPKKKGKPMYSRLTLMLLCHDLLFSKSKRIQMGKHPIKEYVLKHKSR 120

Query: 121 LHSEXXXXXXXXXXTNLNDMINAXXXXXXXXXXITPVRWIRINPIRIPKQKSSDDIILEL 180
           LHSE           NL+++++           +TPVRWIRINP+R  + +  + ++ EL
Sbjct: 121 LHSELVRLKLKLKVKNLSEIVD----NNDSTEDVTPVRWIRINPLRCYQGRDVNAVLEEL 176

Query: 181 RKKFTTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAH 240
            KKF  +V++W+ I PG IYYDEYIP+L+GI P DKITSHELYK GKIIIQDRASCFPAH
Sbjct: 177 GKKFPKRVENWNDIVPGSIYYDEYIPHLYGIHPQDKITSHELYKQGKIIIQDRASCFPAH 236

Query: 241 ILNATPDDYIIDACAAPGNKTTHVASYIM--SLNNDTHINFDKKRVFAFEKDPERSKILD 298
           ILN + DD IIDACAAPGNKTTHVASY+   +   D H+     +++AFEKDPER+KIL+
Sbjct: 237 ILNPSKDDIIIDACAAPGNKTTHVASYMFGDAKQEDPHV-----QIYAFEKDPERAKILE 291

Query: 299 KMVKIAGCKKLVEINTGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNIN--SNK 356
           KM+K+AGC K +++  GDFTK ATP+K+ +VTGFIVDPSCSGSGIFGRK++D++N   N 
Sbjct: 292 KMIKVAGCSKNIQVTVGDFTKAATPDKFKDVTGFIVDPSCSGSGIFGRKYVDSLNRQRNN 351

Query: 357 KLTEKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKI 416
             T+K K   E+D++ +P EQE   +   K+DL+TRL+KLSSFQFQV+KHAMSFP+AKKI
Sbjct: 352 DTTDKDKKSTEEDDE-VPDEQE---DYNKKEDLKTRLAKLSSFQFQVIKHAMSFPTAKKI 407

Query: 417 VYSTCSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKNDPA 476
           VYSTCSIHAEENERVV+DLLLD KVK+WGWKV  +   IPTW RRG + EFE+VF++DPA
Sbjct: 408 VYSTCSIHAEENERVVLDLLLDSKVKQWGWKVAAKESVIPTWPRRGKIEEFEEVFRDDPA 467

Query: 477 MDPKQLAEGCIRTLPKEDGGIGFFAVCFER 506
              + LA+GCIR LP++DGGIGFFAVCFER
Sbjct: 468 K-CQALADGCIRALPRDDGGIGFFAVCFER 496

>TPHA0C03400 Chr3 (747016..748500) [1485 bp, 494 aa] {ON} Anc_2.286
           YNL022C
          Length = 494

 Score =  630 bits (1624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/508 (61%), Positives = 379/508 (74%), Gaps = 14/508 (2%)

Query: 1   MNFYRDATWVLEHLEAQDXXXXXXXXXXXXXXXXCKQFKIQSNPKHVYAVVESAWKFKPF 60
           MNFYRDATWVLE LE +D                CK +K+QSNPKH+YAV+ S WK+KP+
Sbjct: 1   MNFYRDATWVLEFLEKEDAKGKISGSMQSIVLKSCKIYKVQSNPKHIYAVMASCWKYKPY 60

Query: 61  IERIMAKSGILDDIPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKTR 120
           +E IM KSGIL++IPKK GKP ++RLT+LLL HDL+FSKS+RIQMGKHP+K +VL YKT 
Sbjct: 61  LETIMKKSGILNNIPKKNGKPRFERLTILLLCHDLLFSKSKRIQMGKHPLKEYVLKYKTS 120

Query: 121 LHSEXXXXXXXXXXTNLNDMINAXXXXXXXXXXITPVRWIRINPIRIPKQKSSDDIILEL 180
           L SE           +  D+I++          ITPVRW RINPIR P  K  + I+ EL
Sbjct: 121 LRSEMVKLQVKMKLKSWGDLISSQDDAND----ITPVRWFRINPIRTPLSKGVEGILEEL 176

Query: 181 RKKFTTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAH 240
            KKF T+VDHWSKI+ G IY+DE+IPNLFG+   DKITSHELYK GKIIIQDRASCFPAH
Sbjct: 177 EKKFPTRVDHWSKIEQGTIYHDEFIPNLFGVHTKDKITSHELYKQGKIIIQDRASCFPAH 236

Query: 241 ILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKM 300
           +LN   DD +ID+CAAPGNKTTH A+YI+   +       K ++ AFEKDPER+K+L KM
Sbjct: 237 VLNPGKDDIVIDSCAAPGNKTTHTAAYILGGPSKDQ----KIQIHAFEKDPERAKVLQKM 292

Query: 301 VKIAGCKKLVEINTGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNINSNKKLTE 360
           V+ AGC + +E+N GDFTKIATPEK+ NVTGFIVDPSCSGSGIFGRKFID +N  K   E
Sbjct: 293 VRTAGCARTIEVNVGDFTKIATPEKFKNVTGFIVDPSCSGSGIFGRKFIDTLNKKK---E 349

Query: 361 KVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYST 420
               + +D+ + IP+EQ+   E   KDDL+TRLSKL+SFQFQVVKHAM+FP A+K+VYST
Sbjct: 350 GEDVDEDDESESIPVEQD--EEFSKKDDLKTRLSKLASFQFQVVKHAMTFPKARKLVYST 407

Query: 421 CSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKNDPAMDPK 480
           CSIHAEENERVVIDLLLD+ +K+ GW+V  R   IPTW RRG V EF++VF++D     K
Sbjct: 408 CSIHAEENERVVIDLLLDETIKKAGWRVANREKVIPTWPRRGWVDEFKEVFRDDEE-KCK 466

Query: 481 QLAEGCIRTLPKEDGGIGFFAVCFERNI 508
           ++A GCIR LPKEDGGIGFFAVCFER+I
Sbjct: 467 EIAGGCIRALPKEDGGIGFFAVCFERDI 494

>Kpol_1003.38 s1003 (94479..95969) [1491 bp, 496 aa] {ON}
           (94479..95969) [1491 nt, 497 aa]
          Length = 496

 Score =  626 bits (1615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/508 (63%), Positives = 382/508 (75%), Gaps = 13/508 (2%)

Query: 1   MNFYRDATWVLEHLEAQDXXXXXXXXXXXXXXXXCKQFKIQSNPKHVYAVVESAWKFKPF 60
           M+FYRD+TWVLE+LE ++                CK++K++SNP+HVYA V S WK KP+
Sbjct: 1   MDFYRDSTWVLEYLEKENAKDKISGSLQGLVLKSCKKYKVKSNPRHVYAAVSSCWKVKPY 60

Query: 61  IERIMAKSGILDDIPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKTR 120
           +E++M +SGILDDIP KKGKP ++RLTLLLL HDL+ SKS+RIQMGKHPIKT++L YKTR
Sbjct: 61  LEKVMKRSGILDDIPNKKGKPQFERLTLLLLCHDLLLSKSKRIQMGKHPIKTYILKYKTR 120

Query: 121 LHSEXXXXXXXXXXTNLNDMINAXXXXXXXXXXITPVRWIRINPIRIPKQKSSDDIILEL 180
           LHSE           +L+++I            ITPVRWIRINPIR    K  + I+ EL
Sbjct: 121 LHSELVKLKLKLKVRDLSELIE----DENSNDDITPVRWIRINPIRAQYDKGLEPIMNEL 176

Query: 181 RKKFTTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAH 240
            KKF T+V+HWS I PG IY+D+YIPNLFG+   DKITSHELYK GK+IIQDRASCFPAH
Sbjct: 177 NKKFPTRVNHWSDIVPGTIYHDDYIPNLFGVHTKDKITSHELYKTGKVIIQDRASCFPAH 236

Query: 241 ILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKM 300
           ILN   +D +IDACAAPGNKTTH ASYI+             +++AFEKDPER+KIL  M
Sbjct: 237 ILNPGKNDIVIDACAAPGNKTTHTASYILGGPKKDQTT----QIYAFEKDPERAKILQHM 292

Query: 301 VKIAGCKKLVEINTGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNINSNKKLTE 360
           +K+AGC   +++N GDFTKIATPEK+ NVTGFIVDPSCSGSGIFGRK++D+I  NKK  E
Sbjct: 293 IKVAGCSNTIQVNVGDFTKIATPEKFRNVTGFIVDPSCSGSGIFGRKYVDSI--NKKKQE 350

Query: 361 KVKDEG-EDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYS 419
              D G +DDE  +P EQE   + K +DDL+TRLSKL+SFQFQVVKHAMSFP AKKIVYS
Sbjct: 351 SSGDNGNQDDEDAVPDEQEEEFDLK-RDDLKTRLSKLASFQFQVVKHAMSFPKAKKIVYS 409

Query: 420 TCSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKNDPAMDP 479
           TCSIHAEENE VVIDLLLDKKV+EWGWKV PRS  IPTW RRG  +EF  VF+ D     
Sbjct: 410 TCSIHAEENEGVVIDLLLDKKVQEWGWKVAPRSEVIPTWPRRGFQAEFSKVFR-DEDEKC 468

Query: 480 KQLAEGCIRTLPKEDGGIGFFAVCFERN 507
           ++LA+GCIR LPKEDGGIGFFAVCFERN
Sbjct: 469 QELADGCIRVLPKEDGGIGFFAVCFERN 496

>KAFR0H03310 Chr8 complement(630597..632063) [1467 bp, 488 aa] {ON}
           Anc_2.286 YNL022C
          Length = 488

 Score =  622 bits (1603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/508 (60%), Positives = 385/508 (75%), Gaps = 20/508 (3%)

Query: 1   MNFYRDATWVLEHLEAQDXXXXXXXXXXXXXXXXCKQFKIQSNPKHVYAVVESAWKFKPF 60
           M FYRDATWVLE++E QD                C+++K+++NPKH+YAV++S WK+KPF
Sbjct: 1   MEFYRDATWVLEYIEQQDSKGRISGSLQSLVLKSCQKYKLKTNPKHIYAVLDSCWKYKPF 60

Query: 61  IERIMAKSGILDDIPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKTR 120
           +E++M+KSGIL DIPKKKGKP+Y RLTLLLLIHDL+ SK +RIQMGKHPIK FVL YK+R
Sbjct: 61  LEKVMSKSGILKDIPKKKGKPVYTRLTLLLLIHDLLLSKQKRIQMGKHPIKLFVLRYKSR 120

Query: 121 LHSEXXXXXXXXXXTNLNDMINAXXXXXXXXXXITPVRWIRINPIRIPKQKSSDDIILEL 180
           LHSE           +L+++++           ITPVRW RINP+R P    +  ++ EL
Sbjct: 121 LHSELVKLKLKAKVRDLSELVDTGDSSND----ITPVRWFRINPLRCP---DASAVMKEL 173

Query: 181 RKKFTTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAH 240
            KKF  +V+ W  I PG IY+DE+IP LFGI P DKITSHELYK G+IIIQDRASCFPAH
Sbjct: 174 EKKFPQRVESWEGIVPGSIYHDEFIPYLFGIHPQDKITSHELYKQGRIIIQDRASCFPAH 233

Query: 241 ILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKM 300
           ILN T +D IIDAC+APGNKTTHVASY+       +   D  R+FAFEKDPER+K+L KM
Sbjct: 234 ILNPTLEDKIIDACSAPGNKTTHVASYMFG-----NGLVDDVRIFAFEKDPERAKVLQKM 288

Query: 301 VKIAGCKKLVEINTGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNINSNKKLTE 360
           +K+AGC K + +N GDFTK+ATP K+P+VTGFIVDPSCSGSGIFGRK+ID++N  KK T+
Sbjct: 289 IKVAGCSKQISVNVGDFTKLATPSKFPDVTGFIVDPSCSGSGIFGRKYIDSLNRQKK-TQ 347

Query: 361 KVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYST 420
            + D G      +P EQE +AE K   +L+ RLSKLSSFQFQVVKHAMSFP AK+IVYST
Sbjct: 348 DIVDNG------VPDEQEEMAE-KENGNLQERLSKLSSFQFQVVKHAMSFPKAKRIVYST 400

Query: 421 CSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKNDPAMDPK 480
           CSIHAEENERV +DLLLD+KVK+WGWK+  R   IP W RRG VSEF+++F++  A + +
Sbjct: 401 CSIHAEENERVALDLLLDEKVKQWGWKIAKRESVIPQWPRRGFVSEFQEIFRDKTASECQ 460

Query: 481 QLAEGCIRTLPKEDGGIGFFAVCFERNI 508
           ++A+GCIR LP+EDGGIGFFA+CFER+I
Sbjct: 461 EMADGCIRALPREDGGIGFFAICFERDI 488

>Skud_14.307 Chr14 complement(562104..563576) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  616 bits (1589), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/506 (61%), Positives = 381/506 (75%), Gaps = 17/506 (3%)

Query: 1   MNFYRDATWVLEHLEAQDXXXXXXXXXXXXXXXXCKQFKIQSNPKHVYAVVESAWKFKPF 60
           MNFYRDATWVLE +E +                 CK++K++SNPKH+YAV++S WK+KP+
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLRSCKKYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  IERIMAKSGILDDIPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKTR 120
           +E++M K+ IL+DIPKKKGKP++ RLTLLLL HDL+ SK +RIQMGKHPIK +VL +K+ 
Sbjct: 61  LEKVMKKARILEDIPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LHSEXXXXXXXXXXTNLNDMINAXXXXXXXXXXITPVRWIRINPIRIPKQKSSDDIILEL 180
           LHSE           +L++++            + PVRWIRINP++      ++ ++ EL
Sbjct: 121 LHSEMVKLKLKLKVRDLSEVV----LSEDITNDLPPVRWIRINPLKCHPNGDTEPVLAEL 176

Query: 181 RKKFTTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAH 240
           RKKFT KV+ WS + PG IYYDEYIPNLFGI PTDKIT+HELYK+GKIIIQDRASCFPAH
Sbjct: 177 RKKFTLKVNKWSDLVPGSIYYDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAH 236

Query: 241 ILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKM 300
           IL+   DD +IDAC+APGNKTTH ASYI S     +I     R++AFEKDPER+KIL KM
Sbjct: 237 ILHPGADDIVIDACSAPGNKTTHTASYICSGPPKDNII----RIYAFEKDPERAKILQKM 292

Query: 301 VKIAGCKKLVEINTGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNINSNKKLTE 360
           VK+AGC   +++  GDFTK+ATP+K    TGFIVDPSCSGSGIFGRKF D++N  K    
Sbjct: 293 VKVAGCSSNIDVKVGDFTKLATPDKCKGATGFIVDPSCSGSGIFGRKFFDSLNKRKM--- 349

Query: 361 KVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYST 420
              DE +DD   IP EQE   E  AK++L+TRL+KLSSFQFQ+VKHAMSFP+AKKIVYST
Sbjct: 350 ---DEKDDDNDVIPDEQE---EFMAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIVYST 403

Query: 421 CSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKNDPAMDPK 480
           CSIHAEENERVVIDLLLDK V+EWGWKV PR+  IP+W RRG V EF +VF++  A +P+
Sbjct: 404 CSIHAEENERVVIDLLLDKAVQEWGWKVAPRTEVIPSWPRRGKVEEFGEVFRDGTAHNPR 463

Query: 481 QLAEGCIRTLPKEDGGIGFFAVCFER 506
           QLAEGCIR LPKEDGGIGFFAVCFER
Sbjct: 464 QLAEGCIRALPKEDGGIGFFAVCFER 489

>YNL022C Chr14 complement(591427..592899) [1473 bp, 490 aa] {ON}
           Putative cytosine 5-methyltransferase, contains seven
           beta-strand methyltransferase motif similar to
           NOP2/YNL061W; green fluorescent protein (GFP)-fusion
           protein localizes to the nucleus; predicted to be
           involved in ribosome biogenesis
          Length = 490

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/510 (60%), Positives = 377/510 (73%), Gaps = 23/510 (4%)

Query: 1   MNFYRDATWVLEHLEAQDXXXXXXXXXXXXXXXXCKQFKIQSNPKHVYAVVESAWKFKPF 60
           MNFYRDATWVLE +E +                 CK++K++SNPKH+YAV++S WK+KP+
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  IERIMAKSGILDDIPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKTR 120
           +E++M K+ IL+DIPKKKGKP++ RLTLLLL HDL+ SK +RIQMGKHPIK +VL +K+ 
Sbjct: 61  LEKVMKKAHILEDIPKKKGKPLFSRLTLLLLCHDLLLSKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LHSEXXXXXXXXXXTNLNDMINAXXXXXXXXXXITPVRWIRINPIRIPKQKSSDDIILEL 180
           LHSE            L++++            + PVRWIRINP++      ++ ++ EL
Sbjct: 121 LHSEMVKLKLKLKVRELSELV----LSEDISNDLPPVRWIRINPLKCHPNGETEPVLAEL 176

Query: 181 RKKFTTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAH 240
           RKKFT KVD WS++ PG IYYDE+IPNLFGI P+DKIT+HELYK+GKIIIQDRASCFPAH
Sbjct: 177 RKKFTLKVDKWSELVPGSIYYDEFIPNLFGIHPSDKITAHELYKHGKIIIQDRASCFPAH 236

Query: 241 ILNATPDDYIIDACAAPGNKTTHVASYIMS---LNNDTHINFDKKRVFAFEKDPERSKIL 297
           ILN  P D +ID+C+APGNKTTH ASYI      +N+T       R++AFEKDPER+K+L
Sbjct: 237 ILNPGPSDIVIDSCSAPGNKTTHTASYIYPEPPKDNNT-------RIYAFEKDPERAKVL 289

Query: 298 DKMVKIAGCKKLVEINTGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNINSNKK 357
            KM+KIAGC   + +N GDFTK+ATPEKY +VT FIVDPSCSGSGIFGRKF D+ N  K 
Sbjct: 290 QKMIKIAGCSPNISVNVGDFTKLATPEKYKDVTCFIVDPSCSGSGIFGRKFFDSFNRRKI 349

Query: 358 LTEKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIV 417
             +        DEQ+         E  AK++L+TRL+KLSSFQFQ+VKHAMSFP+AKKIV
Sbjct: 350 DDKDDDGGIVPDEQE---------EFIAKEELQTRLAKLSSFQFQMVKHAMSFPAAKKIV 400

Query: 418 YSTCSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKNDPAM 477
           YSTCSIHAEENERVVIDLLLDK V+EWGWKV P+   IP+W RRG V EFE+VF++    
Sbjct: 401 YSTCSIHAEENERVVIDLLLDKSVREWGWKVAPKREVIPSWPRRGKVEEFEEVFRDGVTY 460

Query: 478 DPKQLAEGCIRTLPKEDGGIGFFAVCFERN 507
           DP+QLAEGCIR LPK DGGIGFFAVCFER+
Sbjct: 461 DPQQLAEGCIRALPKSDGGIGFFAVCFERD 490

>Suva_14.325 Chr14 complement(574309..575781) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  605 bits (1560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/507 (60%), Positives = 383/507 (75%), Gaps = 19/507 (3%)

Query: 1   MNFYRDATWVLEHLEAQDXXXXXXXXXXXXXXXXCKQFKIQSNPKHVYAVVESAWKFKPF 60
           MNFYRDATWVLE +E +                 CK++K++SNPKH+YAV++S WK+KP+
Sbjct: 1   MNFYRDATWVLEDIEKEAAKVRISGSMQTLVLKSCKRYKLKSNPKHIYAVLDSCWKYKPY 60

Query: 61  IERIMAKSGILDDIPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKTR 120
           +E++M K+ IL++IPKKKGKP++ RLTLLLL HDL+ SK +RIQMGKHPIK +VL +K+ 
Sbjct: 61  LEKVMKKARILEEIPKKKGKPLFARLTLLLLCHDLLLSKQKRIQMGKHPIKEYVLKFKSP 120

Query: 121 LHSEXXXXXXXXXXTNLNDMINAXXXXXXXXXXITPVRWIRINPIRIPKQKSSDDIILEL 180
           LHSE           +L++++            + PVRWIRINP++     +++ ++ EL
Sbjct: 121 LHSEMVKLKLKLKVRDLSELV----LSEDIVNDLPPVRWIRINPLKCHPDGNTEPVLAEL 176

Query: 181 RKKFTTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAH 240
           +KKFT KVD+WS++ PG IY+DEYIPNLFGI PTDKIT+HELYK+GKIIIQDRASCFPAH
Sbjct: 177 KKKFTQKVDNWSELVPGSIYHDEYIPNLFGIHPTDKITAHELYKHGKIIIQDRASCFPAH 236

