Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0B069502.285ON79579538910.0
Smik_14.3102.285ON70647920310.0
Skud_14.3082.285ON70648020190.0
Suva_14.3262.285ON70647520170.0
YNL021W (HDA1)2.285ON70644220160.0
ZYRO0A01870g2.285ON70748319640.0
NCAS0G038002.285ON72648719580.0
NDAI0G006502.285ON68946119390.0
KAFR0H033202.285ON70247619380.0
CAGL0J03454g2.285ON69348519240.0
KNAG0H020102.285ON69344219190.0
TDEL0G021602.285ON71447919170.0
SAKL0E07700g2.285ON71244319040.0
KLTH0G10340g2.285ON70847118840.0
Ecym_33242.285ON70644618660.0
Kwal_27.115372.285ON70846618550.0
KLLA0E08383g2.285ON70444218350.0
TPHA0C033902.285ON70144518000.0
ADL216C2.285ON70544917930.0
Kpol_1039.322.285ON65943217870.0
Kpol_1003.372.285ON57832613271e-174
SAKL0H25124g8.153ON4483383553e-35
TPHA0H003208.153ON4503343537e-35
KLTH0E06446g8.153ON4493323448e-34
KNAG0G013508.153ON4513353385e-33
Skud_7.798.153ON4523293386e-33
TBLA0D021408.153ON4563423377e-33
Ecym_23468.153ON4853373361e-32
CAGL0A03322g8.153ON4503323342e-32
Kpol_1038.113.8ON4333263332e-32
KLTH0F19668g3.8ON4323263322e-32
Smik_7.798.153ON4523303332e-32
KLLA0F09119g8.153ON4523323315e-32
AFR172C8.153ON4493323315e-32
Kwal_55.207908.153ON4493323306e-32
Kwal_55.221423.8ON4323263296e-32
KLLA0E01981g3.8ON4323343296e-32
Kpol_246.58.153ON4533323306e-32
YGL194C (HOS2)8.153ON4523303307e-32
Suva_14.113.8ON4333263297e-32
NCAS0C043203.8ON4343263297e-32
Ecym_20103.8ON4333263288e-32
AGR395W3.8ON4333263288e-32
NCAS0B054808.153ON4513443299e-32
TBLA0I005603.8ON4333263271e-31
ZYRO0C03498g3.8ON4333263271e-31
SAKL0C13706g3.8ON4333263271e-31
KAFR0C029208.153ON4533333281e-31
Skud_14.113.8ON4333263262e-31
NDAI0G037403.8ON4333263252e-31
NDAI0B027108.153ON4533293262e-31
KNAG0A011603.8ON4333263252e-31
TPHA0A003003.8ON4333263233e-31
CAGL0B01441g3.8ON4333263234e-31
Suva_7.718.153ON4523293244e-31
KAFR0A086303.8ON4333263217e-31
TDEL0B045808.153ON4463343218e-31
Smik_14.23.8ON4333263209e-31
YNL330C (RPD3)3.8ON4333263191e-30
TDEL0A002703.8ON4333263154e-30
ZYRO0G19316g8.153ON4483353147e-30
TDEL0C050403.362ON4541821931e-14
NDAI0A051203.362ON5082501941e-14
SAKL0B07854g3.362ON4891821886e-14
TBLA0B023903.362ON5791821888e-14
Suva_16.3963.362ON4771831851e-13
NCAS0A111803.362ON4902091832e-13
Skud_16.3533.362ON4711831796e-13
Kpol_376.153.362ON5181831797e-13
ZYRO0C16390g3.362ON4361951789e-13
KLTH0F10582g3.362ON4741831761e-12
Kwal_23.37243.362ON4732091752e-12
CAGL0D01430g3.362ON4452021743e-12
KAFR0H008903.362ON4742161743e-12
YPR068C (HOS1)3.362ON4701831733e-12
KLLA0B09394g3.362ON4411831724e-12
Smik_16.3093.362ON4701831716e-12
ADL339W3.362ON4372231691e-11
KNAG0H006303.362ON4561881672e-11
SAKL0H08338g8.607ON6903251647e-11
ADL265W8.607ON6942471602e-10
Ecym_82908.607ON7091341574e-10
Suva_16.1948.607ON6991021575e-10
KAFR0H027908.607ON7171021575e-10
NCAS0C017608.607ON7001341575e-10
Smik_6.3158.607ON6971021558e-10
KLLA0F00858g8.607ON7151101559e-10
KLTH0D09592g8.607ON7051361559e-10
NDAI0E024808.607ON684991531e-09
TDEL0A055208.607ON6741341531e-09