Query: 241 ILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKK-RVFAFEKDPERSKILDK 299
           IL+   +D +IDAC+APGNKTTH ASYI S         DKK +++AFEKDPER+KIL K
Sbjct: 237 ILHPGSNDIVIDACSAPGNKTTHTASYIFSEPPK-----DKKIQIYAFEKDPERAKILQK 291

Query: 300 MVKIAGCKKLVEINTGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNINSNKKLT 359
           M+K+AGC   +++N GDFTK+ATPEK   VTGFIVDPSCSGSGIFGRKF D++N  K   
Sbjct: 292 MIKVAGCSANIDVNVGDFTKLATPEKCKGVTGFIVDPSCSGSGIFGRKFFDSLNRRKIDE 351

Query: 360 EKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYS 419
           +  +D+   DEQ+         E  AK++L+TRL+KLSSFQFQ+VKHAMSFP AKKIVYS
Sbjct: 352 KDDEDDAVPDEQE---------EFMAKEELQTRLAKLSSFQFQMVKHAMSFPGAKKIVYS 402

Query: 420 TCSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKNDPAMDP 479
           TCSIHAEENERVVIDLLLDK V+EWGWKV  R+  +P+W RRG V EFE+VF++  A DP
Sbjct: 403 TCSIHAEENERVVIDLLLDKAVQEWGWKVASRTEVVPSWPRRGKVEEFEEVFRDGSAHDP 462

Query: 480 KQLAEGCIRTLPKEDGGIGFFAVCFER 506
           +QLAEGCIR LPKEDGGIGFFAVCF R
Sbjct: 463 QQLAEGCIRALPKEDGGIGFFAVCFVR 489

>KNAG0H02000 Chr8 complement(353074..354570) [1497 bp, 498 aa] {ON}
           Anc_2.286 YNL022C
          Length = 498

 Score =  603 bits (1556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/509 (60%), Positives = 383/509 (75%), Gaps = 12/509 (2%)

Query: 1   MNFYRDATWVLEHLEAQDXXXXXXXXXXXXXXXXCKQFKIQSNPKHVYAVVESAWKFKPF 60
           M+FYRDATWVLE +E QD                CK+FK+++NPKH+YAVV S W++KPF
Sbjct: 1   MDFYRDATWVLESIENQDAKGKLSGSLQTLVLNSCKRFKVKTNPKHIYAVVSSCWRYKPF 60

Query: 61  IERIMAKSGILDDIPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKTR 120
           +E++M KS ILD++P+KKG P++QRLTLLLL HDL+ SKS+RIQMGKHPIK FVL YKTR
Sbjct: 61  LEKVMKKSKILDEVPQKKGAPVFQRLTLLLLCHDLLLSKSKRIQMGKHPIKMFVLKYKTR 120

Query: 121 LHSEXXXXXXXXXXTNLNDMINAXXXXXXXXXXITPVRWIRINPIRIPKQKSSDDIILEL 180
           L++E           +L+ + ++          ITPVRW R+NP+R   +K    ++ EL
Sbjct: 121 LNAELAKMKVKLKVKDLSQLTDSDDLTND----ITPVRWFRVNPLRCTAEKPVQSVVTEL 176

Query: 181 RKKFTTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAH 240
           RKKFT KVD W  + PG IYYDEYIPNLF + P DKITSHELYK GKIIIQDRASCFPAH
Sbjct: 177 RKKFTEKVDSWKDVVPGSIYYDEYIPNLFCVHPQDKITSHELYKQGKIIIQDRASCFPAH 236

Query: 241 ILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKM 300
           ILN   DD +IDACAAPGNKTTH+A+++    + T     K +++AFEKDPER+++L+KM
Sbjct: 237 ILNPKSDDIVIDACAAPGNKTTHLAAHM--FQDKTADEKPKVQIYAFEKDPERAQVLNKM 294

Query: 301 VKIAGCKKLVEINTGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNINSNKKLTE 360
           +KIAGC K +E+  GDFTK+ATP+  PNV G IVDPSCSGSGIFGRK+ID+IN  K  T+
Sbjct: 295 IKIAGCSKEIEVIVGDFTKLATPQACPNVNGLIVDPSCSGSGIFGRKYIDSINHKK--TD 352

Query: 361 KVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYST 420
           + K+E E +   +P   E   E +  D+L+TRLSKLSSFQFQ+VK+A+SFP A K+VYST
Sbjct: 353 EEKEEEERELDAVP---EEQEEQELDDNLKTRLSKLSSFQFQIVKYALSFPQATKVVYST 409

Query: 421 CSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKNDP-AMDP 479
           CSIHAEENERVVIDLLLDKKVKE GW+V PRS  IPTWERRGLV EF+ VF+ D  + + 
Sbjct: 410 CSIHAEENERVVIDLLLDKKVKESGWRVAPRSKVIPTWERRGLVDEFQQVFREDSESSNC 469

Query: 480 KQLAEGCIRTLPKEDGGIGFFAVCFERNI 508
           +++A+GCIR LP+EDGGIGFFAVCFER +
Sbjct: 470 QEMADGCIRALPREDGGIGFFAVCFERTL 498

>KLLA0E08361g Chr5 complement(751889..753364) [1476 bp, 491 aa] {ON}
           similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022C
          Length = 491

 Score =  600 bits (1548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/508 (58%), Positives = 367/508 (72%), Gaps = 18/508 (3%)

Query: 1   MNFYRDATWVLEHLEAQ-DXXXXXXXXXXXXXXXXCKQFKIQSNPKHVYAVVESAWKFKP 59
           M FYRDATWVLE +E +                  CK++K+++NP+H+YA+V S W+++ 
Sbjct: 1   MEFYRDATWVLEFVEQELSKDKRVAGSLQTLVLTSCKRYKLKTNPRHIYAIVSSTWQYRE 60

Query: 60  FIERIMAKSGILDDIPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKT 119
           ++++I+ KSGIL+D+PKKKGKP++ + T+ LL+HDL+ SKS+RIQMGKHPIKTF+L ++T
Sbjct: 61  YLDKIIKKSGILEDVPKKKGKPLFNKDTIRLLVHDLLLSKSKRIQMGKHPIKTFILKHQT 120

Query: 120 RLHSEXXXXXXXXXXTNLNDMINAXXXXXXXXXXITPVRWIRINPIRIPKQKSSDDIILE 179
           RL +E          T+L+ +I            +TPVRWIRINPI +  ++  DD++ E
Sbjct: 121 RLKAELTKLKVKLKVTSLSQLIKTDDGED-----VTPVRWIRINPILV--KERYDDVLAE 173

Query: 180 LRKKFTTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPA 239
           L KKF  +V+ W +I PG IYYDEYIPNLFGI P DKITSHE YK GKIIIQDRASCFPA
Sbjct: 174 LNKKFPQRVNSWKQIVPGSIYYDEYIPNLFGIHPGDKITSHEQYKRGKIIIQDRASCFPA 233

Query: 240 HILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDK 299
           HILN    D +IDACAAPGNKTTHVA++I     D     D  ++ AFEKDPER+K L  
Sbjct: 234 HILNPNSTDVVIDACAAPGNKTTHVAAHIF---GDVDTKVDSVKIHAFEKDPERAKTLQM 290

Query: 300 MVKIAGCKKLVEINTGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNINSNKKLT 359
           MV  AGC K V+I+ GDFTK+  PE + NVTGFIVDPSCSGSGIFGRK ID +N +K  +
Sbjct: 291 MVATAGCAKGVKIHVGDFTKLGKPELFQNVTGFIVDPSCSGSGIFGRKAIDKVNLSKTGS 350

Query: 360 EKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYS 419
               +  ED     P+EQE     K + DL+ RL+KLSSFQ+Q+VKHAMSFPSAKKI YS
Sbjct: 351 S---NTDEDQTSVEPVEQEKELFEKEQ-DLKNRLAKLSSFQYQIVKHAMSFPSAKKICYS 406

Query: 420 TCSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKNDPAMDP 479
           TCSIHAEENERVVIDLLLD KVKEWGWKV  R+  IPTW RRG  SEFE+VF   P  + 
Sbjct: 407 TCSIHAEENERVVIDLLLDSKVKEWGWKVRKRTGVIPTWPRRGWTSEFEEVF---PKEEA 463

Query: 480 KQLAEGCIRTLPKEDGGIGFFAVCFERN 507
           K+LAEGCIR LPKEDGGIGFFAVCFER+
Sbjct: 464 KELAEGCIRALPKEDGGIGFFAVCFERD 491

>NCAS0G03790 Chr7 complement(699962..701440) [1479 bp, 492 aa] {ON}
           Anc_2.286 YNL022C
          Length = 492

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/509 (61%), Positives = 384/509 (75%), Gaps = 20/509 (3%)

Query: 1   MNFYRDATWVLEHLEAQDXXXXXXXXXXXXXXXXCKQFKIQSNPKHVYAVVESAWKFKPF 60
           M FYRDATWVLE +E +D                CK++K++ NPKHVYAV++S WK+KP+
Sbjct: 1   MEFYRDATWVLEFVEQEDAKGRISGSLQTLVFQSCKRYKLKCNPKHVYAVLDSCWKYKPY 60

Query: 61  IERIMAKSGILDDIPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKTR 120
           +E++M KSGILD+IPK+KGKP+Y RLTL+L+ HDL+FSK++RIQMGK PIKT+VL +K+R
Sbjct: 61  LEKVMKKSGILDEIPKRKGKPMYSRLTLMLMCHDLLFSKAKRIQMGKLPIKTYVLKHKSR 120

Query: 121 LHSEXXXXXXXXXXTNLNDMINAXXXXXXXXXXITPVRWIRINPIRIPKQKSSDDIILEL 180
           LHSE           NL+++++           +TPVRWIRINP+R   + +     LE+
Sbjct: 121 LHSELVKLKLKLKVKNLSELVS----NADSENDMTPVRWIRINPLRCDVEATK----LEI 172

Query: 181 RKKFTTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAH 240
           +KKF T+V++WS I PG IYYDEYIPNLFGI P DKITSH LYK GKIIIQDRASCFPAH
Sbjct: 173 QKKFPTRVENWSDIVPGSIYYDEYIPNLFGIHPQDKITSHNLYKQGKIIIQDRASCFPAH 232

Query: 241 ILNATPDDYIIDACAAPGNKTTHVASYIM-SLNNDTHINFDKKRVFAFEKDPERSKILDK 299
           IL+   +D +ID CAAPGNKTTH ASY++   + D  I     +++AFEK+PER+KILDK
Sbjct: 233 ILHPDENDVVIDGCAAPGNKTTHTASYMIKEPSKDPKI-----QIYAFEKNPERAKILDK 287

Query: 300 MVKIAGCKKLVEINTGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNINSNKKLT 359
           M+K+AGC K ++IN GDFTKIA PEKY +VTGFIVDPSCSGSGIFGRKFID++N  KK+ 
Sbjct: 288 MIKVAGCSKNIKINVGDFTKIALPEKYKDVTGFIVDPSCSGSGIFGRKFIDSLN-RKKMN 346

Query: 360 EKVKDEGEDDEQDIPLEQETLAEAKAK-DDLETRLSKLSSFQFQVVKHAMSFPSAKKIVY 418
              KDE +  E D   E     E   K +DL+TRLSKLSSFQFQVVKHAMSFP+AKKIVY
Sbjct: 347 ---KDEADKKEGDEEEEVPDEQEEYNKREDLKTRLSKLSSFQFQVVKHAMSFPNAKKIVY 403

Query: 419 STCSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKNDP-AM 477
           STCSIHAEENERVVIDL+LD KVK+WGWKV PRS  IPTW RRG V EFE+VF+ D  + 
Sbjct: 404 STCSIHAEENERVVIDLMLDSKVKQWGWKVAPRSKVIPTWPRRGKVEEFEEVFREDGNSS 463

Query: 478 DPKQLAEGCIRTLPKEDGGIGFFAVCFER 506
             ++LA GCIR LP+ DGGIGFFAVCFER
Sbjct: 464 KCEELAGGCIRALPRSDGGIGFFAVCFER 492

>Smik_14.309 Chr14 complement(553805..555277) [1473 bp, 490 aa] {ON}
           YNL022C (REAL)
          Length = 490

 Score =  595 bits (1533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/506 (60%), Positives = 379/506 (74%), Gaps = 17/506 (3%)

Query: 1   MNFYRDATWVLEHLEAQDXXXXXXXXXXXXXXXXCKQFKIQSNPKHVYAVVESAWKFKPF 60
           MNFYRDATWVLE +E +                 CK++K++SNPKHVYAV++S WK+KP+
Sbjct: 1   MNFYRDATWVLEDIEKEAAKERISGSMQTLVLKSCKRYKLKSNPKHVYAVLDSCWKYKPY 60

Query: 61  IERIMAKSGILDDIPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKTR 120
           +E++M K+ IL+DIPKKKGKP++ RLTLLLL HDL+ SK +RIQMGKHPIK +VL +K+ 
Sbjct: 61  LEKVMKKARILEDIPKKKGKPLFSRLTLLLLCHDLLISKQKRIQMGKHPIKDYVLKFKSP 120

Query: 121 LHSEXXXXXXXXXXTNLNDMINAXXXXXXXXXXITPVRWIRINPIRIPKQKSSDDIILEL 180
           LHSE           NL++++            + PVRWIRINP++      ++ ++ EL
Sbjct: 121 LHSEMVKLKLKLKVRNLSELV----LSEDIANDLPPVRWIRINPLKCYPNGKTEPVLAEL 176

Query: 181 RKKFTTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAH 240
           RKKFT KV+ WS++ P  IYYDEYIPNLFGI P+DKIT+HELYKNGKIIIQDRASCFPAH
Sbjct: 177 RKKFTLKVEKWSELVPESIYYDEYIPNLFGIHPSDKITAHELYKNGKIIIQDRASCFPAH 236

Query: 241 ILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKM 300
           ILN  P+D +IDAC+APGNKTTH ASYI S          + R++AFEKDPER+KIL KM
Sbjct: 237 ILNPGPNDIVIDACSAPGNKTTHTASYICSEPPKD----SRTRIYAFEKDPERAKILQKM 292

Query: 301 VKIAGCKKLVEINTGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNINSNKKLTE 360
           +KIAGC   ++++ GDFTK+ATPEK+ + TGFIVDPSCSGSGIFGRKF D++N  K   +
Sbjct: 293 IKIAGCSSNIDVSVGDFTKLATPEKFKDATGFIVDPSCSGSGIFGRKFFDSLNRKKMDDK 352

Query: 361 KVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYST 420
              ++   DEQ+         E  AK++L+TRL+KLSSFQFQ+VKHAMSFP AKKIVYST
Sbjct: 353 DDDNDIVPDEQE---------EFMAKEELQTRLAKLSSFQFQMVKHAMSFPVAKKIVYST 403

Query: 421 CSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKNDPAMDPK 480
           CSIHAEENERVVIDLLLDK V+EWGW+V PRS  IP W RRG V EFE+VF+   A DP+
Sbjct: 404 CSIHAEENERVVIDLLLDKAVQEWGWRVAPRSEVIPFWPRRGKVEEFEEVFREGAAHDPQ 463

Query: 481 QLAEGCIRTLPKEDGGIGFFAVCFER 506
           +LAEGCIR LPK+DGGIGFFAVCFER
Sbjct: 464 ELAEGCIRALPKDDGGIGFFAVCFER 489

>TDEL0G02170 Chr7 (427274..428728) [1455 bp, 484 aa] {ON} Anc_2.286
           YNL022C
          Length = 484

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/506 (57%), Positives = 365/506 (72%), Gaps = 22/506 (4%)

Query: 1   MNFYRDATWVLEHLEAQDXXXXXXXXXXXXXXXXCKQFKIQSNPKHVYAVVESAWKFKPF 60
           MNFYRDATWVLE++E +D                C+++K++S+PKH+YAVV+S W++K  
Sbjct: 1   MNFYRDATWVLEYVEQEDEKGRLSGSMQTLVLKSCQRYKLKSDPKHLYAVVDSCWRYKAL 60

Query: 61  IERIMAKSGILDDIPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKTR 120
           +E+IM +S I DDIPKKKGKPIY RLTLLL+ HDL+ SK +RIQMGK PIK +VL +KTR
Sbjct: 61  LEKIMKRSKIYDDIPKKKGKPIYSRLTLLLMCHDLLISKQKRIQMGKLPIKEYVLKHKTR 120

Query: 121 LHSEXXXXXXXXXXTNLNDMINAXXXXXXXXXXITPVRWIRINPIRIPKQKSSDDIILEL 180
           L+SE           +L+++++           +TPVRWIRINP+R PK    + ++ EL
Sbjct: 121 LNSELVKLKLKLKVKSLSEIVD----KEDSSNDVTPVRWIRINPLRCPKN-DVEPVLKEL 175

Query: 181 RKKFTTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAH 240
            KKF  +V HWS I  G +YYDE++PNLFG+ P DKITSHELY+ GKIIIQDR+SCFPAH
Sbjct: 176 IKKFPQRVSHWSDITSGTLYYDEFVPNLFGVHPRDKITSHELYRQGKIIIQDRSSCFPAH 235

Query: 241 ILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKM 300
           ILN   +D +IDACAAPGNKTTHVA++I+      +      +++AFEKDP R+ IL KM
Sbjct: 236 ILNPGKNDVVIDACAAPGNKTTHVAAHILP----EYTREQTPKIYAFEKDPARANILKKM 291

Query: 301 VKIAGCKKLVEINTGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNINSNKKLTE 360
             +AGC + VEI+ GDFTK+A P  + +VTG IVDPSCSGSGIFGRK +D+ N  KK TE
Sbjct: 292 TSVAGCGQTVEIHVGDFTKLAVPANFKDVTGLIVDPSCSGSGIFGRKSVDSHNVAKKKTE 351

Query: 361 KVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYST 420
                    + +IP E+E +      DD+  RLSKL+SFQFQVVKHAMS P+AKKIVYST
Sbjct: 352 T--------DSEIPDEEEKM----VGDDVANRLSKLASFQFQVVKHAMSMPNAKKIVYST 399

Query: 421 CSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKNDPAMDPK 480
           CSIHAEENERVVIDLLLD+ +KEWGWKV  R   IP W RRG V EFE VF++DP +   
Sbjct: 400 CSIHAEENERVVIDLLLDRNIKEWGWKVASREEVIPKWPRRGKVKEFEQVFRDDP-VKCN 458

Query: 481 QLAEGCIRTLPKEDGGIGFFAVCFER 506
           +LA+GCIR LP+EDGGIGFFAVCF+R
Sbjct: 459 ELADGCIRALPQEDGGIGFFAVCFKR 484

>KLTH0G10362g Chr7 (876756..878345) [1590 bp, 529 aa] {ON} highly
           similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022C
          Length = 529

 Score =  585 bits (1508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/508 (55%), Positives = 363/508 (71%), Gaps = 26/508 (5%)

Query: 1   MNFYRDATWVLEHLEAQDXXXXXXXXXXXXXXXXCKQFKIQSNPKHVYAVVESAWKFKPF 60
           MNFYRDATWVLE++E+ +                CK++++++NPKH+YA V S W++  F
Sbjct: 47  MNFYRDATWVLEYVESAEKGGRVAGSLQTLVLNSCKKYQLKTNPKHIYAAVYSCWRYNEF 106

Query: 61  IERIMAKSGILDDIPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKTR 120
           +++++ +SGIL DIPKKKGK ++   T+ LL+HDL+FSK++RIQMGKHP+K FVL YK R
Sbjct: 107 LDKLLKRSGILKDIPKKKGKEVFNPTTIKLLVHDLLFSKNKRIQMGKHPLKEFVLKYKAR 166

Query: 121 LHSEXXXXXXXXXXTNLNDMINAXXXXXXXXXXITPVRWIRINPIRIPKQKSSDDIILEL 180
           L SE          T+L  ++            +TPVRW R+NPIR   +  S+DI+ EL
Sbjct: 167 LSSELVRLKIKLKVTDLQQLLK------DDRNDMTPVRWFRLNPIRCGAK--SEDILQEL 218

Query: 181 RKKFTTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAH 240
            KKF T+V+ W+ I PGCIY+DEYIP LFG+ P DKITSHELYK GK+IIQDRASCFPAH
Sbjct: 219 SKKFPTRVNSWTNIAPGCIYHDEYIPGLFGVHPADKITSHELYKTGKVIIQDRASCFPAH 278

Query: 241 ILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKM 300
           ILNA+ +D IIDACAAPGNKTTHVA++I     D  +  +  R+ AFEKDPER+K L  M
Sbjct: 279 ILNASSEDLIIDACAAPGNKTTHVAAHIF---QDQAV--ESVRIHAFEKDPERAKTLRTM 333

Query: 301 VKIAGCKKLVEINTGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNINSNKKLTE 360
           +  AGC K +E++ GDFT++A P K+P+VTGFI+DPSCSGSGIFGRK ID+ N +K    
Sbjct: 334 INTAGCTKGIEVHVGDFTQLAKPGKFPDVTGFILDPSCSGSGIFGRKMIDDRNKSK---- 389

Query: 361 KVKDEGEDDEQDIPLEQETLAEAKAKD-DLETRLSKLSSFQFQVVKHAMSFPSAKKIVYS 419
                  D    +  E++        D DL+ RL KL+SFQF++VKHAMSFPSAKK+VYS
Sbjct: 390 ------ADGASPVEEEEKEEEREDISDKDLKNRLEKLASFQFEIVKHAMSFPSAKKLVYS 443

Query: 420 TCSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKNDPAMDP 479
           TCS+HAEENER+V+DLLLD KVKEWGW+V  R+  IPTW RRG   EFE+VF+++     
Sbjct: 444 TCSVHAEENERIVVDLLLDSKVKEWGWRVRKRAGVIPTWSRRGFYKEFEEVFRDEDT--A 501

Query: 480 KQLAEGCIRTLPKEDGGIGFFAVCFERN 507
           K+LAE CIR  PKEDGGIGFFAVCFER+
Sbjct: 502 KELAEACIRVAPKEDGGIGFFAVCFERD 529

>SAKL0E07678g Chr5 complement(621183..622616) [1434 bp, 477 aa] {ON}
           highly similar to uniprot|P53972 Saccharomyces
           cerevisiae YNL022C
          Length = 477

 Score =  581 bits (1497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/507 (57%), Positives = 370/507 (72%), Gaps = 30/507 (5%)

Query: 1   MNFYRDATWVLEHLEAQDXXXXXXXXXXXXXXXXCKQFKIQSNPKHVYAVVESAWKFKPF 60
           MN YRDATWV E++E ++                CK++K+++NPKH+YA+V S WK+KPF
Sbjct: 1   MNLYRDATWVFEYVEQEESKGKIAGSLQTLVLNSCKRYKLKTNPKHLYAIVHSCWKYKPF 60

Query: 61  IERIMAKSGILDDIPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKTR 120
           +E+I+ KSGIL DIPKKKG+P +   T+LLL+HDL+ SK++RIQMGKHPIK FVL +K R
Sbjct: 61  LEKILKKSGILKDIPKKKGQPAFSNTTILLLVHDLLLSKNKRIQMGKHPIKEFVLKHKVR 120

Query: 121 LHSEXXXXXXXXXXTNLNDMINAXXXXXXXXXXITPVRWIRINPIRIPKQKSSDDIILEL 180
           L +E          TNL+ ++            +TPVRWIRINP+R       DD+  EL
Sbjct: 121 LQAELAKLKVKLRVTNLSQLVK------DDSNDMTPVRWIRINPVRC--NGKVDDVKGEL 172

Query: 181 RKKFTTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAH 240
           +KKF TKV +WS+I PG IY+DE+IPNLFG+ P DKITSHELYK GKIIIQDRASCFPAH
Sbjct: 173 QKKFPTKVSNWSEIVPGTIYHDEFIPNLFGVHPADKITSHELYKRGKIIIQDRASCFPAH 232

Query: 241 ILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKM 300
           ILN TP+D IID+C+APGNKTTHVA+++     D      +K++ AFEKDPER+K L KM
Sbjct: 233 ILNPTPEDVIIDSCSAPGNKTTHVAAHMF----DPEFVPKQKQIHAFEKDPERAKTLQKM 288

Query: 301 VKIAGCKKLVEINTGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNINSNKKLTE 360
           +++AGC K +E++ GDFTK+A P+K+  VTGFIVDPSCSGSGIFGRK ID+ N+  ++  
Sbjct: 289 IQVAGCDKSIEVHVGDFTKLAKPDKFSQVTGFIVDPSCSGSGIFGRKIIDDTNNKNEV-- 346

Query: 361 KVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYST 420
                         L +E   + +   DL+TRL+KLSSFQFQ++KHAMSFP+AKK+VYST
Sbjct: 347 --------------LPEEEQEKEEMDQDLKTRLTKLSSFQFQILKHAMSFPNAKKLVYST 392

Query: 421 CSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKNDPAMDPK 480
           CSIHAEENERVVIDLLLD KV++WGW+V  R+  IPTW RRG V EF+ V+++      +
Sbjct: 393 CSIHAEENERVVIDLLLDDKVQQWGWRVRKRAGVIPTWSRRGFVEEFQQVYQD--KQQAQ 450

Query: 481 QLAEGCIRTLPKEDGGIGFFAVCFERN 507
           +LA+GCIR LPKEDGGIGFFAVCFER+
Sbjct: 451 ELADGCIRALPKEDGGIGFFAVCFERD 477

>Kwal_27.11532 s27 complement(837572..839011) [1440 bp, 479 aa] {ON}
           YNL022C - Non-essential protein with similarity to S.
           pombe hypothetical protein E349594 [contig 27] FULL
          Length = 479

 Score =  580 bits (1494), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/507 (56%), Positives = 362/507 (71%), Gaps = 28/507 (5%)

Query: 1   MNFYRDATWVLEHLEAQDXXXXXXXXXXXXXXXXCKQFKIQSNPKHVYAVVESAWKFKPF 60
           MNFYRDATWVLE++E  +                CK++ +++NPKH+YA V S W++  F
Sbjct: 1   MNFYRDATWVLEYVEKAESSGRVAGSLQTLVLNSCKKYNLKTNPKHLYAAVYSCWRYNEF 60

Query: 61  IERIMAKSGILDDIPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKTR 120
           +E+++ KS IL D+PKKKGK I+   T+ LL+HDL+F+K++RIQMGKHP+K FVL +KTR
Sbjct: 61  LEKLLKKSEILKDVPKKKGKEIFNPTTIKLLVHDLLFTKNKRIQMGKHPLKEFVLKHKTR 120

Query: 121 LHSEXXXXXXXXXXTNLNDMINAXXXXXXXXXXITPVRWIRINPIRIPKQKSSDDIILEL 180
           L+SE          T+L+ ++            +TPVRW RINP+R       ++++ EL
Sbjct: 121 LNSELVRLKIKLKVTDLHQLLK------DDRNDMTPVRWFRINPVRC--HGKHEEVMAEL 172

Query: 181 RKKFTTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAH 240
            KKF T+VD W  + PG IY+DEYIPNLFG+ P DKITSHELYK GKIIIQDRASCFPAH
Sbjct: 173 AKKFPTRVDSWKDVVPGSIYHDEYIPNLFGVHPGDKITSHELYKTGKIIIQDRASCFPAH 232

Query: 241 ILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKM 300
           ILN +P D IIDACAAPGNKTTHVA++ M LN+       +  + AFEKDPER+K L  M
Sbjct: 233 ILNPSPSDVIIDACAAPGNKTTHVAAH-MFLNDQPQ----EPLIHAFEKDPERAKTLRTM 287

Query: 301 VKIAGCKKLVEINTGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNINSNKKLTE 360
           VK AGC K + I+ GDFTK+A P  +PNV+GFIVDPSCSGSGIFGR+ ID+ N ++    
Sbjct: 288 VKTAGCSKGINIHVGDFTKLAKPSLFPNVSGFIVDPSCSGSGIFGRQIIDDHNKSR---- 343

Query: 361 KVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYST 420
                   +E  +P ++E   E + K D++ RL+KL+SFQF++VK+A+SFPSAKK+VYST
Sbjct: 344 --------EEGALPTQEEERQEIEGK-DIKNRLAKLASFQFEIVKYALSFPSAKKLVYST 394

Query: 421 CSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKNDPAMDPK 480
           CSIHAEENER+VIDLLLD KVKEWGW+V  R+ +IPTW RRG   EFEDVF+       K
Sbjct: 395 CSIHAEENERIVIDLLLDSKVKEWGWRVRKRAGAIPTWPRRGFYHEFEDVFREGDTA--K 452

Query: 481 QLAEGCIRTLPKEDGGIGFFAVCFERN 507
           +LAE CIR  PKEDGGIGFFAVCFER+
Sbjct: 453 ELAEACIRVAPKEDGGIGFFAVCFERD 479

>ZYRO0A01892g Chr1 (156967..158364) [1398 bp, 465 aa] {ON} similar
           to uniprot|P53972 Saccharomyces cerevisiae YNL022C
          Length = 465

 Score =  573 bits (1477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/510 (54%), Positives = 361/510 (70%), Gaps = 49/510 (9%)

Query: 1   MNFYRDATWVLEHLEAQDXXXXXXXXXXXXXXXXCKQFKIQSNPKHVYAVVESAWKFKPF 60
           M+FYRD+TW+LE+LEA++                C ++K+++NPKH+YAVV S WK++ +
Sbjct: 1   MDFYRDSTWILEYLEAEEKKGKLSGSLQSNVLKTCTKYKVKNNPKHIYAVVASCWKYRMY 60

Query: 61  IERIMAKSGILDDIPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKTR 120
           +ERIM KSGIL  IP+KKGKP + RLT++LL HDL+ SK +RIQMGKHPIK +VL YKTR
Sbjct: 61  LERIMHKSGILKTIPQKKGKPAFSRLTIMLLCHDLLISKQKRIQMGKHPIKDYVLKYKTR 120

Query: 121 LHSEXXXXXXXXXXTNLNDMINAXXXXXXXXXXITPVRWIRINPIR--IPKQKSSDDIIL 178
           LH+E            L+++++            TPVRWIRINP++  IP       ++ 
Sbjct: 121 LHAELVKLKVKLKVKELSELVDQDDGDDA-----TPVRWIRINPLKCDIPV------VVE 169

Query: 179 ELRKKFTTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFP 238
           +L KKF  +VDHW ++ PG IYYDEY+PNLFGI P++KITSH+LYK GK+IIQDRASC P
Sbjct: 170 QLNKKFPHRVDHWDQLSPGSIYYDEYVPNLFGIHPSEKITSHDLYKQGKVIIQDRASCLP 229

Query: 239 AHILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILD 298
           AHILN   +D ++DACAAPGNKTTH+A++I+S   D+  N  + ++ AFEK+P R+K+L 
Sbjct: 230 AHILNPGKEDVVMDACAAPGNKTTHLAAHIISAAGDS--NGGQAQIHAFEKEPARAKVLQ 287

Query: 299 KMVKIAGCKKLVEINTGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNINSNKKL 358
           KM   AGC  LV+I+ GDFT++A P+++ +VT  +VDPSCSGSGIFGRK +++ N     
Sbjct: 288 KMTSQAGCGSLVKIHVGDFTRLAVPDQFEDVTAALVDPSCSGSGIFGRKSLESSN----- 342

Query: 359 TEKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVY 418
                     D QD                L+ RLSKLSSFQFQVVKHAMS P+A+KIVY
Sbjct: 343 ----------DSQD--------------QKLQDRLSKLSSFQFQVVKHAMSMPNARKIVY 378

Query: 419 STCSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKNDPAMD 478
           STCS+HAEENERVVIDLLLD KVKEWGW+++PRS  +PTW RRG+  EFE+VF++D    
Sbjct: 379 STCSVHAEENERVVIDLLLDSKVKEWGWQLSPRSEVVPTWPRRGIAEEFEEVFRDD---K 435

Query: 479 PK--QLAEGCIRTLPKEDGGIGFFAVCFER 506
           PK   LAE CIR LP+EDGGIGFFAVCF+R
Sbjct: 436 PKCQLLAESCIRALPREDGGIGFFAVCFQR 465

>CAGL0M06941g Chr13 complement(706878..708356) [1479 bp, 492 aa]
           {ON} similar to uniprot|P53972 Saccharomyces cerevisiae
           YNL022c
          Length = 492

 Score =  574 bits (1479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/509 (57%), Positives = 377/509 (74%), Gaps = 19/509 (3%)

Query: 1   MNFYRDATWVLEHLEAQ-DXXXXXXXXXXXXXXXXCKQFKIQSNPKHVYAVVESAWKFKP 59
           M FYRD+TWVLE+LE Q +                CKQ++I++NPKH+YA+V S WK+KP
Sbjct: 1   MEFYRDSTWVLEYLEGQIEKTGRVSGSLQTIVLRCCKQYRIKTNPKHIYAIVSSCWKYKP 60

Query: 60  FIERIMAKSGILDDIPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKT 119
           ++++IM KSG+LD IP+KKGKP + +LTLLLL HDL+ SK++RIQMGKHPIK +VL YK 
Sbjct: 61  YLDKIMKKSGLLDAIPRKKGKPAFSKLTLLLLCHDLLLSKAKRIQMGKHPIKNYVLKYKN 120

Query: 120 RLHSEXXXXXXXXXXTNLNDMINAXXXXXXXXXXITPVRWIRINPIRIPKQKSSDDIILE 179
            L++E          T+L+ +++           +TPVRWIRINP+RI     +D ++ E
Sbjct: 121 ALNAEFVKLKIKLKITDLSQVVDKDDAADD----MTPVRWIRINPLRISNH-DTDQVLNE 175

Query: 180 LRKKFTTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPA 239
           L+KKF T+V+ W  I PG IYYDE+IPNL+GI  +DKITSHELYK GKIIIQDRASCFPA
Sbjct: 176 LKKKFPTRVNTWKDIIPGSIYYDEFIPNLYGIHISDKITSHELYKQGKIIIQDRASCFPA 235

Query: 240 HILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDK 299
           HILN + DD +IDAC+APGNKTTHVA++I    +  +   D  +++AFEKDPER++IL K
Sbjct: 236 HILNPSADDVVIDACSAPGNKTTHVAAHI--FGDPENPRNDNVQIYAFEKDPERAQILQK 293

Query: 300 MVKIAGCKKLVEINTGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNINSN-KKL 358
           M+K AGC K +++N GDFT+IATP KY +VTGFI+DPSCSGSGIFGRK +D +N++ KK 
Sbjct: 294 MIKTAGCHKNIDVNVGDFTQIATPSKYSDVTGFILDPSCSGSGIFGRKSVDILNNHGKKS 353

Query: 359 TEKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVY 418
            ++V DE  D E+    + E L E         RLSKL+SFQFQ+V+HAMSFP+AKKIVY
Sbjct: 354 NDEVPDEN-DAEETTDSKNEQLKE---------RLSKLASFQFQIVRHAMSFPNAKKIVY 403

Query: 419 STCSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKNDPAMD 478
           STCSIHAEENERVVIDLLLDKKV+ WGW+V  + L +PTW RRG   EF++VF +    +
Sbjct: 404 STCSIHAEENERVVIDLLLDKKVQSWGWRVAKKELVLPTWYRRGFKEEFQEVFTDKTEQE 463

Query: 479 PKQLAEGCIRTLPKEDGGIGFFAVCFERN 507
            ++LA+GC+R LPKEDGGIGFFAVCF R+
Sbjct: 464 CQELADGCVRALPKEDGGIGFFAVCFVRD 492

>Ecym_3325 Chr3 (623214..624704) [1491 bp, 496 aa] {ON} similar to
           Ashbya gossypii ADL215W
          Length = 496

 Score =  572 bits (1474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/507 (54%), Positives = 371/507 (73%), Gaps = 26/507 (5%)

Query: 1   MNFYRDATWVLEHLEAQ-DXXXXXXXXXXXXXXXXCKQFKIQSNPKHVYAVVESAWKFKP 59
           M FYRD++WVLE++E +                  CK++K+++NPKH+YA+V S WK+K 
Sbjct: 14  MEFYRDSSWVLEYIEQEFSKNSRISGSLQTLVLRSCKRYKLKTNPKHIYAIVSSCWKYKM 73

Query: 60  FIERIMAKSGILDDIPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKT 119
           ++E+I+  SG+L D+P KKG+P++ + T++LL+HDL+ SK++RI MGKHPIK FVL  + 
Sbjct: 74  YLEKIIKNSGLLADVPLKKGEPVFSKTTIMLLVHDLLLSKNKRIHMGKHPIKAFVLKRQV 133

Query: 120 RLHSEXXXXXXXXXXTNLNDMINAXXXXXXXXXXITPVRWIRINPIRIPKQKSSDDIILE 179
           RL  E           +L++++            ++PVRWIRINP R   Q   DD++ E
Sbjct: 134 RLSGEFKKMLVKLKVKSLSELVE------DNDADMSPVRWIRINPFRC--QGKVDDVLKE 185

Query: 180 LRKKFTTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPA 239
           LRKKF  +VD W++I PG IY DEYIPNL+G+ P+DKITSHELYK GKIIIQDRASCFPA
Sbjct: 186 LRKKFPKQVDDWTQIVPGSIYRDEYIPNLYGVHPSDKITSHELYKRGKIIIQDRASCFPA 245

Query: 240 HILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDK 299
           +ILN TP D +IDAC+APGNKTTH+A++I    N + +     +++AFE+D +R++IL+K
Sbjct: 246 YILNPTPHDVVIDACSAPGNKTTHIAAHIFPDGNASDV-----KIYAFERDAKRAEILEK 300

Query: 300 MVKIAGCKKLVEINTGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNINSNKKLT 359
           MV  AGC+  ++I+ GDFT++A P+ + +VTGFI+DPSCSGSGIFGR+ +D  N + KL 
Sbjct: 301 MVTSAGCESCIQISVGDFTQLAKPQMFKDVTGFILDPSCSGSGIFGRQSVDLANKS-KLA 359

Query: 360 EKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYS 419
           EKV +E  +++    +EQ  L         +TRL+KLSSFQFQ+VKHAMSFP+AKK+VYS
Sbjct: 360 EKVPNEVFEEQDPKEMEQNEL--------YKTRLAKLSSFQFQIVKHAMSFPNAKKLVYS 411

Query: 420 TCSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKNDPAMDP 479
           TCSIHAEENERVVIDLLLD+ +K++GWKV  R   IP W+RRG++SEFE+VF ++ A   
Sbjct: 412 TCSIHAEENERVVIDLLLDQNIKQYGWKVAKRDSVIPAWQRRGILSEFEEVFPHEQA--- 468

Query: 480 KQLAEGCIRTLPKEDGGIGFFAVCFER 506
           ++LA+GCIR LPKEDGGIGFFAVCFER
Sbjct: 469 QELADGCIRALPKEDGGIGFFAVCFER 495

>ADL215W Chr4 (326584..328038) [1455 bp, 484 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL022C
          Length = 484

 Score =  549 bits (1415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/508 (53%), Positives = 349/508 (68%), Gaps = 25/508 (4%)

Query: 1   MNFYRDATWVLEHLEAQDXXXXXXXXXXXXXXXXC-KQFKIQSNPKHVYAVVESAWKFKP 59
           M FYRDA+WVLE++E +                   K++K++S+ +HVYA+V S WK+K 
Sbjct: 1   MEFYRDASWVLEYIEQEFARKSKVAGSLHSLVLQSHKKYKLKSDVRHVYAIVASFWKYKA 60

Query: 60  FIERIMAKSGILDDIPKKKGKPIYQRLTLLLLIHDLMFSKSRRIQMGKHPIKTFVLGYKT 119
           +++RI+ KSG+L D+P+KKG+P ++R TL L++HDL+ SK +RI MGKHP+K FVL ++T
Sbjct: 61  YLDRIIEKSGLLKDVPRKKGEPAFKRSTLGLVVHDLLLSKKKRIHMGKHPLKAFVLKHQT 120

Query: 120 RLHSEXXXXXXXXXXTNLNDMINAXXXXXXXXXXITPVRWIRINPIRIPKQKSSDDIILE 179
           RL  E           +L+ ++             TPVRWIR+NP RI  Q+  ++++ E
Sbjct: 121 RLRGEYAKQLVKLGVADLSVLVQ------DEREDATPVRWIRLNPFRIRGQR--EEVLQE 172

Query: 180 LRKKFTTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPA 239
           L+KKF  +V  W ++ PG IY DEY+  L+G+ P DKITSHELYK GKIIIQDRASCFPA
Sbjct: 173 LQKKFPRRVADWRELTPGSIYEDEYVAGLYGVHPADKITSHELYKRGKIIIQDRASCFPA 232

Query: 240 HILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDK 299
            IL     D IIDACAAPGNKTTHVA++I       H      ++ AFE+DP+R+K L K
Sbjct: 233 QILAPGRSDVIIDACAAPGNKTTHVAAHIFPEGGADH-----AQIHAFERDPQRAKTLRK 287

Query: 300 MVKIAGCKKLVEINTGDFTKIATPEKYPNVTGFIVDPSCSGSGIFGRKFIDNINSNKKLT 359
           M+  AGC   +E++ GDFT+ A PE + NVTGFIVDPSCSGSGIFGR+ +D     +K T
Sbjct: 288 MIATAGCDNAIEVHVGDFTRDAQPEIFKNVTGFIVDPSCSGSGIFGRQLVDATQETQKGT 347