Ecym_34653.362ON4452341492e-09
TBLA0E040808.607ON6942921513e-09
Kwal_26.85058.607ON7081361513e-09
Skud_16.1648.607ON6971341494e-09
YPL116W (HOS3)8.607ON6971021495e-09
TPHA0A011208.607ON6981091485e-09
ZYRO0F10780g8.607ON668991461e-08
Kpol_479.68.607ON688991451e-08
CAGL0J06974g8.607ON6781341397e-08
KNAG0J013008.607ON6771061361e-07
TPHA0M015903.362ON4941431342e-07
Kpol_480.143.492ON69999800.74
TBLA0G014004.133ON352149752.3
KLTH0D02222gna 1ON847105743.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0B06950
         (795 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0B06950 Chr2 complement(1643756..1646143) [2388 bp, 795 aa] ...  1503   0.0  
Smik_14.310 Chr14 (555609..557729) [2121 bp, 706 aa] {ON} YNL021...   786   0.0  
Skud_14.308 Chr14 (563902..566022) [2121 bp, 706 aa] {ON} YNL021...   782   0.0  
Suva_14.326 Chr14 (576098..578218) [2121 bp, 706 aa] {ON} YNL021...   781   0.0  
YNL021W Chr14 (593227..595347) [2121 bp, 706 aa] {ON}  HDA1Putat...   781   0.0  
ZYRO0A01870g Chr1 complement(154507..156630) [2124 bp, 707 aa] {...   761   0.0  
NCAS0G03800 Chr7 (701547..703727) [2181 bp, 726 aa] {ON}              758   0.0  
NDAI0G00650 Chr7 complement(141981..144050) [2070 bp, 689 aa] {O...   751   0.0  
KAFR0H03320 Chr8 (633105..635213) [2109 bp, 702 aa] {ON} Anc_2.2...   751   0.0  
CAGL0J03454g Chr10 complement(332090..334171) [2082 bp, 693 aa] ...   745   0.0  
KNAG0H02010 Chr8 (354923..357004) [2082 bp, 693 aa] {ON} Anc_2.2...   743   0.0  
TDEL0G02160 Chr7 complement(424838..426982) [2145 bp, 714 aa] {O...   743   0.0  
SAKL0E07700g Chr5 (622822..624960) [2139 bp, 712 aa] {ON} highly...   738   0.0  
KLTH0G10340g Chr7 complement(874566..876692) [2127 bp, 708 aa] {...   730   0.0  
Ecym_3324 Chr3 complement(620836..622956) [2121 bp, 706 aa] {ON}...   723   0.0  
Kwal_27.11537 s27 (839198..841324) [2127 bp, 708 aa] {ON} YNL021...   719   0.0  
KLLA0E08383g Chr5 (754048..756162) [2115 bp, 704 aa] {ON} highly...   711   0.0  
TPHA0C03390 Chr3 complement(743315..745420) [2106 bp, 701 aa] {O...   697   0.0  
ADL216C Chr4 complement(324197..326314) [2118 bp, 705 aa] {ON} S...   695   0.0  
Kpol_1039.32 s1039 (99859..101838) [1980 bp, 659 aa] {ON} (99859...   692   0.0  
Kpol_1003.37 s1003 complement(91621..92301,92861..92869,92912..9...   515   e-174
SAKL0H25124g Chr8 (2184039..2185385) [1347 bp, 448 aa] {ON} high...   141   3e-35
TPHA0H00320 Chr8 complement(62605..63957) [1353 bp, 450 aa] {ON}...   140   7e-35
KLTH0E06446g Chr5 complement(594807..596156) [1350 bp, 449 aa] {...   137   8e-34
KNAG0G01350 Chr7 (300791..302146) [1356 bp, 451 aa] {ON} Anc_8.1...   134   5e-33
Skud_7.79 Chr7 complement(146016..147374) [1359 bp, 452 aa] {ON}...   134   6e-33
TBLA0D02140 Chr4 complement(539873..541243) [1371 bp, 456 aa] {O...   134   7e-33
Ecym_2346 Chr2 complement(678792..680249) [1458 bp, 485 aa] {ON}...   134   1e-32
CAGL0A03322g Chr1 (338516..339868) [1353 bp, 450 aa] {ON} highly...   133   2e-32