Query: 360 EKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYS 419
           E       D   D+P E+ET    K+  +L+ RL+KLSSFQFQ+VKHAMSFPSAKK++YS
Sbjct: 348 ET------DPSADVP-EEETFEATKSAVELKNRLAKLSSFQFQIVKHAMSFPSAKKLIYS 400

Query: 420 TCSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKNDPAMDP 479
           TCS+HAEENERVVIDLLLD KV++ GWKV  RS  IP W RRG  +EFE+VF +      
Sbjct: 401 TCSVHAEENERVVIDLLLDSKVQKGGWKVASRSKVIPAWPRRGHQAEFEEVFPD----QA 456

Query: 480 KQLAEGCIRTLPKEDGGIGFFAVCFERN 507
           ++LA GCIR LPKEDGGIGFFAVCFER 
Sbjct: 457 EELAGGCIRVLPKEDGGIGFFAVCFERE 484

>SAKL0E08624g Chr5 complement(704579..706414) [1836 bp, 611 aa] {ON}
           similar to uniprot|P40991 Saccharomyces cerevisiae
           YNL061W NOP2 Probable RNA m(5)C methyltransferase
           essential for processing and maturation of 27S pre-rRNA
           and large ribosomal subunit biogenesis localized to the
           nucleolus
          Length = 611

 Score = 65.5 bits (158), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 69/249 (27%), Positives = 103/249 (41%), Gaps = 62/249 (24%)

Query: 188 VDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAHILNATPD 247
           +  W+K+  G   +D  +P   G +P         Y  G  I+Q  +S  P   L+   +
Sbjct: 293 IGSWTKV--GLQIFDSQVP--IGATPE--------YLAGHYILQAASSFLPVIALDPQEN 340

Query: 248 DYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKMVKIAGCK 307
           + I+D  AAPG KTT    YI +L  +T        VFA + +  R+K L   +   GC 
Sbjct: 341 ERILDMAAAPGGKTT----YISALMKNTGC------VFANDANKARTKSLIANIHRLGCH 390

Query: 308 KLVEINTGDFTKIATPEKYPNVTG----FIVDPSCSGSGIFGRKFIDNINSNKKLTEKVK 363
             +  N           ++P V G     ++D  CSG+G+ G+     ++  +K      
Sbjct: 391 NTIVCNY-------DAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEK------ 437

Query: 364 DEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYSTCSI 423
                D   IP  Q+ L            LS + S    V  H+    +   IVYSTCS+
Sbjct: 438 -----DFMQIPHLQKQLI-----------LSAIDS----VDAHSK---TGGVIVYSTCSV 474

Query: 424 HAEENERVV 432
             EENE VV
Sbjct: 475 AVEENEAVV 483

>ADL254W Chr4 (253602..255413) [1812 bp, 603 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL061W (NOP2)
          Length = 603

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 75/285 (26%), Positives = 117/285 (41%), Gaps = 65/285 (22%)

Query: 160 IRINPIRIPKQKSSDDIILELRKKFTTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITS 219
           IR N ++  ++  + +++   R      +  W+K+  G   +D  +P   G +P      
Sbjct: 260 IRTNTLKTRRRDLAQNLVN--RGVNLQPIGSWTKV--GLQIFDSQVP--VGATPE----- 308

Query: 220 HELYKNGKIIIQDRASCFPAHILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINF 279
              Y  G  I+Q  +S  P   L+   ++ I+D  AAPG KTT    YI ++  +T    
Sbjct: 309 ---YLAGHYILQAASSFLPVIALDPHENERILDMAAAPGGKTT----YISAMMKNTGC-- 359

Query: 280 DKKRVFAFEKDPERSKILDKMVKIAGCKKLVEINTGDFTKIATPEKYPNVTG----FIVD 335
               VFA + +  R+K L   +   GC   +  N           ++P V G     ++D
Sbjct: 360 ----VFANDANKARTKSLIANIHRLGCTNTIVCNY-------DAREFPKVIGGFDRILLD 408

Query: 336 PSCSGSGIFGRKFIDNINSNKKLTEKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSK 395
             CSG+G+ G+     +N  +K           D   IP  Q+ L            LS 
Sbjct: 409 APCSGTGVIGKDQSVKVNRTEK-----------DFMQIPHLQKQLI-----------LSA 446

Query: 396 LSSFQFQVVKHAMSFPSAKKIVYSTCSIHAEENERVVIDLLLDKK 440
           + S      KH         IVYSTCS+  EENE  V+D  L K+
Sbjct: 447 IDSVDSNS-KHGGV------IVYSTCSVAVEENE-AVVDYALRKR 483

>ZYRO0A01562g Chr1 (128145..129998) [1854 bp, 617 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 617

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 71/257 (27%), Positives = 108/257 (42%), Gaps = 63/257 (24%)

Query: 188 VDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAHILNATPD 247
           +  W+K+  G   +D  +P   G +P         Y  G  I+Q  +S  P   L+   +
Sbjct: 300 IGSWTKV--GLQIFDSQVP--IGATPE--------YLAGNYILQAASSFLPVIALDPQEN 347

Query: 248 DYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKMVKIAGCK 307
           + I+D  AAPG KTT    YI +L  +T        VFA + +  R+K L   +   GC 
Sbjct: 348 ERILDMAAAPGGKTT----YISALMKNTGC------VFANDANKSRTKSLVANIHRLGCT 397

Query: 308 KLVEINTGDFTKIATPEKYPNVTG----FIVDPSCSGSGIFGRKFIDNINSNKKLTEKVK 363
             +  N           ++P V G     ++D  CSG+G+ G+     ++  +K      
Sbjct: 398 NTIVCNY-------DAREFPRVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEK------ 444

Query: 364 DEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYSTCSI 423
                D   IP  Q+ L            LS + S    V  H+    +   IVYSTCS+
Sbjct: 445 -----DFMQIPHLQKQLL-----------LSAIDS----VDSHSK---TGGIIVYSTCSV 481

Query: 424 HAEENERVVIDLLLDKK 440
             EE+E+VV D  L K+
Sbjct: 482 AVEEDEQVV-DYALRKR 497

>TDEL0B04390 Chr2 (769749..771770) [2022 bp, 673 aa] {ON} Anc_8.171
           YBL024W
          Length = 673

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 82/314 (26%), Positives = 122/314 (38%), Gaps = 80/314 (25%)

Query: 226 GKIIIQDRASCFPAHILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVF 285
           G I  Q+  S  P  +L   P   ++D CAAPG+KT   A  I +L+ DT  +     V 
Sbjct: 143 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKT---AQMIEALHKDT--DEPTGFVV 197

Query: 286 AFEKDPERSKILDKMVKIAGCKKLVEINTGD--FTKI----ATPEKYPNVTGF---IVDP 336
           A + D +RS +L   +K      L+ +N     F +I    A      NV  F   + D 
Sbjct: 198 ANDADSKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKSSAADDSSKANVLKFDRVLCDV 257

Query: 337 SCSGSGIFGRKFIDNINSNKKLTEKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKL 396
            CSG G   +    N+N  +  T                 Q  L               L
Sbjct: 258 PCSGDGTMRK----NVNVWRDWT----------------PQGGLG--------------L 283

Query: 397 SSFQFQVVKHAMSFPSAK-KIVYSTCSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLS- 454
            + QF ++   +     K ++VYSTCS++  ENE VV + L     ++WG K+   S   
Sbjct: 284 HTVQFNILNRGLHLLKNKGRLVYSTCSMNPIENEAVVAEAL-----RKWGDKIRLVSCED 338

Query: 455 -IPTWERRGLVSEFEDVFKNDPAMDPKQLA---------------------EGCIRTLPK 492
            +P   R   VS++  + +N   M P++                       E CIR  P 
Sbjct: 339 KLPGLVRSKGVSQWPVIDRN---MTPREKGDEGTHDSWFPPTEEEAAKFNLENCIRVYPH 395

Query: 493 EDGGIGFFAVCFER 506
           +    GFF   FE+
Sbjct: 396 QQNTGGFFITVFEK 409

>KNAG0I01870 Chr9 complement(366800..368689) [1890 bp, 629 aa] {ON}
           Anc_2.247 YNL061W
          Length = 629

 Score = 63.9 bits (154), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 68/257 (26%), Positives = 106/257 (41%), Gaps = 63/257 (24%)

Query: 188 VDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAHILNATPD 247
           + +W+K+  G   +D  +P   G +P         Y  G  I+Q  +S  P   L+   +
Sbjct: 311 IGNWTKV--GLQIFDSQVP--IGATPE--------YLAGHYILQAASSFLPVIALDPQEN 358

Query: 248 DYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKMVKIAGCK 307
           + I+D  AAPG KTT    YI ++  +T        VFA + +  R+K L   +   GC 
Sbjct: 359 ERILDMAAAPGGKTT----YISAMMKNTGC------VFANDANKNRTKSLIANIHRLGCT 408

Query: 308 KLVEINTGDFTKIATPEKYPNVTG----FIVDPSCSGSGIFGRKFIDNINSNKKLTEKVK 363
             +  N           ++P V G     ++D  CSG+G+ G+     ++  +K      
Sbjct: 409 NTIVCNY-------DAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEK------ 455

Query: 364 DEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYSTCSI 423
                D   IP  Q+ L            LS + S      K  +       IVYSTCS+
Sbjct: 456 -----DFIQIPHLQKQLL-----------LSAIDSVDANSKKGGI-------IVYSTCSV 492

Query: 424 HAEENERVVIDLLLDKK 440
             EE+E  V+D  L K+
Sbjct: 493 AVEEDE-AVVDYALRKR 508

>KAFR0J00970 Chr10 (174873..176705) [1833 bp, 610 aa] {ON} Anc_2.247
           YNL061W
          Length = 610

 Score = 63.5 bits (153), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 68/257 (26%), Positives = 107/257 (41%), Gaps = 63/257 (24%)

Query: 188 VDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAHILNATPD 247
           + +W+K+  G   +D  +P   G +P         Y  G+ I+Q  +S  P   L+   +
Sbjct: 294 IGNWTKV--GLQIFDSQVP--IGATPE--------YLAGQYILQAASSFLPVIALDPQEN 341

Query: 248 DYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKMVKIAGCK 307
           + I+D  +APG KTT    YI +L  +T        VFA + +  R+K L   +   GC 
Sbjct: 342 ERILDMASAPGGKTT----YISALMKNTGC------VFANDANKNRTKSLIANIHRLGCT 391

Query: 308 KLVEINTGDFTKIATPEKYPNVTG----FIVDPSCSGSGIFGRKFIDNINSNKKLTEKVK 363
             +  N           ++P V G     ++D  CSG+G+ G          K  + KV 
Sbjct: 392 NTIVCNY-------DAREFPKVIGGFDRILLDAPCSGTGVIG----------KDQSVKVS 434

Query: 364 DEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYSTCSI 423
              +D  Q   L+++ L  A    D  ++                   S   IVYSTCS+
Sbjct: 435 RTEKDFIQIPHLQKQLLLSAIDSVDANSK-------------------SGGVIVYSTCSV 475

Query: 424 HAEENERVVIDLLLDKK 440
             EE+E  V+D  L K+
Sbjct: 476 AVEEDE-AVVDYALRKR 491

>ZYRO0G08998g Chr7 complement(726070..728121) [2052 bp, 683 aa] {ON}
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 683

 Score = 63.5 bits (153), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 77/311 (24%), Positives = 114/311 (36%), Gaps = 75/311 (24%)

Query: 226 GKIIIQDRASCFPAHILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVF 285
           G I  Q+  S  P  +L+  P   ++D CAAPG+KT  +  Y+   +ND    F    V 
Sbjct: 142 GNISRQEAVSMIPPTLLDVQPHHTVLDMCAAPGSKTAQMIEYLHR-DNDEPSGF----VV 196

Query: 286 AFEKDPERSKILDKMVKIAGCKKLVEINTGDFTKIATPEKYPNVTG---------FIVDP 336
           A + D +RS +L   +K      L+ +N  D       + +P+ T           + D 
Sbjct: 197 ANDADAKRSHMLVHQLKRLNSANLIVVNH-DAQFFPRVKAHPDHTNKKDILRFDRVLCDV 255

Query: 337 SCSGSGIFGRKFIDNINSNKKLTEKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKL 396
            CSG G   +    N+N  +  T                 Q  LA              L
Sbjct: 256 PCSGDGTMRK----NVNVWRDWT----------------TQNGLA--------------L 281

Query: 397 SSFQFQVVKHAMS-FPSAKKIVYSTCSIHAEENERVVIDLLLDKKVKEWGWKVT------ 449
            + Q  ++   +    S  ++VYSTCS++  ENE VV + L     ++WG KV       
Sbjct: 282 HNVQLNILNRGLHLLKSGGRLVYSTCSMNPIENEAVVAEAL-----RKWGGKVRLVDCSD 336

Query: 450 -----PRSLSIPTW---ERRGLVSEFEDVFKNDPAMDPKQLAEG------CIRTLPKEDG 495
                 RS  I  W    R     E  +   ND    P            C+R  P +  
Sbjct: 337 KLPGLVRSNGINQWPVLNRNMETKEKGEDGTNDSWFPPTDEEAARFHLDYCVRVYPHQQN 396

Query: 496 GIGFFAVCFER 506
             GFF    E+
Sbjct: 397 TGGFFITVLEK 407

>AFR179C Chr6 complement(766458..768560) [2103 bp, 700 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL024W
           (NCL1)
          Length = 700

 Score = 63.2 bits (152), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 78/309 (25%), Positives = 116/309 (37%), Gaps = 74/309 (23%)

Query: 226 GKIIIQDRASCFPAHILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVF 285
           G I  Q+  S  P ++L   P   ++D CAAPG+KT  +   + + N      F    V 
Sbjct: 146 GNISRQEAVSMIPPNVLGVEPHHSVLDMCAAPGSKTAQLVEALHA-NGPEPSGF----VV 200

Query: 286 AFEKDPERSKILDKMVKIAGCKKLVEINTGD--FTKIATPEKYPNVTGF---IVDPSCSG 340
           A + D  RS +L   +K      L+ +N     F +I T E   +   F   + D  CSG
Sbjct: 201 ANDADYRRSHMLVHQLKRLNSANLIVVNHDAQFFPRIKTAEGSKDFLKFDRVLCDVPCSG 260

Query: 341 SGIFGRKFIDNINSNKKLTEKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQ 400
            G   +    NIN         KD G                             L + Q
Sbjct: 261 DGTMRK----NINV-------WKDWGTGSGLG-----------------------LHTVQ 286

Query: 401 FQVVKHAMS-FPSAKKIVYSTCSIHAEENERVVIDLLLDKKVKEWGWKVT---------- 449
             ++   ++   +  ++VYSTCS++  ENE VV   L     ++WG K+           
Sbjct: 287 LNILNRGLTLLKNGGRLVYSTCSLNPIENEAVVAAAL-----RKWGAKIKLVNCDDQLLG 341

Query: 450 -PRSLSIPTWERRGLVSEFEDVFKNDPAM----------DPKQL-AEGCIRTLPKEDGGI 497
             RS  I +W    L   +E+  K D             + K+   E CIR  P +    
Sbjct: 342 LVRSTGISSWPV--LDKNYEEKNKGDDGTIATWFPPSEEEAKEFNLENCIRVYPHQQNTG 399

Query: 498 GFFAVCFER 506
           GFF   FE+
Sbjct: 400 GFFISVFEK 408

>KLLA0F03399g Chr6 (319007..320866) [1860 bp, 619 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 619

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 67/257 (26%), Positives = 105/257 (40%), Gaps = 63/257 (24%)

Query: 188 VDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAHILNATPD 247
           +  W+K+  G   +D  +P   G +P         Y  G  I+Q  +S  P   L+   +
Sbjct: 296 IGSWTKV--GLQIFDSQVP--IGATPE--------YLAGHYILQAASSFLPVIALDPQEN 343

Query: 248 DYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKMVKIAGCK 307
           + I+D  AAPG KTT    YI ++  +T        VFA + +  R+K L   +   GC 
Sbjct: 344 ERILDMAAAPGGKTT----YISAMMKNTGC------VFANDANKARTKSLIANIHRLGCT 393

Query: 308 KLVEINTGDFTKIATPEKYPNVTG----FIVDPSCSGSGIFGRKFIDNINSNKKLTEKVK 363
             +  N           ++P V G     ++D  CSG+G+ G+     ++  +K      
Sbjct: 394 NTIVCNY-------DAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEK------ 440

Query: 364 DEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYSTCSI 423
                D   IP  Q+ L            LS + S          +  +   IVYSTCS+
Sbjct: 441 -----DFMQIPHLQKQLL-----------LSAIDSVD-------SNSKTGGVIVYSTCSV 477

Query: 424 HAEENERVVIDLLLDKK 440
             +ENE  V+D  L K+
Sbjct: 478 AVDENE-AVVDYALRKR 493

>CAGL0J10032g Chr10 (983405..985264) [1860 bp, 619 aa] {ON} highly
           similar to uniprot|P40991 Saccharomyces cerevisiae
           YNL061w NOP2
          Length = 619

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 67/257 (26%), Positives = 106/257 (41%), Gaps = 63/257 (24%)

Query: 188 VDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAHILNATPD 247
           +  W+K+  G   +D  +P   G +P         Y  G  I+Q  +S  P   L+   +
Sbjct: 302 IGSWTKV--GLQIFDSQVP--IGATPE--------YLAGNYILQAASSFLPVVALDPQEN 349

Query: 248 DYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKMVKIAGCK 307
           + ++D  +APG KTT    YI +L  +T        VFA + + +R+K L   +   GC 
Sbjct: 350 ERVLDMASAPGGKTT----YISALMKNTGC------VFANDANKKRTKSLIANIHRLGCT 399

Query: 308 KLVEINTGDFTKIATPEKYPNVTG----FIVDPSCSGSGIFGRKFIDNINSNKKLTEKVK 363
             +  N           ++P V G     ++D  CSG+G+ G+     ++  +K      
Sbjct: 400 NTIVCNY-------DAREFPKVIGGFDRVLLDAPCSGTGVIGKDQSVKVSRTEK------ 446

Query: 364 DEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYSTCSI 423
                D   IP  Q+ L            LS + S      K  +       IVYSTCS+
Sbjct: 447 -----DFIQIPHLQKQLL-----------LSAIDSVDANSKKGGV-------IVYSTCSV 483

Query: 424 HAEENERVVIDLLLDKK 440
             EE+E  V+D  L K+
Sbjct: 484 AVEEDE-AVVDYALRKR 499

>Kpol_1003.15 s1003 (41683..43584) [1902 bp, 633 aa] {ON}
           (41683..43584) [1902 nt, 634 aa]
          Length = 633

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 68/258 (26%), Positives = 110/258 (42%), Gaps = 65/258 (25%)

Query: 188 VDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAHILNATPD 247
           +  W+K+  G   +D  +P          I +   Y  G+ I+Q  +S  P   L+   +
Sbjct: 314 IGAWTKV--GLQIFDSQVP----------IGATSEYLAGQYILQAASSFLPVVALDPQEN 361

Query: 248 DYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKMVKIAGCK 307
           + ++D  AAPG KTT    YI +L  +T        VFA + +  R+K L   +   GC 
Sbjct: 362 ERVLDMAAAPGGKTT----YISALMKNTGC------VFANDANKARTKSLIANIHRLGCT 411

Query: 308 KLVEINTGDFTKIATPEKYPNVTG----FIVDPSCSGSGIFGRKFIDNINSNKKLTEKVK 363
             +  N           ++P V G     ++D  CSG+G+ G+    ++ S++  TEK  
Sbjct: 412 NTIVCNY-------DAREFPKVIGGFDRILLDAPCSGTGVIGKD--QSVKSSR--TEK-- 458

Query: 364 DEGEDDEQDIP-LEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYSTCS 422
                D   IP L+++ L  A    D  ++   +                   IVYSTCS
Sbjct: 459 -----DFIQIPHLQKQLLLSAIDSVDANSKTGGV-------------------IVYSTCS 494

Query: 423 IHAEENERVVIDLLLDKK 440
           +  EE+E  V+D  L K+
Sbjct: 495 VAVEEDE-AVVDYALRKR 511

>YNL061W Chr14 (510540..512396) [1857 bp, 618 aa] {ON}  NOP2Probable
           RNA m(5)C methyltransferase, essential for processing
           and maturation of 27S pre-rRNA and large ribosomal
           subunit biogenesis; localized to the nucleolus;
           constituent of 66S pre-ribosomal particles
          Length = 618

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 68/257 (26%), Positives = 105/257 (40%), Gaps = 63/257 (24%)

Query: 188 VDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAHILNATPD 247
           +  W+K+  G   +D  +P   G +P         Y  G  I+Q  +S  P   L+   +
Sbjct: 299 IGSWTKV--GLQIFDSQVP--IGATPE--------YLAGHYILQAASSFLPVIALDPHEN 346

Query: 248 DYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKMVKIAGCK 307
           + I+D  AAPG KTT    YI ++  +T        VFA + +  R+K L   +   GC 
Sbjct: 347 ERILDMAAAPGGKTT----YISAMMKNTGC------VFANDANKSRTKSLIANIHRLGCT 396

Query: 308 KLVEINTGDFTKIATPEKYPNVTG----FIVDPSCSGSGIFGRKFIDNINSNKKLTEKVK 363
             +  N           ++P V G     ++D  CSG+G+ G          K  + KV 
Sbjct: 397 NTIVCNY-------DAREFPKVIGGFDRILLDAPCSGTGVIG----------KDQSVKVS 439

Query: 364 DEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYSTCSI 423
              +D  Q   L+++ L  A    D  ++   +                   IVYSTCS+
Sbjct: 440 RTEKDFIQIPHLQKQLLLSAIDSVDCNSKHGGV-------------------IVYSTCSV 480

Query: 424 HAEENERVVIDLLLDKK 440
             EE+E  VID  L K+
Sbjct: 481 AVEEDE-AVIDYALRKR 496

>Kpol_1002.109 s1002 (272892..274904) [2013 bp, 670 aa] {ON}
           (272892..274904) [2013 nt, 671 aa]
          Length = 670

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 77/310 (24%), Positives = 116/310 (37%), Gaps = 73/310 (23%)

Query: 226 GKIIIQDRASCFPAHILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVF 285
           G I  Q+  S  P  +L   P   ++D CAAPG+KT  +    + + +D    F    V 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKTAQLIE-ALHMEDDEPSGF----VV 199

Query: 286 AFEKDPERSKILDKMVKIAGCKKLVEINTGD--FTKIATPE---KYPNVTGF---IVDPS 337
           A + D +RS +L   +K      L+ +N     F +I   E   +  +V  F   + D  
Sbjct: 200 ANDADAKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKLHEDATQKKDVLRFDRVLCDVP 259

Query: 338 CSGSGIFGRKFIDNINSNKKLTEKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLS 397
           CSG G   +    N+N  +                    Q  L               L 
Sbjct: 260 CSGDGTMRK----NVNVWRDWNT----------------QSGLG--------------LH 285

Query: 398 SFQFQVVKHAMSFPSAK-KIVYSTCSIHAEENERVVIDLLLDKKVKEWGWKV-------- 448
           + Q  ++   +     K ++VYSTCS++  ENE VV   L     ++WG K+        
Sbjct: 286 TVQLNILNRGLHLLKPKGRLVYSTCSMNPIENEAVVAAAL-----RKWGDKIRLVNCDDK 340

Query: 449 ---TPRSLSIPTW---------ERRGLVSEFEDVFKNDPAMDPKQLAEGCIRTLPKEDGG 496
                RS  I TW         +++G  +  E  F   P    K     CIR  P +   
Sbjct: 341 LPGLVRSKGISTWPVVDRNMEEKKKGDENTVESWFAPTPEEAEKFDLSSCIRVYPHQQNT 400

Query: 497 IGFFAVCFER 506
            GFF   FE+
Sbjct: 401 GGFFITVFEK 410

>Smik_14.266 Chr14 (490908..492764) [1857 bp, 618 aa] {ON} YNL061W
           (REAL)
          Length = 618

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 68/257 (26%), Positives = 105/257 (40%), Gaps = 63/257 (24%)

Query: 188 VDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAHILNATPD 247
           +  W+K+  G   +D  +P   G +P         Y  G  I+Q  +S  P   L+   +
Sbjct: 299 IGSWTKV--GLQIFDSQVP--IGATPE--------YLAGHYILQAASSFLPVIALDPHEN 346

Query: 248 DYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKMVKIAGCK 307
           + I+D  AAPG KTT    YI ++  +T        VFA + +  R+K L   +   GC 
Sbjct: 347 ERILDMAAAPGGKTT----YISAMMKNTGC------VFANDANKSRTKSLIANIHRLGCT 396

Query: 308 KLVEINTGDFTKIATPEKYPNVTG----FIVDPSCSGSGIFGRKFIDNINSNKKLTEKVK 363
             +  N           ++P V G     ++D  CSG+G+ G          K  + KV 
Sbjct: 397 NTIVCNY-------DAREFPKVIGGFDRILLDAPCSGTGVIG----------KDQSVKVS 439

Query: 364 DEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYSTCSI 423
              +D  Q   L+++ L  A    D  ++   +                   IVYSTCS+
Sbjct: 440 RTEKDFIQIPHLQKQLLLSAIDSVDCNSKHGGV-------------------IVYSTCSV 480

Query: 424 HAEENERVVIDLLLDKK 440
             EE+E  VID  L K+
Sbjct: 481 AVEEDE-AVIDYALRKR 496

>Ecym_3284 Chr3 (537227..539047) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii ADL254W
          Length = 606

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 70/258 (27%), Positives = 103/258 (39%), Gaps = 65/258 (25%)

Query: 188 VDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAHILNATPD 247
           +  W+K+  G   +D  +P   G +P         Y  G  I+Q  +S  P   L+   +
Sbjct: 288 IGTWTKV--GLQIFDSQVP--IGATPE--------YLAGHYILQAASSFLPVIALDPQEN 335

Query: 248 DYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKMVKIAGCK 307
           + I+D  AAPG KTT    YI +L  +T        VFA + +  R+K L   +   GC 
Sbjct: 336 ERILDMAAAPGGKTT----YISALMKNTGC------VFANDANKARTKSLIANIHRLGCT 385

Query: 308 KLVEINTGDFTKIATPEKYPNVTG----FIVDPSCSGSGIFGRKFIDNINSNKKLTEKVK 363
             +  N           ++P V G     ++D  CSG+G+  +             + VK
Sbjct: 386 NTIVCNYD-------AREFPKVIGGFDRILLDAPCSGTGVIAK------------DQSVK 426

Query: 364 -DEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYSTCS 422
               E D   IP  Q+ L            LS + S         +       IVYSTCS
Sbjct: 427 VSRTEKDFMQIPHLQKQLI-----------LSAIDSVDSNSKTGGI-------IVYSTCS 468

Query: 423 IHAEENERVVIDLLLDKK 440
           +  EENE  V+D  L K+
Sbjct: 469 VAVEENE-AVVDYALRKR 485

>NDAI0B01830 Chr2 (436254..438314) [2061 bp, 686 aa] {ON} Anc_8.171
           YBL024W
          Length = 686

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 79/312 (25%), Positives = 120/312 (38%), Gaps = 77/312 (24%)

Query: 226 GKIIIQDRASCFPAHILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVF 285
           G I  Q+  S  P  +L   P   ++D CAAPG+KT   A  I +L+ DT  +     V 
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKT---AQLIEALHKDT--DEPTGFVV 199

Query: 286 AFEKDPERSKILDKMVKIAGCKKLVEINTGD--FTKI---ATPEKYPNVTGF---IVDPS 337
           A + D +RS +L   +K      L+ +N     F +I      EK   +  F   + D  
Sbjct: 200 ANDADAKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKLHTDAEKKKEMLKFDRILCDVP 259

Query: 338 CSGSGIFGRKFIDNINSNKKLTEKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLS 397
           CSG G   +    N+N  K                    Q  L               L 
Sbjct: 260 CSGDGTMRK----NVNVWKDWN----------------TQGGLG--------------LH 285

Query: 398 SFQFQVVKHAMS-FPSAKKIVYSTCSIHAEENERVVIDLLLDKKVKEWGWKV-------- 448
           + Q  ++   ++   S  ++VYSTCS++  ENE VV + L     ++WG K+        
Sbjct: 286 TVQLNILNRGLNLLKSGGRLVYSTCSMNPIENEAVVAEAL-----RKWGSKIKLVNCDDK 340

Query: 449 ---TPRSLSIPTW---------ERRGLVSEFEDVFKNDPAMDPKQL--AEGCIRTLPKED 494
                RS  I  W         + +G     E  F   P  + +++   + CIR  P + 
Sbjct: 341 LVGLVRSKGISNWPVLDRNMAVKNKGDEGTIESWFP--PTEEEREIFHLDSCIRVYPHQQ 398

Query: 495 GGIGFFAVCFER 506
              GFF   FE+
Sbjct: 399 NTGGFFITVFEK 410

>NCAS0G03030 Chr7 (556908..558380) [1473 bp, 490 aa] {ON} Anc_2.247
           YNL061W
          Length = 490

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 67/257 (26%), Positives = 105/257 (40%), Gaps = 63/257 (24%)

Query: 188 VDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAHILNATPD 247
           +  W+K+  G   +D  +P   G +P         Y  G  I+Q  +S  P   L+   +
Sbjct: 171 IGSWTKV--GLQIFDSQVP--IGATPE--------YLAGNYILQAASSFLPVIALDPHEN 218

Query: 248 DYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKMVKIAGCK 307
           + I+D  AAPG KTT    YI ++  +T        VFA + +  R+K L   +   GC 
Sbjct: 219 ERILDMAAAPGGKTT----YISAMMKNTGC------VFANDANKNRTKSLIANIHRLGCT 268

Query: 308 KLVEINTGDFTKIATPEKYPNVTG----FIVDPSCSGSGIFGRKFIDNINSNKKLTEKVK 363
             +  N           ++P V G     ++D  CSG+G+ G          K  + KV 
Sbjct: 269 NTIVCNY-------DAREFPKVIGGFDRILLDAPCSGTGVIG----------KDQSVKVS 311

Query: 364 DEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYSTCSI 423
              +D  Q   L+++ L  A    D  ++   +                   IVYSTCS+
Sbjct: 312 RTEKDFIQIPHLQKQLLLSAIDSVDCNSKHGGV-------------------IVYSTCSV 352

Query: 424 HAEENERVVIDLLLDKK 440
             EE+E  V+D  L K+
Sbjct: 353 AVEEDE-AVVDYALRKR 368

>KLTH0G09460g Chr7 (787197..789110) [1914 bp, 637 aa] {ON} similar
           to uniprot|P40991 Saccharomyces cerevisiae YNL061W NOP2
           Probable RNA m(5)C methyltransferase essential for
           processing and maturation of 27S pre-rRNA and large
           ribosomal subunit biogenesis localized to the nucleolus
          Length = 637

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 67/254 (26%), Positives = 103/254 (40%), Gaps = 63/254 (24%)

Query: 191 WSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAHILNATPDDYI 250
           W+K+  G   +D  +P   G +P         Y  G  I+Q  +S  P   L+   ++ I
Sbjct: 313 WTKV--GLQIFDSQVP--IGATPE--------YLAGHYILQAASSFLPVVALDPHENERI 360

Query: 251 IDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKMVKIAGCKKLV 310
           +D  AAPG KTT    YI ++  +T        VFA + +  R+K L   +   GC   +
Sbjct: 361 LDMAAAPGGKTT----YISAMMKNTGC------VFANDANKARTKSLIANIHRLGCTNTI 410

Query: 311 EINTGDFTKIATPEKYPNVTG----FIVDPSCSGSGIFGRKFIDNINSNKKLTEKVKDEG 366
             N           ++P V G     ++D  CSG+G+            K  + KV    
Sbjct: 411 VCNY-------DAREFPKVIGGFDRILLDAPCSGTGVIA----------KDQSVKVSRTD 453

Query: 367 EDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYSTCSIHAE 426
           +D  Q   L+++ L  A    D  ++   +                   IVYSTCS+  E
Sbjct: 454 KDFMQIPHLQKQLLLSAIDSVDANSKTGGV-------------------IVYSTCSVAVE 494

Query: 427 ENERVVIDLLLDKK 440
           ENE  V+D  L K+
Sbjct: 495 ENE-AVVDYALRKR 507

>NDAI0D01050 Chr4 (236435..238312) [1878 bp, 625 aa] {ON} Anc_2.247
           YNL061W
          Length = 625

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 71/257 (27%), Positives = 108/257 (42%), Gaps = 63/257 (24%)

Query: 188 VDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAHILNATPD 247
           +  W+K+  G   +D  +P   G +P         Y  G  I+Q  +S  P   L+   +
Sbjct: 306 IGSWTKV--GLQIFDSQVP--IGATPE--------YLAGNYILQAASSFLPVIALDPHEN 353

Query: 248 DYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKMVKIAGCK 307
           + I+D  AAPG KTT    YI +L  +T        VFA + +  R+K L   +   GC 
Sbjct: 354 ERILDMAAAPGGKTT----YISALMKNTGT------VFANDANKNRTKSLIANIHRLGCT 403

Query: 308 KLVEINTGDFTKIATPEKYPNVTG----FIVDPSCSGSGIFGRKFIDNINSNKKLTEKVK 363
             +  N           ++P V G     ++D  CSG+G+ G+      + + K++   K
Sbjct: 404 NTIVCNY-------DAREFPKVIGGFDRILLDAPCSGTGVIGK------DQSVKVSRTEK 450

Query: 364 DEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYSTCSI 423
           D  +     IP  Q+ L            LS + S      KH         IVYSTCS+
Sbjct: 451 DFIQ-----IPHLQKQLL-----------LSAIDSVDCN-SKH------GGIIVYSTCSV 487

Query: 424 HAEENERVVIDLLLDKK 440
             EE+E  V+D  L K+
Sbjct: 488 AVEEDE-AVVDYALRKR 503

>TDEL0C04150 Chr3 complement(734914..736758) [1845 bp, 614 aa] {ON}
           Anc_2.247 YNL061W
          Length = 614

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 67/257 (26%), Positives = 106/257 (41%), Gaps = 63/257 (24%)

Query: 188 VDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAHILNATPD 247
           +  W+K+  G   +D  +P   G +P         Y  G  I+Q  +S  P   L+   +
Sbjct: 296 IGSWTKV--GLQIFDSQVP--IGATPE--------YLAGNYILQAASSFLPVIALDPHEN 343

Query: 248 DYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKMVKIAGCK 307
           + I+D  AAPG KTT    YI +L  +T        VFA + +  R+K L   +   GC 
Sbjct: 344 ERILDMAAAPGGKTT----YISALMKNTGC------VFANDANKARTKSLIANIHRLGCT 393

Query: 308 KLVEINTGDFTKIATPEKYPNVTG----FIVDPSCSGSGIFGRKFIDNINSNKKLTEKVK 363
             +  N           ++P V G     ++D  C+G+G+ G          K  + KV 
Sbjct: 394 NTIVCNY-------DAREFPKVIGGFDRILLDAPCTGTGVIG----------KDQSVKVS 436

Query: 364 DEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYSTCSI 423
              +D  Q   L+++ L  A    D  ++   +                   IVYSTCS+
Sbjct: 437 RTEKDFIQVPHLQKQLLLSAIDSVDSNSKTGGI-------------------IVYSTCSV 477

Query: 424 HAEENERVVIDLLLDKK 440
             EE+E +V+D  L K+
Sbjct: 478 AVEEDE-MVVDYALRKR 493

>KNAG0D02050 Chr4 (339873..341921) [2049 bp, 682 aa] {ON} Anc_8.171
           YBL024W
          Length = 682

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 77/310 (24%), Positives = 117/310 (37%), Gaps = 73/310 (23%)

Query: 226 GKIIIQDRASCFPAHILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVF 285
           G I  Q+  S  P  +L   P   ++D CAAPG+KT   A  + +L+ DT  +     V 
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKT---AQLLEALHRDT--DEPTGFVV 199

Query: 286 AFEKDPERSKILDKMVKIAGCKKLVEINTGD--FTKIAT---PEKYPNVTGF---IVDPS 337
           A + D  RS +L   +K      L+ +N     F +I T    EK  ++  F   + D  
Sbjct: 200 ANDADNRRSHMLVHQLKRLNSANLIVVNHDAQFFPRIKTSKNSEKKSDLLKFDRILCDVP 259

Query: 338 CSGSGIFGRKFIDNINSNKKLTEKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLS 397
           CSG G   +    N+N  +                    Q  L               L 
Sbjct: 260 CSGDGTMRK----NVNVWRDWN----------------TQNALG--------------LH 285

Query: 398 SFQFQVVKHAMS-FPSAKKIVYSTCSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLS-- 454
             Q  ++   +       ++VYSTCS++  ENE VV   L     ++WG KV   +    
Sbjct: 286 QVQANILNRGLHLLKKGGRLVYSTCSMNPIENEAVVAQAL-----RKWGDKVRLVNCDDK 340

Query: 455 IPTWERRGLVSEFEDVFKNDPAMDPKQLA------------------EGCIRTLPKEDGG 496
           +P   R   +S++  + +N   M+  Q                    E CIR  P +   
Sbjct: 341 LPGLVRNKGISKWPTLNRNMEEMEKGQEGANDSWFQPTEEEAEKFQLENCIRVYPHQQNT 400

Query: 497 IGFFAVCFER 506
            GFF   FE+
Sbjct: 401 GGFFITVFEK 410

>TPHA0C03150 Chr3 (697508..699334) [1827 bp, 608 aa] {ON} Anc_2.247
           YNL061W
          Length = 608

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 68/254 (26%), Positives = 105/254 (41%), Gaps = 63/254 (24%)

Query: 191 WSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAHILNATPDDYI 250
           W+K+  G   +D  +P          I +   Y  G+ I+Q  +S  P   L+   ++ +
Sbjct: 297 WTKV--GLQIFDSQVP----------IGATSEYLAGQYILQAASSFLPVVALDPQLNERV 344

Query: 251 IDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKMVKIAGCKKLV 310
           +D  AAPG KTT    YI +L  +T        VFA + +  R+K L   +   GC   +
Sbjct: 345 LDMAAAPGGKTT----YISALMKNTGC------VFANDANKARTKSLIANIHRLGCTNTI 394

Query: 311 EINTGDFTKIATPEKYPNVTG----FIVDPSCSGSGIFGRKFIDNINSNKKLTEKVKDEG 366
             N           ++P V G     ++D  CSG+G+ G+     ++  +K         
Sbjct: 395 VCNY-------DAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEK--------- 438

Query: 367 EDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYSTCSIHAE 426
             D   IP  Q+ L    A D ++   SK   F                IVYSTCS+  E
Sbjct: 439 --DFIQIPHLQKQLL-LSAIDSVDAN-SKTGGF----------------IVYSTCSVAVE 478

Query: 427 ENERVVIDLLLDKK 440
           E+E  V+D  L K+
Sbjct: 479 EDE-AVVDYALRKR 491

>Suva_14.280 Chr14 (509488..511350) [1863 bp, 620 aa] {ON} YNL061W
           (REAL)
          Length = 620

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 69/257 (26%), Positives = 105/257 (40%), Gaps = 63/257 (24%)

Query: 188 VDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAHILNATPD 247
           +  W+K+  G   +D  +P   G +P         Y  G  I+Q  +S  P   L+   +
Sbjct: 301 IGSWTKV--GLQIFDSQVP--IGATPE--------YLAGHYILQAASSFLPVIALDPHEN 348

Query: 248 DYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKMVKIAGCK 307
           + I+D  AAPG KTT    YI ++  +T        VFA + +  R+K L   +   GC 
Sbjct: 349 ERILDMAAAPGGKTT----YISAMMKNTGC------VFANDANKSRTKSLIANIHRLGCT 398

Query: 308 KLVEINTGDFTKIATPEKYPNVTG----FIVDPSCSGSGIFGRKFIDNINSNKKLTEKVK 363
             +  N           ++P V G     ++D  CSG+G+ G+     ++  +K      
Sbjct: 399 NTIVCNY-------DAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEK------ 445

Query: 364 DEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYSTCSI 423
                D   IP  Q+ L            LS + S      KH         IVYSTCS+
Sbjct: 446 -----DFIQIPHLQKQLL-----------LSAIDSVDCNS-KHGGV------IVYSTCSV 482

Query: 424 HAEENERVVIDLLLDKK 440
             EE+E  V+D  L K+
Sbjct: 483 AVEEDE-AVVDYALRKR 498

>Skud_14.271 Chr14 (500809..502668) [1860 bp, 619 aa] {ON} YNL061W
           (REAL)
          Length = 619

 Score = 59.7 bits (143), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 67/246 (27%), Positives = 100/246 (40%), Gaps = 62/246 (25%)

Query: 191 WSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAHILNATPDDYI 250
           W+K+  G   +D  +P   G +P         Y  G  I+Q  +S  P   L+   ++ I
Sbjct: 303 WTKV--GLQIFDSQVP--IGATPE--------YLAGHYILQAASSFLPVIALDPHENERI 350

Query: 251 IDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKMVKIAGCKKLV 310
           +D  AAPG KTT    YI ++  +T        VFA + +  R+K L   +   GC   +
Sbjct: 351 LDMAAAPGGKTT----YISAMMKNTGC------VFANDANKSRTKSLIANIHRLGCTNTI 400

Query: 311 EINTGDFTKIATPEKYPNVTG----FIVDPSCSGSGIFGRKFIDNINSNKKLTEKVKDEG 366
             N           ++P V G     ++D  CSG+G+ G+     ++  +K         
Sbjct: 401 VCNY-------DAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEK--------- 444

Query: 367 EDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYSTCSIHAE 426
             D   IP  Q+ L            LS + S      KH         IVYSTCS+  E
Sbjct: 445 --DFIQIPHLQKQLL-----------LSAIDSVDCNS-KHGGV------IVYSTCSVAVE 484

Query: 427 ENERVV 432
           E+E VV
Sbjct: 485 EDEAVV 490

>NCAS0B04390 Chr2 complement(795633..797648) [2016 bp, 671 aa] {ON}
           Anc_8.171 YBL024W
          Length = 671

 Score = 59.7 bits (143), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 82/313 (26%), Positives = 120/313 (38%), Gaps = 79/313 (25%)

Query: 226 GKIIIQDRASCFPAHILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVF 285
           G I  Q+  S  P  +L   P   ++D CAAPG+KT   A  I +L+ DT  +     V 
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKT---AQLIEALHKDT--DEPTGFVV 199

Query: 286 AFEKDPERSKILDKMVKIAGCKKLVEINTGD--FTKIAT---PEKYPNVTGF---IVDPS 337
           A + D  RS +L   +K      L+ +N     F +I      EK  ++  F   + D  
Sbjct: 200 ANDADARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKLHDDAEKKRDMLKFDRILCDVP 259

Query: 338 CSGSGIFGRKFIDNINSNKKLTEKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLS 397
           CSG G   +    N+N  K                    Q  L               L 
Sbjct: 260 CSGDGTMRK----NVNVWKDWN----------------AQGALG--------------LH 285

Query: 398 SFQFQVVKHAMSF--PSAKKIVYSTCSIHAEENERVVIDLLLDKKVKEWGWKV------- 448
           + Q+ ++   +    P+  ++VYSTCS++  ENE VV   L     ++WG K+       
Sbjct: 286 TVQWNILNRGLHLLKPNG-RLVYSTCSLNPIENEAVVAQAL-----RKWGNKIRLVNCDE 339

Query: 449 ----TPRSLSIPTWERRGLVSEFEDVFKND---------PAMDPKQL--AEGCIRTLPKE 493
                 RS  I  W    L  + E   KND         P+ +   L   + CIR  P +
Sbjct: 340 KLPGLVRSKGISQWP--VLNRDLETKNKNDEGVLESWFPPSEEEASLFNLDACIRVYPHQ 397

Query: 494 DGGIGFFAVCFER 506
               GFF   FE+
Sbjct: 398 QNTGGFFITVFEK 410

>KNAG0G01510 Chr7 complement(341469..343469) [2001 bp, 666 aa] {ON}
           Anc_8.171 YBL024W
          Length = 666

 Score = 59.7 bits (143), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 79/308 (25%), Positives = 122/308 (39%), Gaps = 69/308 (22%)

Query: 226 GKIIIQDRASCFPAHILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVF 285
           G I  Q+  S  P  +L    +  ++D CAAPG+KT   A  I  L+ DT  +     + 
Sbjct: 159 GNISRQEAVSMIPPLLLRLESNHNVLDMCAAPGSKT---AQLIEQLHKDT--DEPTGIIV 213

Query: 286 AFEKDPERSKILDKMVKIAGCKKLVEINTGD--FTKIATPEKYPNVT----GFIVDPSCS 339
           A + D  RS +L   +K      ++ +N     F  I T     N+T      + D  CS
Sbjct: 214 ANDSDMRRSYLLVHQLKRLNSSNILVVNHDAQFFPNIRTNSLNNNITMKFDRILCDVPCS 273

Query: 340 GSGIFGRKFIDNINSNKKLTEKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSF 399
           G G   RK I NI ++ +                   Q  L   + ++++  R  +L   
Sbjct: 274 GDGTL-RKNI-NIWNDWRF------------------QNALGLHRLQNNILNRGLQL--- 310

Query: 400 QFQVVKHAMSFPSAKKIVYSTCSIHAEENERVVIDLLLDKKVKEWGWKVTP--------- 450
                       +  ++VYSTCS++  ENE V+ + L     + W  +V+          
Sbjct: 311 ----------LRNGGRLVYSTCSMNPIENEAVIANAL-----RNWAGEVSLVNFDDELPG 355

Query: 451 --RSLSIPTW---ERRGLVSEFEDVFKND----PAMDPKQL--AEGCIRTLPKEDGGIGF 499
             RS  I +W   +R G + E  D    D    P  D ++    E CIR  P +     F
Sbjct: 356 LIRSRGISSWPVIDRNGEMRERGDPETLDSWFPPTADEQKTFNLEKCIRVYPHQQDTGAF 415

Query: 500 FAVCFERN 507
           F   FE+N
Sbjct: 416 FIAVFEKN 423

>Kwal_23.4841 s23 (890138..892021) [1884 bp, 627 aa] {ON} YNL061W
           (NOP2) - 90-kDa protein, located in nucleolus, that is
           homologous to a human proliferation-associated nucleolar
           protein, p120 [contig 5] FULL
          Length = 627

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 68/254 (26%), Positives = 103/254 (40%), Gaps = 63/254 (24%)

Query: 191 WSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAHILNATPDDYI 250
           W+K+  G   +D  +P   G +P         Y  G  I+Q  +S  P   L+   ++ I
Sbjct: 311 WTKV--GLQIFDSQVP--IGATPE--------YLAGHYILQAASSFLPVIALDPHENERI 358

Query: 251 IDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKMVKIAGCKKLV 310
           +D  AAPG KTT    YI ++  +T        VFA + +  R+K L   +   GC   +
Sbjct: 359 LDMAAAPGGKTT----YISAMMKNTGC------VFANDANKARTKSLIANIHRLGCTNTI 408

Query: 311 EINTGDFTKIATPEKYPNVTG----FIVDPSCSGSGIFGRKFIDNINSNKKLTEKVKDEG 366
             N           ++P V G     ++D  CSG+G+  +     ++  +K         
Sbjct: 409 VCNY-------DAREFPKVIGGFDRILLDAPCSGTGVIAKDQSVKVSRTEK--------- 452

Query: 367 EDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYSTCSIHAE 426
             D   IP  Q+ L            LS + S          +  +   IVYSTCS+  E
Sbjct: 453 --DFIQIPHLQKQLL-----------LSAIDSVD-------ANSKTGGVIVYSTCSVAVE 492

Query: 427 ENERVVIDLLLDKK 440
           ENE  VID  L K+
Sbjct: 493 ENE-AVIDYALRKR 505

>TPHA0H00150 Chr8 (15977..17926) [1950 bp, 649 aa] {ON} Anc_8.171
           YBL024W
          Length = 649

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 77/316 (24%), Positives = 121/316 (38%), Gaps = 83/316 (26%)

Query: 226 GKIIIQDRASCFPAHILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKR-- 283
           G I  Q+  S  P  +L+  P   ++D CAAPG+KT  +   +       HI+ D+    
Sbjct: 140 GNISRQEAVSMLPPILLDVKPHHTVLDMCAAPGSKTAQLMESL-------HIDSDEPSGF 192

Query: 284 VFAFEKDPERSKILDKMVKIAGCKKLVEIN-TGDF-------TKIATPEKYPNVTGFIVD 335
           V A + D +RS +L   +K      ++ +N    F       TK A+ ++       + D
Sbjct: 193 VIANDADNKRSHLLVHQLKRLSTSNVLIVNHDAQFFPNLKINTKDASSQEDLKFDRILCD 252

Query: 336 PSCSGSGIFGRKFIDNINSNKKLTEKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSK 395
             CSG G   +    N+N  K                    Q  L               
Sbjct: 253 VPCSGDGTMRK----NVNVWKNWN----------------TQNALG-------------- 278

Query: 396 LSSFQFQVVKHAMS-FPSAKKIVYSTCSIHAEENERVVIDLLLDKKVKEWGWKVTP---- 450
           L + QF ++   ++      K+VYSTCS++  ENE VV  +L     ++WG KV      
Sbjct: 279 LHNVQFNILDRGLTLLKETGKLVYSTCSLNPIENEAVVAAVL-----RKWGDKVRLVCCD 333

Query: 451 -------RSLSIPTWERRGLVSEFEDVFKN------DPAMDPKQLAE-------GCIRTL 490
                  RS  + TW    +  + E+V +N      + +  P    E        C+R  
Sbjct: 334 DKLKGLIRSKGLTTWPV--INRDMEEVPRNRSDDKINKSCYPPTEEEVSKFNLDRCMRVY 391

Query: 491 PKEDGGIGFFAVCFER 506
           P +    GFF   FE+
Sbjct: 392 PHQQNTGGFFITMFEK 407

>Suva_2.97 Chr2 (172667..174679) [2013 bp, 670 aa] {ON} YBL024W
           (REAL)
          Length = 670

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 77/314 (24%), Positives = 115/314 (36%), Gaps = 81/314 (25%)

Query: 226 GKIIIQDRASCFPAHILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVF 285
           G I  Q+  S  P  +L   P   ++D CAAPG+KT   A  I +L+ DT  +     V 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKT---AQLIEALHKDT--DEPSGFVV 199

Query: 286 AFEKDPERSKILDKMVKIAGCKKLVEINTGD--FTKIATPE---KYPNVTGF---IVDPS 337
           A + D  RS +L   +K      L+ +N     F +I   E   K  +V  F   + D  
Sbjct: 200 ANDADARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHENSNKKNDVLKFDRILCDVP 259

Query: 338 CSGSGIFGRKFIDNINSNKKLTEKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLS-KL 396
           CSG G   +    N+N  K                               D  T+    L
Sbjct: 260 CSGDGTMRK----NVNVWK-------------------------------DWNTQAGLGL 284

Query: 397 SSFQFQVVKHAMS-FPSAKKIVYSTCSIHAEENERVVIDLLLDKKVKEWG---------- 445
            + Q  ++   +       ++VYSTCS++  ENE V+ + L     ++WG          
Sbjct: 285 HTVQLNILNRGLHLLKDGGRLVYSTCSLNPIENEAVIAEAL-----RKWGDKIRLVNCDD 339

Query: 446 -------------WKVTPRSLSIPTWERRGLVSEFEDVFKNDPAMDPKQLAEGCIRTLPK 492
                        W V  R+L+  T   +G     E  F        K   + C+R  P 
Sbjct: 340 KLSGLVRSKGVSKWPVYDRNLTEKT---KGDEGTLESFFAPSEEEASKFNLQNCMRVYPH 396

Query: 493 EDGGIGFFAVCFER 506
           +    GFF   FE+
Sbjct: 397 QQNTGGFFITVFEK 410

>TBLA0E03850 Chr5 (967569..969467) [1899 bp, 632 aa] {ON} Anc_2.247
           YNL061W
          Length = 632

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 64/257 (24%), Positives = 104/257 (40%), Gaps = 63/257 (24%)

Query: 188 VDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRASCFPAHILNATPD 247
           +  W+K+  G   +D  +P   G +P         Y  G  I+Q  +S  P   L+   +
Sbjct: 313 IGAWTKV--GLQIFDSQVP--IGATPE--------YLAGNYILQAASSFLPVIALDPQEN 360

Query: 248 DYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKMVKIAGCK 307
           + ++D  +APG KTT    YI +L  +T        +FA + +  R+K L   +   GC 
Sbjct: 361 ERVLDMASAPGGKTT----YISALMKNTGC------IFANDANKARTKSLIANIHRLGCT 410

Query: 308 KLVEINTGDFTKIATPEKYPNVTG----FIVDPSCSGSGIFGRKFIDNINSNKKLTEKVK 363
             +  N           ++P V G     ++D  CSG+G+ G+     ++  +K      
Sbjct: 411 NTIVCNY-------DAREFPKVIGGFDRILLDAPCSGTGVIGKDQSVKVSRTEK------ 457

Query: 364 DEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMSFPSAKKIVYSTCSI 423
                D   IP  Q+ L            LS + S         +       +VYSTCS+
Sbjct: 458 -----DFIQIPHLQKQLI-----------LSAIDSLDSNSKNGGV-------LVYSTCSV 494

Query: 424 HAEENERVVIDLLLDKK 440
             EE+E  V+D  L K+
Sbjct: 495 AVEEDE-AVVDYALRKR 510

>NCAS0B05640 Chr2 complement(1068983..1070962) [1980 bp, 659 aa]
           {ON} 
          Length = 659

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 76/310 (24%), Positives = 112/310 (36%), Gaps = 73/310 (23%)

Query: 226 GKIIIQDRASCFPAHILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVF 285
           G I  Q+  S  P  +L   P   ++D CAAPG+KT   A  + +L+ D+  N     V 
Sbjct: 139 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKT---AQLLEALHRDS--NEPTGFVV 193

Query: 286 AFEKDPERSKILDKMVKIAGCKKLVEINTGD--FTKIATPEKYPNVTGF------IVDPS 337
           A + D  R+ +L   +K      L+ +N     F KI       N +G       + D  
Sbjct: 194 ANDSDSRRAYMLVHQLKRLNSANLLVVNHDAQFFPKIKLRADATNKSGMLKYDRILCDVP 253

Query: 338 CSGSGIFGRKFIDNINSNKKLTEKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLS 397
           CSG G   +    N+N  K                    Q  L               L 
Sbjct: 254 CSGDGTMRK----NVNVWKDWN----------------TQNALG--------------LH 279

Query: 398 SFQFQVVKHAMS-FPSAKKIVYSTCSIHAEENERVVIDLLLDKKVKEWGWKV-------- 448
           + Q  ++   +       ++VYSTCS++  ENE VV   L     ++WG K+        
Sbjct: 280 NVQLNILNRGLQLLKDNGRLVYSTCSLNPIENEAVVAAAL-----RKWGNKIKLVDCQNK 334

Query: 449 ---TPRSLSIPTW-----ERRGLVSEFEDV----FKNDPAMDPKQLAEGCIRTLPKEDGG 496
                RS  I  W     E   +  + E      F+   A       E C+R  P +   
Sbjct: 335 LQGLVRSNGISHWSVYDREMNAITKDSESTKSSWFEPTDAEKENFNLEHCMRVYPHQQNT 394

Query: 497 IGFFAVCFER 506
            GFF   FE+
Sbjct: 395 GGFFIAVFEK 404

>KAFR0B02220 Chr2 complement(438809..440869) [2061 bp, 686 aa] {ON}
           Anc_8.171 YBL024W
          Length = 686

 Score = 57.4 bits (137), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 74/310 (23%), Positives = 111/310 (35%), Gaps = 73/310 (23%)

Query: 226 GKIIIQDRASCFPAHILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVF 285
           G I  Q+  S  P  +L   P   ++D CAAPG+KT  +    + ++ D    F    V 
Sbjct: 146 GNISRQEAVSMIPPIVLEVEPQHTVLDMCAAPGSKTAQLIE-ALHMDTDEPTGF----VV 200

Query: 286 AFEKDPERSKILDKMVKIAGCKKLVEINTGD--FTKIAT---PEKYPNVTGF---IVDPS 337
           A + D  RS +L   +K      L+ +N     F +I      +K  ++  F   + D  
Sbjct: 201 ANDADSRRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKISNDSDKKKDLLKFDRILCDVP 260

Query: 338 CSGSGIFGRKFIDNINSNKKLTEKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLS 397
           CSG G   +    N+N  K                    Q  L               L 
Sbjct: 261 CSGDGTMRK----NVNVWKDWN----------------TQSGLG--------------LH 286

Query: 398 SFQFQVVKHAMS-FPSAKKIVYSTCSIHAEENERVVIDLLLDKKVKEWGWKVT------- 449
           + Q+ ++   ++   S  ++VYSTCS++  ENE VV   L     + WG K+        
Sbjct: 287 TVQYNILNRGLNLLKSGGRLVYSTCSLNPIENEAVVAQAL-----RTWGDKIKLVNCGDK 341

Query: 450 ----PRSLSIPTW---------ERRGLVSEFEDVFKNDPAMDPKQLAEGCIRTLPKEDGG 496
                RS  I  W         + +G     E  F            E CIR  P +   
Sbjct: 342 LPGLVRSQGISQWPVIDRNMTEKNKGDEGTIESWFPPSEEEAKNFHLENCIRVYPHQQNT 401

Query: 497 IGFFAVCFER 506
            GFF    E+
Sbjct: 402 GGFFITVIEK 411

>Skud_2.81 Chr2 (156273..158318) [2046 bp, 681 aa] {ON} YBL024W
           (REAL)
          Length = 681

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 75/311 (24%), Positives = 115/311 (36%), Gaps = 75/311 (24%)

Query: 226 GKIIIQDRASCFPAHILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVF 285
           G I  Q+  S  P  +L   P   ++D CAAPG+KT   A  I +L+ DT  +     V 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKT---AQLIEALHKDT--DEPSGFVV 199

Query: 286 AFEKDPERSKILDKMVKIAGCKKLVEINTGD--FTKI---ATPEKYPNVTGF---IVDPS 337
           A + D  RS +L   +K      L+ +N     F +I       K  ++  F   + D  
Sbjct: 200 ANDADARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHGNSNKKNDILKFDRILCDVP 259

Query: 338 CSGSGIFGRKFIDNINSNKKLTEKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLS-KL 396
           CSG G   +    N+N  K                               D  T+    L
Sbjct: 260 CSGDGTMRK----NVNVWK-------------------------------DWNTQAGLGL 284

Query: 397 SSFQFQVVKHAMS-FPSAKKIVYSTCSIHAEENERVVIDLLLDKKVKEWGWKVTP----- 450
            + Q  ++   +    S  ++VYSTCS++  ENE V+ + L     ++WG K+       
Sbjct: 285 HTVQLNILNRGLHLLKSNGRLVYSTCSLNPIENEAVIAEAL-----RKWGDKIRLVNCDD 339

Query: 451 ------RSLSIPTW---------ERRGLVSEFEDVFKNDPAMDPKQLAEGCIRTLPKEDG 495
                 RS  +  W         + +G     E  F        K   + C+R  P +  
Sbjct: 340 KLTGLIRSKGVSKWPVYDRNLTEKNKGDEGTLESFFPPSEEEASKFNLKNCMRVYPHQQN 399

Query: 496 GIGFFAVCFER 506
             GFF   FE+
Sbjct: 400 TGGFFISVFEK 410

>Smik_2.92 Chr2 (166201..168225) [2025 bp, 674 aa] {ON} YBL024W
           (REAL)
          Length = 674

 Score = 56.6 bits (135), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 76/314 (24%), Positives = 114/314 (36%), Gaps = 81/314 (25%)

Query: 226 GKIIIQDRASCFPAHILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVF 285
           G I  Q+  S  P  +L   P   ++D CAAPG+KT   A  I +L+ DT  +     V 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKT---AQLIEALHKDT--DEPSGFVV 199

Query: 286 AFEKDPERSKILDKMVKIAGCKKLVEINTGD--FTKIATPEKYPN---VTGF---IVDPS 337
           A + D  RS +L   +K      L+ +N     F +I       N   V  F   + D  
Sbjct: 200 ANDADARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHGNSSNKNDVLKFDRILCDVP 259

Query: 338 CSGSGIFGRKFIDNINSNKKLTEKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLS-KL 396
           CSG G   +    N+N  K                               D  T+    L
Sbjct: 260 CSGDGTMRK----NVNVWK-------------------------------DWNTQAGLGL 284

Query: 397 SSFQFQVVKHAMS-FPSAKKIVYSTCSIHAEENERVVIDLLLDKKVKEWG---------- 445
            + Q  ++   +    +  ++VYSTCS++  ENE VV + L     ++WG          
Sbjct: 285 HTVQLNILNRGLHLLKNNGRLVYSTCSLNPIENEAVVAEAL-----RKWGDKIRLVNCDD 339

Query: 446 -------------WKVTPRSLSIPTWERRGLVSEFEDVFKNDPAMDPKQLAEGCIRTLPK 492
                        W V  R+L+  T   +G     E  F        +   + C+R  P 
Sbjct: 340 KLPGLIRSKGVSKWPVYDRNLTEKT---KGDEGTLESFFSPSEEEASRFNLQNCMRVYPH 396

Query: 493 EDGGIGFFAVCFER 506
           +    GFF   FE+
Sbjct: 397 QQNTGGFFITVFEK 410

>YBL024W Chr2 (172534..174588) [2055 bp, 684 aa] {ON}
           NCL1S-adenosyl-L-methionine-dependent tRNA:
           m5C-methyltransferase, methylates cytosine to m5C at
           several positions in tRNAs and intron-containing
           pre-tRNAs; increases proportion of tRNALeu(CAA) with m5C
           at wobble position in response to hydrogen peroxide,
           causing selective translation of mRNA from genes
           enriched in TTG codon; loss of NCL1 confers
           hypersensitivity to oxidative stress; similar to Nop2p
           and human proliferation associated nucleolar protein
           p120
          Length = 684

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 76/314 (24%), Positives = 114/314 (36%), Gaps = 81/314 (25%)

Query: 226 GKIIIQDRASCFPAHILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVF 285
           G I  Q+  S  P  +L   P   ++D CAAPG+KT   A  I +L+ DT  +     V 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPHHTVLDMCAAPGSKT---AQLIEALHKDT--DEPSGFVV 199

Query: 286 AFEKDPERSKILDKMVKIAGCKKLVEINTGD--FTKI---ATPEKYPNVTGF---IVDPS 337
           A + D  RS +L   +K      L+ +N     F +I          +V  F   + D  
Sbjct: 200 ANDADARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIRLHGNSNNKNDVLKFDRILCDVP 259

Query: 338 CSGSGIFGRKFIDNINSNKKLTEKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLS-KL 396
           CSG G   +    N+N  K                               D  T+    L
Sbjct: 260 CSGDGTMRK----NVNVWK-------------------------------DWNTQAGLGL 284

Query: 397 SSFQFQVVKHAMS-FPSAKKIVYSTCSIHAEENERVVIDLLLDKKVKEWG---------- 445
            + Q  ++   +    +  ++VYSTCS++  ENE VV + L     ++WG          
Sbjct: 285 HAVQLNILNRGLHLLKNNGRLVYSTCSLNPIENEAVVAEAL-----RKWGDKIRLVNCDD 339

Query: 446 -------------WKVTPRSLSIPTWERRGLVSEFEDVFKNDPAMDPKQLAEGCIRTLPK 492
                        W V  R+L+  T    G +  F   F        K   + C+R  P 
Sbjct: 340 KLPGLIRSKGVSKWPVYDRNLTEKTKGDEGTLDSF---FSPSEEEASKFNLQNCMRVYPH 396

Query: 493 EDGGIGFFAVCFER 506
           +    GFF   FE+
Sbjct: 397 QQNTGGFFITVFEK 410

>Ecym_2353 Chr2 complement(691422..693494) [2073 bp, 690 aa] {ON}
           similar to Ashbya gossypii AFR179C
          Length = 690

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 71/307 (23%), Positives = 110/307 (35%), Gaps = 70/307 (22%)

Query: 226 GKIIIQDRASCFPAHILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVF 285
           G I  Q+  S  P  +L   P   ++D CAAPG+KT  +   + +   +         V 
Sbjct: 145 GNISRQEAVSMIPPLLLEVEPQHTVLDMCAAPGSKTAQLIEALHAKGPEP-----SGFVV 199

Query: 286 AFEKDPERSKILDKMVKIAGCKKLVEINTGD--FTKIATPEKYPNVTGF---IVDPSCSG 340
           A + D  RS +L   +K      L+ +N     F +I T E   +   F   + D  CSG
Sbjct: 200 ANDADYRRSHMLVHQLKRLNSANLIVVNHDAQFFPRIKTSEGSKDFLRFDRVLCDVPCSG 259

Query: 341 SGIFGRKFIDNINSNKKLTEKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQ 400
            G   +    NIN                                KD        L + Q
Sbjct: 260 DGTMRK----NINV------------------------------WKDWATASGLGLHTVQ 285

Query: 401 FQVVKHAMS-FPSAKKIVYSTCSIHAEENERVVIDLLLDKKVKEWGWKVTPRSLS--IPT 457
             ++   ++      ++VYSTCS++  ENE VV   L     ++WG K+        +P 
Sbjct: 286 VNILNRGLNLLKDGGRLVYSTCSLNPIENEAVVAAAL-----RKWGDKIKLVECGDKLPG 340

Query: 458 WERRGLVSE-------FEDVFKNDPAMDPKQLA-----------EGCIRTLPKEDGGIGF 499
             R   +S+       F    ++D  +D                E C+R  P +    GF
Sbjct: 341 LIRSQGISQWPVYDKGFNAKQRSDEGVDASWFPPTDEEISKFHLESCVRVYPHQQNTGGF 400

Query: 500 FAVCFER 506
           F   FE+
Sbjct: 401 FIAVFEK 407

>SAKL0H19448g Chr8 (1713663..1715738) [2076 bp, 691 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 691

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 70/307 (22%), Positives = 109/307 (35%), Gaps = 70/307 (22%)

Query: 226 GKIIIQDRASCFPAHILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVF 285
           G I  Q+  S  P  +L   P+  ++D CAAPG+KT  +   + +   D    F    V 
Sbjct: 145 GNISRQEAVSMIPPIVLEVKPNHTVLDMCAAPGSKTAQLIEALHA-QEDEPTGF----VV 199

Query: 286 AFEKDPERSKILDKMVKIAGCKKLVEINTGD--FTKIATPEKYPNVTGF---IVDPSCSG 340
           A + D +RS +L   +K      L+ +N     F +I +         F   + D  CSG
Sbjct: 200 ANDADAKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKSQPDSKEFLKFDRVLCDVPCSG 259

Query: 341 SGIFGRKFIDNINSNKKLTEKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQ 400
            G   +    N+N                                +D        L + Q
Sbjct: 260 DGTMRK----NVNV------------------------------WRDWGTASGLGLHTVQ 285

Query: 401 FQVVKHAMS-FPSAKKIVYSTCSIHAEENERVVIDLLLDKKVKEWGWKVT---------- 449
             ++   ++      ++VYSTCS++  ENE V+   L     ++WG K+           
Sbjct: 286 LNILNRGLNLLKDGGRLVYSTCSLNPIENESVIAAAL-----RKWGDKIRLVNCDEKLPG 340

Query: 450 -PRSLSIPTW---------ERRGLVSEFEDVFKNDPAMDPKQLAEGCIRTLPKEDGGIGF 499
             RS  I  W         + +G     E  F        +   E CIR  P +    GF
Sbjct: 341 LVRSKGITQWPVYDKNFALKEKGDEGVIETWFPPTEEEATRFHLENCIRVYPHQQNTGGF 400

Query: 500 FAVCFER 506
           F   FE+
Sbjct: 401 FITVFEK 407

>KLTH0H08096g Chr8 (706261..708327) [2067 bp, 688 aa] {ON} similar
           to uniprot|P38205 Saccharomyces cerevisiae YBL024W
          Length = 688

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 75/309 (24%), Positives = 109/309 (35%), Gaps = 74/309 (23%)

Query: 226 GKIIIQDRASCFPAHILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVF 285
           G I  Q+  S  P  +L       ++D CAAPG+KT  +   + S + D    F    V 
Sbjct: 145 GNISRQEAVSMIPPIVLEVESHHSVLDMCAAPGSKTAQMIEALHS-SEDEPTGF----VV 199

Query: 286 AFEKDPERSKILDKMVKIAGCKKLVEINTGD--FTKIATPEKYPNVTGF---IVDPSCSG 340
           A + D  RS +L   +K      LV +N     F ++ T ++      F   + D  CSG
Sbjct: 200 ANDADARRSHMLVHQLKRLNSANLVVVNHDAQFFPRVKTDKETNQFLKFDRILCDVPCSG 259

Query: 341 SGIFGRKFIDNINSNKKLTEKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQ 400
            G   +    N+N                                KD        L + Q
Sbjct: 260 DGTMRK----NVNV------------------------------WKDWGTASGLGLHTVQ 285

Query: 401 FQVVKHAMS-FPSAKKIVYSTCSIHAEENERVVIDLLLDKKVKEWGWKVT---------- 449
             ++K  ++      ++VYSTCS++  ENE VV   L     ++WG K+           
Sbjct: 286 LNILKRGLNLLKKGGRLVYSTCSMNPIENEAVVAAAL-----RQWGDKIKLVDCSDKLPG 340

Query: 450 -PRSLSIPTWERRGLVSEFEDVFKNDPAMD----PKQLAEG-------CIRTLPKEDGGI 497
             RS  I  W    +   FE   K D        P    E        CIR  P +    
Sbjct: 341 LVRSKGISNWPV--IDKAFEKKEKGDEGTTESWFPPSAEEAADFHLDRCIRVYPHQQNTG 398

Query: 498 GFFAVCFER 506
           GFF    E+
Sbjct: 399 GFFITVIEK 407

>KLLA0F12562g Chr6 (1163366..1165480) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024W
          Length = 704

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 72/312 (23%), Positives = 112/312 (35%), Gaps = 76/312 (24%)

Query: 226 GKIIIQDRASCFPAHILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVF 285
           G I  Q+  S  P  +L+  P  Y++D CAAPG+KT  +   + +  +D    F    V 
Sbjct: 145 GNISRQEAVSMIPPIVLDVKPHHYVLDMCAAPGSKTAQLIEALHA-ESDEPSGF----VI 199

Query: 286 AFEKDPERSKILDKMVKIAGCKKLVEINTG---------DFTKIATPEKYPNVTGFIVDP 336
           A + D +RS +L   +K      L+ +N           D T+ +   ++      + D 
Sbjct: 200 ANDADYKRSHMLVHQLKRLNSANLMVVNHDAQFFPRIKVDSTEGSKGPQFLKFDRVLCDV 259

Query: 337 SCSGSGIFGRKFIDNINSNKKLTEKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLS-K 395
            CSG G   +    N+N  K                               D  T     
Sbjct: 260 PCSGDGTMRK----NVNVWK-------------------------------DWNTGSGLG 284

Query: 396 LSSFQFQVVKHAMS-FPSAKKIVYSTCSIHAEENERVVIDLLLDKKVKEWGWKV------ 448
           L   Q  +++  ++      K+VYSTCS++  ENE V+   L     + WG KV      
Sbjct: 285 LHIVQLNILERGLNLLKEGGKLVYSTCSLNPIENEAVIAAAL-----RRWGDKVRLVNCD 339

Query: 449 -----TPRSLSIPTWE---------RRGLVSEFEDVFKNDPAMDPKQLAEGCIRTLPKED 494
                  RS  I  W+          +G  +  +  F        K   E C+R    + 
Sbjct: 340 DQLPGLVRSKGITEWKVYDKQFQVREKGHENCLDSWFPPTAEEVEKFHLENCMRVYQHQQ 399

Query: 495 GGIGFFAVCFER 506
              GFF   FE+
Sbjct: 400 NTGGFFITVFEK 411

>TPHA0C02870 Chr3 (620913..622937) [2025 bp, 674 aa] {ON} Anc_8.171
           YBL024W
          Length = 674

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 72/312 (23%), Positives = 113/312 (36%), Gaps = 77/312 (24%)

Query: 226 GKIIIQDRASCFPAHILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKR-- 283
           G I  Q+  S  P  +L    +  ++D CAAPG+KT  +   +       H N D+    
Sbjct: 144 GNISRQEAVSMIPPILLEVESNHTVLDMCAAPGSKTAQLIEAL-------HTNEDEPTGI 196

Query: 284 VFAFEKDPERSKILDKMVKIAGCKKLVEINTGD--FTKIATPEKYPNVTGF------IVD 335
           V A + D  RS +L   +K      L+ +N     F +IA  E   +   F      + D
Sbjct: 197 VVANDADARRSHMLVHQLKRLNSANLMVVNHDAQFFPRIALHENTTDSNDFLKFDRILCD 256

Query: 336 PSCSGSGIFGRKFIDNINSNKKLTEKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSK 395
             CSG G   +    N+N  +  T                 Q  L               
Sbjct: 257 VPCSGDGTMRK----NVNVWRDWT----------------SQGGLG-------------- 282

Query: 396 LSSFQFQVVKHAMSFPSAK-KIVYSTCSIHAEENERVVIDLLLDKKVKEWGWKV------ 448
           L + Q  ++   +     K ++VYSTCS++  ENE V+   L     ++WG K+      
Sbjct: 283 LHNIQLNILNRGLHLLKPKGRLVYSTCSMNPIENEAVIAAAL-----RKWGSKIRVINCD 337

Query: 449 -----TPRSLSIPTW---ERRGLVSEFEDVFKNDPAMDPKQLA------EGCIRTLPKED 494
                  RS  I +W    R   + +  D   ++    P +        + CIR  P + 
Sbjct: 338 EKLPGLVRSKGIDSWPVFNRDMEIRQKGDQGVSNTWFPPSEEEKSQFNLQNCIRVYPHQQ 397

Query: 495 GGIGFFAVCFER 506
               FF    E+
Sbjct: 398 NTGAFFITVIEK 409

>CAGL0K01991g Chr11 (173969..175987) [2019 bp, 672 aa] {ON} highly
           similar to uniprot|P38205 Saccharomyces cerevisiae
           YBL024w NCL1 tRNA (cytosine-5-)-methyltransferase
          Length = 672

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 77/307 (25%), Positives = 112/307 (36%), Gaps = 79/307 (25%)

Query: 226 GKIIIQDRASCFPAHILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVF 285
           G I  Q+  S  P  +L   P   ++D CAAPG+KTT +   I +L+ DT  +     V 
Sbjct: 143 GNISRQEAVSMIPPIVLEVEPHHTVLDMCAAPGSKTTQM---IEALHKDT--DEPTGFVV 197

Query: 286 AFEKDPERSKILDKMVKIAGCKKLVEINTGD--FTKIA---TPEKYPNVTGF---IVDPS 337
           A + D  RS +L   +K      L+ +N     F +I     P K      F   + D  
Sbjct: 198 ANDADSRRSHMLVHQLKRLNSANLMVVNHDAQFFPRIILSDEPSKKKAQLKFDRILCDVP 257

Query: 338 CSGSGIFGRKFIDNINSNKKLTEKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLS 397
           CSG G   +    N+N  K                    Q  L               L 
Sbjct: 258 CSGDGTMRK----NVNVWKDWN----------------TQGALG--------------LH 283

Query: 398 SFQFQVVKHAMS-FPSAKKIVYSTCSIHAEENERVVIDLLLDKKVKEWGWKVTP------ 450
           + Q  ++   +    +  ++VYSTCS++  ENE VV + L     + WG KV        
Sbjct: 284 TVQLNILDRGLHLLQNNGRLVYSTCSMNPIENEAVVAEAL-----RRWGDKVRLVDCSEK 338

Query: 451 -----RSLSIPTW------------ERRGLVSEFEDVFKNDPAMDPKQLAEGCIRTLPKE 493
                RS  I  W            E  G+++ +   F        K   E C+R  P +
Sbjct: 339 LPGLIRSQGITQWPVIDRNMEERKKEDEGMINSW---FPPSEEEVSKFHLERCMRVYPHQ 395

Query: 494 DGGIGFF 500
               GFF
Sbjct: 396 QNTGGFF 402

>TBLA0A08740 Chr1 (2141750..2143810) [2061 bp, 686 aa] {ON}
           Anc_8.171 YBL024W
          Length = 686

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 71/314 (22%), Positives = 113/314 (35%), Gaps = 81/314 (25%)

Query: 226 GKIIIQDRASCFPAHILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVF 285
           G I  Q+  S  P  +L   P   ++D CAAPG+KT  +    + + N     F    V 
Sbjct: 145 GNISRQEAVSMIPPLVLEVKPHHTVLDMCAAPGSKTAQMIE-ALHMENAEPTGF----VV 199

Query: 286 AFEKDPERSKILDKMVKIAGCKKLVEINTGD--FTKI---ATPEKYPNVTGF---IVDPS 337
           A + D  RS +L   +K      ++ +N     F +I       K  +   F   + D  
Sbjct: 200 ANDSDYRRSHMLVHQLKRLNSANMMVVNHDAQFFPRIKLSVGDNKAKDALKFDRILCDVP 259

Query: 338 CSGSGIFGRKFIDNINSNKKLTEKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLS-KL 396
           CSG G   +    N+N  K                               D  T+    L
Sbjct: 260 CSGDGTMRK----NVNVWK-------------------------------DWNTQAGLGL 284

Query: 397 SSFQFQVVKHAMS-FPSAKKIVYSTCSIHAEENERVVIDLLLDKKVKEWGWKVT------ 449
            + Q+ ++   +    +  ++VYSTCS++  ENE VV      + ++ WG K+       
Sbjct: 285 HTIQYNILNRGLHLLKTGGRLVYSTCSLNPIENEAVVA-----RALRTWGSKIKIINCDD 339

Query: 450 -----PRSLSIPTW---------ERRGLVSEFEDVFKNDPAMDPKQLA---EGCIRTLPK 492
                 RS  +  W         + +G     E  F   P  D +  A   + C+R  P 
Sbjct: 340 KLPGLIRSNGVTQWPVFDRNMESKNKGDEGTLESWF---PPTDEEVTAFNLQNCMRVYPH 396

Query: 493 EDGGIGFFAVCFER 506
           +    GFF    E+
Sbjct: 397 QQNTGGFFITVIEK 410

>NDAI0B02980 Chr2 complement(757926..759965) [2040 bp, 679 aa] {ON} 
          Length = 679

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 75/312 (24%), Positives = 114/312 (36%), Gaps = 76/312 (24%)

Query: 226 GKIIIQDRASCFPAHILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVF 285
           G I  Q+  S  P  +L+  P   ++D CAAPG+KT   A  I +L+ D         V 
Sbjct: 139 GNISRQEAVSMIPPIVLDVKPHHTVLDMCAAPGSKT---AQLIEALHMDGP--EPSGFVV 193

Query: 286 AFEKDPERSKILDKMVKIAGCKKLVEINTG---------DFTKIATPEKYPNVTGFIVDP 336
           A + D +RS +L   +K      L+ +N           D  K    ++Y      + D 
Sbjct: 194 ANDSDSKRSHMLVHQLKRLNSANLMVVNHDAQFFPKIQLDSNKGRHNKEYLKFDRILCDV 253

Query: 337 SCSGSGIFGRKFIDNINSNKKLTEKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKL 396
            CSG G   +    N+N  K                    Q +L               L
Sbjct: 254 PCSGDGTIRK----NVNIWKDWN----------------TQNSLG--------------L 279

Query: 397 SSFQFQVVKHAMS-FPSAKKIVYSTCSIHAEENERVVIDLLLDKKVKEWGWKV------- 448
            + Q  ++   +    S  ++VYSTCS+   ENE V+        +++WG K+       
Sbjct: 280 HNVQLNILNRGIQLLKSGGRLVYSTCSLSPIENEAVI-----SATLRKWGNKIKLVDCKE 334

Query: 449 -TPRSLSIPT---WE----RRGLVSEFEDVFKNDPAMDPKQLAEG------CIRTLPKED 494
             P  +S P    WE       +VS+  +  K D    P +          CIR  P + 
Sbjct: 335 MLPGLISSPGISKWEVYDRTMSIVSKGAEKSK-DTWFQPTEEEANDFNLSHCIRVFPHQQ 393

Query: 495 GGIGFFAVCFER 506
              GFF    E+
Sbjct: 394 NTGGFFIAVLEK 405

>Kwal_14.2081 s14 (598648..599463) [816 bp, 272 aa] {ON} YBL024W
           (NCL1) - Probable proliferating-cell nucleolar antigen
           (human p120) [contig 230] PARTIAL
          Length = 272

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 49/124 (39%), Gaps = 10/124 (8%)

Query: 226 GKIIIQDRASCFPAHILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVF 285
           G I  Q+  S  P  +L   P   ++D CAAPG+KT  +   + +   D    F    V 
Sbjct: 145 GNISRQEAVSMIPPIVLEVEPHHAVLDMCAAPGSKTAQMIEALHA-TEDEPTGF----VV 199

Query: 286 AFEKDPERSKILDKMVKIAGCKKLVEINTGD--FTKIATPEKYPNVTGF---IVDPSCSG 340
           A + D  RS +L   +K      L+ +N     F ++           F   + D  CSG
Sbjct: 200 ANDADARRSHMLVHQLKRLNSANLMVVNHDAQFFPRVKLDNDSNQFLKFDRVLCDVPCSG 259

Query: 341 SGIF 344
            G  
Sbjct: 260 DGTM 263

>SAKL0D08712g Chr4 complement(724741..725679) [939 bp, 312 aa] {ON}
           similar to uniprot|P40693 Saccharomyces cerevisiae
           YNL002C
          Length = 312

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 55/117 (47%), Gaps = 20/117 (17%)

Query: 289 KDPERSKILDKMVKIAGCKKLVEINTGDFTKIATPEKYPN---VTGFIV--DPSCSG--- 340
           K P   KI  K  KI    +LVE+NTG F K+ T + YP    V  ++V   PS +    
Sbjct: 138 KGPTAVKIPQKAFKILSLLRLVEVNTGVFVKL-TEQVYPLLKIVAPYVVIGKPSLASIRS 196

Query: 341 -----SGIFGRKFIDN------INSNKKLTEKVKDEGEDDEQDIPLEQETLAEAKAK 386
                S I  ++  D+      +N N  + E++ DEG    +DI  E  TL E+ AK
Sbjct: 197 LIQKRSRILHKRADDDQEKEIVLNDNNIVEERLGDEGIICIEDIIHEIATLGESFAK 253

>TPHA0A01920 Chr1 complement(387645..389966) [2322 bp, 773 aa] {ON}
           Anc_8.237 YER171W
          Length = 773

 Score = 35.0 bits (79), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 4/56 (7%)

Query: 404 VKHAMSFPSAKKIVYSTCSIHAEENERVVIDL--LLDKKVKEWGWKVTPRSLSIPT 457
           V + M +P  +KI+Y  CS    E E+ +++L  L+D + KE G+K   R L + +
Sbjct: 57  VAYQMHYPEHRKIIY--CSRTMSEIEKALVELENLMDYRTKELGFKEEFRGLGLSS 110

>Ecym_3003 Chr3 complement(6934..7893) [960 bp, 319 aa] {ON} similar
           to Ashbya gossypii ACR026W
          Length = 319

 Score = 34.3 bits (77), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 32/78 (41%), Gaps = 13/78 (16%)

Query: 246 PDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKMVKIAG 305
           P D +++     GN TT +                 ++V A E DP  +  L K V    
Sbjct: 56  PSDIVLEVGPGTGNLTTRILE-------------KARKVVAVEFDPRMAAELTKRVHGTA 102

Query: 306 CKKLVEINTGDFTKIATP 323
            +K +EI  GDFTK   P
Sbjct: 103 AEKKLEIILGDFTKTELP 120

>CAGL0L11924g Chr12 (1279776..1282103) [2328 bp, 775 aa] {ON} highly
           similar to uniprot|P06839 Saccharomyces cerevisiae
           YER171w DNA helicase/ATPase
          Length = 775

 Score = 34.7 bits (78), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 32/56 (57%), Gaps = 4/56 (7%)

Query: 404 VKHAMSFPSAKKIVYSTCSIHAEENERVVIDL--LLDKKVKEWGWKVTPRSLSIPT 457
           + + M +P  +KI+Y  CS    E E+ +++L  L+D + KE G+K   R L + +
Sbjct: 57  IAYQMHYPEHRKIIY--CSRTMSEIEKALVELENLMDYRAKELGFKEEFRGLGLTS 110

>ZYRO0B11836g Chr2 (940987..943299) [2313 bp, 770 aa] {ON} highly
           similar to uniprot|P06839 Saccharomyces cerevisiae
           YER171W RAD3 5' to 3' DNA helicase involved in
           nucleotide excision repair and transcription subunit of
           RNA polymerase II transcription initiation factor TFIIH
           subunit of Nucleotide Excision Repair Factor 3 (NEF3)
           homolog of human XPD protein
          Length = 770

 Score = 34.3 bits (77), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 32/56 (57%), Gaps = 4/56 (7%)

Query: 404 VKHAMSFPSAKKIVYSTCSIHAEENERVVIDL--LLDKKVKEWGWKVTPRSLSIPT 457
           + + M +P  +KI+Y  CS    E E+ +++L  L+D + KE G++   R L + +
Sbjct: 57  IAYQMHYPEHRKIIY--CSRTMSEIEKALVELENLMDYRTKELGYREDFRGLGLTS 110

>SAKL0E00660g Chr5 complement(42779..43747) [969 bp, 322 aa] {ON}
           highly similar to uniprot|P41819 Saccharomyces
           cerevisiae YPL266W DIM1 Essential 18S rRNA dimethylase
           responsible for conserved m6(2)Am6(2)A dimethylation in
           3'- terminal loop of 18 S rRNA part of 90S and 40S pre-
           particles in nucleolus involved in pre-ribosomal RNA
           processing
          Length = 322

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 30/78 (38%), Gaps = 13/78 (16%)

Query: 246 PDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKMVKIAG 305
           P D +++     GN T  +                 +RV A E DP  +  L K V    
Sbjct: 57  PSDVVLEVGPGTGNLTVRILE-------------QARRVVAVEMDPRMAAELTKRVHGTA 103

Query: 306 CKKLVEINTGDFTKIATP 323
            +K +EI  GDF K   P
Sbjct: 104 AEKKLEILLGDFMKTELP 121

>Smik_5.343 Chr5 (526697..529024) [2328 bp, 775 aa] {ON} YER171W
           (REAL)
          Length = 775

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 32/56 (57%), Gaps = 4/56 (7%)

Query: 404 VKHAMSFPSAKKIVYSTCSIHAEENERVVIDL--LLDKKVKEWGWKVTPRSLSIPT 457
           + + M +P  +KI+Y  CS    E E+ +++L  L+D + KE G++   R L + +
Sbjct: 57  IAYQMHYPEHRKIIY--CSRTMSEIEKALVELENLMDYRTKELGYQEDFRGLGLTS 110

>Suva_5.305 Chr5 (494912..497245) [2334 bp, 777 aa] {ON} YER171W
           (REAL)
          Length = 777

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 32/56 (57%), Gaps = 4/56 (7%)

Query: 404 VKHAMSFPSAKKIVYSTCSIHAEENERVVIDL--LLDKKVKEWGWKVTPRSLSIPT 457
           + + M +P  +KI+Y  CS    E E+ +++L  L+D + KE G++   R L + +
Sbjct: 57  IAYQMHYPEHRKIIY--CSRTMSEIEKALVELENLMDYRTKELGYQEDFRGLGLTS 110

>Skud_5.310 Chr5 (512188..514515) [2328 bp, 775 aa] {ON} YER171W
           (REAL)
          Length = 775

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 32/56 (57%), Gaps = 4/56 (7%)

Query: 404 VKHAMSFPSAKKIVYSTCSIHAEENERVVIDL--LLDKKVKEWGWKVTPRSLSIPT 457
           + + M +P  +KI+Y  CS    E E+ +++L  L+D + KE G++   R L + +
Sbjct: 57  IAYQMHYPEHRKIIY--CSRTMSEIEKALVELENLMDYRTKELGYQEDFRGLGLTS 110

>YER171W Chr5 (527082..529418) [2337 bp, 778 aa] {ON}  RAD35' to 3'
           DNA helicase, involved in nucleotide excision repair and
           transcription; subunit of RNA polII initiation factor
           TFIIH and of Nucleotide Excision Repair Factor 3 (NEF3);
           homolog of human XPD protein; mutant has aneuploidy
           tolerance
          Length = 778

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 32/56 (57%), Gaps = 4/56 (7%)

Query: 404 VKHAMSFPSAKKIVYSTCSIHAEENERVVIDL--LLDKKVKEWGWKVTPRSLSIPT 457
           + + M +P  +KI+Y  CS    E E+ +++L  L+D + KE G++   R L + +
Sbjct: 57  IAYQMHYPEHRKIIY--CSRTMSEIEKALVELENLMDYRTKELGYQEDFRGLGLTS 110

>TBLA0A01440 Chr1 (336642..338210) [1569 bp, 522 aa] {ON} Anc_8.453
           YDR232W
          Length = 522

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 276 HINFDKKRVFAFEKDPERSKILDKMVKIAGC 306
           H++F+K       KDPERS ILD++  I G 
Sbjct: 280 HLDFEKHLKLGISKDPERSSILDRVDMITGT 310

>TBLA0H01880 Chr8 (441695..446821) [5127 bp, 1708 aa] {ON} Anc_5.370
           YHR080C
          Length = 1708

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 33/62 (53%), Gaps = 9/62 (14%)

Query: 188 VDHWSKIKPGCIYYDEYIPNLFGISPTDKIT-------SHELYKNGKIIIQDRASCFPAH 240
           +D+ S+ K    +   +  N+ GISP +K+        S ++ + GK+ I DR  CF A+
Sbjct: 815 IDYASEKKNSSFH--SFFKNINGISPDEKLIIDITCALSRDILQQGKMYITDRNICFNAN 872

Query: 241 IL 242
           IL
Sbjct: 873 IL 874

>Kpol_449.12 s449 complement(42834..43793) [960 bp, 319 aa] {ON}
           complement(42834..43793) [960 nt, 320 aa]
          Length = 319

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 31/81 (38%), Gaps = 13/81 (16%)

Query: 243 NATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKMVK 302
           N  P D +++     GN T  +                 ++V A E DP  +  L K V 
Sbjct: 54  NIKPSDIVLEVGPGTGNLTVRILE-------------QARKVVAVEMDPRMAAELTKRVH 100

Query: 303 IAGCKKLVEINTGDFTKIATP 323
               +K +EI  GDF K   P
Sbjct: 101 GTPAEKKLEIMLGDFMKTELP 121

>Smik_6.474 Chr6 complement(781184..782140) [957 bp, 318 aa] {ON}
           YPL266W (REAL)
          Length = 318

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 30/78 (38%), Gaps = 13/78 (16%)

Query: 246 PDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKMVKIAG 305
           P D +++     GN T  +                 K V A E DP  +  L K V+   
Sbjct: 56  PSDVVLEVGPGTGNLTVRILE-------------QAKSVVAVEMDPRMAAELTKRVRGTQ 102

Query: 306 CKKLVEINTGDFTKIATP 323
            +K +EI  GDF K   P
Sbjct: 103 VEKKLEIMLGDFMKTELP 120

>Skud_16.11 Chr16 (18214..19170) [957 bp, 318 aa] {ON} YPL266W
           (REAL)
          Length = 318

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 30/78 (38%), Gaps = 13/78 (16%)

Query: 246 PDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKMVKIAG 305
           P D +++     GN T  +                 K V A E DP  +  L K V+   
Sbjct: 56  PSDVVLEVGPGTGNLTVRILE-------------QAKNVVAVEMDPRMAAELTKRVRGTP 102

Query: 306 CKKLVEINTGDFTKIATP 323
            +K +EI  GDF K   P
Sbjct: 103 VEKKLEIMLGDFMKTELP 120

>KNAG0D00260 Chr4 complement(35036..36229) [1194 bp, 397 aa] {ON}
           Anc_6.362 YNR043W
          Length = 397

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 36/75 (48%), Gaps = 10/75 (13%)

Query: 424 HAEENERVVIDLL--LDKKVKEWGWKVTPRSLSIPTWERRGLVSEFEDVFKND-PAMDPK 480
           + +ENE  ++     L   V+ WG K T  +L       +G  + F   +K D PAM   
Sbjct: 311 YLQENESKLLPFFYPLLSTVEGWGTKFTAETL-------QGFENTFNTQYKADFPAMLDP 363

Query: 481 QLAEGCIRTLPKEDG 495
           +LAEG  R +P + G
Sbjct: 364 KLAEGISRIIPTQVG 378

>YPL266W Chr16 (39121..40077) [957 bp, 318 aa] {ON}  DIM1Essential
           18S rRNA dimethylase (dimethyladenosine transferase),
           responsible for conserved m6(2)Am6(2)A dimethylation in
           3'-terminal loop of 18S rRNA, part of 90S and 40S
           pre-particles in nucleolus, involved in pre-ribosomal
           RNA processing
          Length = 318

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 30/78 (38%), Gaps = 13/78 (16%)

Query: 246 PDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKMVKIAG 305
           P D +++     GN T  +                 K V A E DP  +  L K V+   
Sbjct: 56  PSDVVLEVGPGTGNLTVRILE-------------QAKNVVAVEMDPRMAAELTKRVRGTP 102

Query: 306 CKKLVEINTGDFTKIATP 323
            +K +EI  GDF K   P
Sbjct: 103 VEKKLEIMLGDFMKTELP 120

>Suva_16.39 Chr16 (54705..55661) [957 bp, 318 aa] {ON} YPL266W
           (REAL)
          Length = 318

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 30/78 (38%), Gaps = 13/78 (16%)

Query: 246 PDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKMVKIAG 305
           P D +++     GN T  +                 K V A E DP  +  L K V+   
Sbjct: 56  PSDVVLEVGPGTGNLTVRILE-------------QAKNVVAVEMDPRMAAELTKRVRGTP 102

Query: 306 CKKLVEINTGDFTKIATP 323
            +K +EI  GDF K   P
Sbjct: 103 VEKKLEILLGDFMKTELP 120

>Skud_4.696 Chr4 complement(1236293..1238728) [2436 bp, 811 aa] {ON}
           YDR422C (REAL)
          Length = 811

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 36/73 (49%), Gaps = 7/73 (9%)

Query: 180 LRKKF----TTKVDHWSKIKPGCIYYDEYIPNLFGISPTDKITSHELYKNGKIIIQDRAS 235
           LR  F     + +D  ++IKP  + Y   IPNLF I      TS + ++  ++  QDR S
Sbjct: 629 LRGSFVRLKASSLDLMAEIKPEKLEYSNEIPNLFNIGEASTTTSKDHFE--RLSPQDRPS 686

Query: 236 CFPAHILNATPDD 248
            F   +++   DD
Sbjct: 687 -FTHKVVDCNQDD 698

>CAGL0L07678g Chr12 complement(846285..847238) [954 bp, 317 aa] {ON}
           highly similar to uniprot|P41819 Saccharomyces
           cerevisiae YPL266w DIM1
          Length = 317

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 30/78 (38%), Gaps = 13/78 (16%)

Query: 246 PDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKMVKIAG 305
           P D +++     GN T  +                 ++V A E DP  +  L K V    
Sbjct: 56  PSDIVLEVGPGTGNLTVRILE-------------QARKVVAVEMDPRMAAELTKRVHGTP 102

Query: 306 CKKLVEINTGDFTKIATP 323
            +K +EI  GDF K   P
Sbjct: 103 AEKKLEIMLGDFMKTELP 120

>KAFR0B06450 Chr2 complement(1337903..1338859) [957 bp, 318 aa] {ON}
           Anc_6.1 YPL266W
          Length = 318

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 21/81 (25%), Positives = 31/81 (38%), Gaps = 13/81 (16%)

Query: 243 NATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKMVK 302
           N  P D +++     GN T  +                 ++V A E DP  +  L K V 
Sbjct: 53  NIKPSDVVLEVGPGTGNLTVRILE-------------QARKVVAVEMDPRMAAELTKRVH 99

Query: 303 IAGCKKLVEINTGDFTKIATP 323
               ++ +EI  GDF K   P
Sbjct: 100 GTPAERKLEIILGDFMKTELP 120

>YGR090W Chr7 (662358..666071) [3714 bp, 1237 aa] {ON}
           UTP22Possible U3 snoRNP protein involved in maturation
           of pre-18S rRNA, based on computational analysis of
           large-scale protein-protein interaction data
          Length = 1237

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 62/150 (41%), Gaps = 27/150 (18%)

Query: 350 DNINSNKKLTEKVKDEGEDDEQDIPLEQETLAEAKAKDDLETRLSKLSSFQFQVVKHAMS 409
           +N +S++ + E+   E E+DE D   E   +A   A      +++   S+   + +    
Sbjct: 37  ENDHSSQAINERTVPEQENDESDTSPESNEVATNTAATRHNGKVTATESYDIHIARE--- 93

Query: 410 FPSAKKIVYSTCSIHAEENERVVIDLLLDK---------KVKEWGWKVTPRSLSIPTWER 460
                     T  +      ++ ID LL++         KV+++  K+      IP WE 
Sbjct: 94  ----------TAELFKSNIFKLQIDELLEQVKLKQKHVLKVEKFLHKLYDILQEIPDWEE 143

Query: 461 RGLVSEFEDVFKND----PAMDPKQLAEGC 486
           + L +E +  FKN     P +DPK + +  
Sbjct: 144 KSL-AEVDSFFKNKIVSVPFVDPKPIPQNT 172

>KAFR0B06650 Chr2 complement(1386066..1387784) [1719 bp, 572 aa]
           {ON} Anc_6.174 YGL095C
          Length = 572

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query: 166 RIPKQKSS--DDIILELRKKFTTKVDHWSKIKPGCIYYDEYIPNLFGI 211
           R+    SS  DD++ EL KKF T++D + K       Y ++IP L  I
Sbjct: 449 RVESSTSSNKDDLLSELAKKFNTRMDAYKKTNVSNNVYMQHIPKLSNI 496

>Kwal_55.20461 s55 complement(412840..414042) [1203 bp, 400 aa] {ON}
           YGR111W - Hypothetical ORF [contig 148] FULL
          Length = 400

 Score = 31.6 bits (70), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 2/40 (5%)

Query: 299 KMVKIAGCKKLVEINTGDFTK--IATPEKYPNVTGFIVDP 336
           K +   GC+ LVE  T +F++  I+  EK PN + F V+P
Sbjct: 214 KNLDFEGCQSLVERQTREFSQRLISLQEKNPNASVFTVEP 253

>KNAG0L02440 Chr12 (434232..435185) [954 bp, 317 aa] {ON} Anc_6.1
           YPL266W
          Length = 317

 Score = 31.2 bits (69), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 33/85 (38%), Gaps = 16/85 (18%)

Query: 239 AHILNATPDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILD 298
           AHI    P D +++     GN T  +                 K+V A E DP  +  L 
Sbjct: 52  AHI---KPSDIVLEVGPGTGNLTVRILE-------------KAKKVVAVEMDPRMAAELT 95

Query: 299 KMVKIAGCKKLVEINTGDFTKIATP 323
           K V     +K ++I  GDF K   P
Sbjct: 96  KRVHGTPAEKKLDIMLGDFMKTELP 120

>ZYRO0F00308g Chr6 complement(32198..33157) [960 bp, 319 aa] {ON}
           highly similar to uniprot|P41819 Saccharomyces
           cerevisiae YPL266W DIM1 Essential 18S rRNA dimethylase
           responsible for conserved m6(2)Am6(2)A dimethylation in
           3'- terminal loop of 18 S rRNA part of 90S and 40S pre-
           particles in nucleolus involved in pre-ribosomal RNA
           processing
          Length = 319

 Score = 30.8 bits (68), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 32/78 (41%), Gaps = 13/78 (16%)

Query: 246 PDDYIIDACAAPGNKTTHVASYIMSLNNDTHINFDKKRVFAFEKDPERSKILDKMVKIAG 305
           P D +++     GN T  +   +             ++ +A E DP  +  L K V+   
Sbjct: 57  PSDTVLEVGPGTGNLTVRILEQV-------------RKAYAVEMDPRMAAELTKRVRGTD 103

Query: 306 CKKLVEINTGDFTKIATP 323
            ++ +EI  GDF K   P
Sbjct: 104 GERKLEILLGDFIKTDLP 121

>Kwal_26.7914 s26 complement(565158..566801) [1644 bp, 547 aa] {ON}
           YKL005C - Hypothetical ORF [contig 55] FULL
          Length = 547

 Score = 31.2 bits (69), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 41/86 (47%), Gaps = 6/86 (6%)

Query: 311 EINTGD--FTKIATPEKYPNVTGFIVDPSC--SGSGIFGRKFIDN-INSNKKLTEKVKDE 365
           E+N  D  F  I +P  YP++  + +DPS     S   GR++  N  N      E + D 
Sbjct: 93  EVNDLDEYFCNICSPASYPDIV-YAIDPSSLNKTSLAHGREYSHNHQNYEDDEEEHILDS 151

Query: 366 GEDDEQDIPLEQETLAEAKAKDDLET 391
           G +DE  +P ++   ++ K   ++ T
Sbjct: 152 GTEDEDQLPTKRRKKSKLKTDHNVAT 177

>KLLA0D04884g Chr4 (419435..420391) [957 bp, 318 aa] {ON} similar to
           uniprot|P40693 Saccharomyces cerevisiae YNL002C
          Length = 318

 Score = 30.8 bits (68), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 38/113 (33%), Positives = 52/113 (46%), Gaps = 20/113 (17%)

Query: 289 KDPERSKILDKMVKIAGCKKLVEINTGDFTKIATPEKYP---NVTGFIV--DPSCSG--- 340
           K P   KI  K  K+    +LVE+NTG F K+ T + YP    V+ +IV   PS +    
Sbjct: 144 KGPTAVKIPAKAYKVLSLLRLVELNTGVFIKL-TKDVYPLLKLVSPYIVIGQPSLASIRS 202

Query: 341 -----SGIFGRKFIDN------INSNKKLTEKVKDEGEDDEQDIPLEQETLAE 382
                S I  ++  D       +N N  + EK+ DEG    +DI  E  TL E
Sbjct: 203 LIQKRSRIMWQRPEDKEPKEIILNDNNIVEEKLGDEGVICIEDIIHEISTLGE 255

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,285,206
Number of extensions: 2434489
Number of successful extensions: 9659
Number of sequences better than 10.0: 137
Number of HSP's gapped: 9793
Number of HSP's successfully gapped: 160
Length of query: 508
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 394
Effective length of database: 40,409,475
Effective search space: 15921333150
Effective search space used: 15921333150
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)