Kpol_1038.11 s1038 complement(25267..26568) [1302 bp, 433 aa] {O...   132   2e-32
KLTH0F19668g Chr6 (1595709..1597007) [1299 bp, 432 aa] {ON} high...   132   2e-32
Smik_7.79 Chr7 complement(134747..136105) [1359 bp, 452 aa] {ON}...   132   2e-32
KLLA0F09119g Chr6 (848467..849825) [1359 bp, 452 aa] {ON} highly...   132   5e-32
AFR172C Chr6 complement(754470..755819) [1350 bp, 449 aa] {ON} S...   132   5e-32
Kwal_55.20790 s55 complement(559958..561307) [1350 bp, 449 aa] {...   131   6e-32
Kwal_55.22142 s55 (1130691..1131989) [1299 bp, 432 aa] {ON} YNL3...   131   6e-32
KLLA0E01981g Chr5 complement(186177..187475) [1299 bp, 432 aa] {...   131   6e-32
Kpol_246.5 s246 (11759..13120) [1362 bp, 453 aa] {ON} (11759..13...   131   6e-32
YGL194C Chr7 complement(140368..141726) [1359 bp, 452 aa] {ON}  ...   131   7e-32
Suva_14.11 Chr14 complement(13144..14445) [1302 bp, 433 aa] {ON}...   131   7e-32
NCAS0C04320 Chr3 (887622..888926) [1305 bp, 434 aa] {ON} Anc_3.8      131   7e-32
Ecym_2010 Chr2 complement(12699..14000) [1302 bp, 433 aa] {ON} s...   130   8e-32
AGR395W Chr7 (1455659..1456960) [1302 bp, 433 aa] {ON} Syntenic ...   130   8e-32
NCAS0B05480 Chr2 complement(1033624..1034979) [1356 bp, 451 aa] ...   131   9e-32
TBLA0I00560 Chr9 (100393..101694) [1302 bp, 433 aa] {ON} Anc_3.8...   130   1e-31
ZYRO0C03498g Chr3 (278064..279365) [1302 bp, 433 aa] {ON} highly...   130   1e-31
SAKL0C13706g Chr3 (1207800..1209101) [1302 bp, 433 aa] {ON} high...   130   1e-31
KAFR0C02920 Chr3 complement(584668..586029) [1362 bp, 453 aa] {O...   130   1e-31
Skud_14.11 Chr14 complement(11451..12752) [1302 bp, 433 aa] {ON}...   130   2e-31
NDAI0G03740 Chr7 complement(900866..902167) [1302 bp, 433 aa] {O...   129   2e-31
NDAI0B02710 Chr2 (674610..675971) [1362 bp, 453 aa] {ON} Anc_8.153    130   2e-31
KNAG0A01160 Chr1 complement(7229..8530) [1302 bp, 433 aa] {ON} A...   129   2e-31
TPHA0A00300 Chr1 complement(40868..42169) [1302 bp, 433 aa] {ON}...   129   3e-31
CAGL0B01441g Chr2 complement(130216..131517) [1302 bp, 433 aa] {...   129   4e-31
Suva_7.71 Chr7 complement(135837..137195) [1359 bp, 452 aa] {ON}...   129   4e-31
KAFR0A08630 Chr1 (1731077..1732378) [1302 bp, 433 aa] {ON} Anc_3...   128   7e-31
TDEL0B04580 Chr2 complement(817368..818708) [1341 bp, 446 aa] {O...   128   8e-31
Smik_14.2 Chr14 complement(2435..3736) [1302 bp, 433 aa] {ON} YN...   127   9e-31
YNL330C Chr14 complement(18001..19302) [1302 bp, 433 aa] {ON}  R...   127   1e-30
TDEL0A00270 Chr1 complement(44950..46251) [1302 bp, 433 aa] {ON}...   125   4e-30
ZYRO0G19316g Chr7 (1600375..1601721) [1347 bp, 448 aa] {ON} high...   125   7e-30
TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {O...    79   1e-14
NDAI0A05120 Chr1 (1164314..1165840) [1527 bp, 508 aa] {ON} Anc_3...    79   1e-14
SAKL0B07854g Chr2 complement(669743..671212) [1470 bp, 489 aa] {...    77   6e-14
TBLA0B02390 Chr2 (558067..559806) [1740 bp, 579 aa] {ON} Anc_3.3...    77   8e-14
Suva_16.396 Chr16 complement(689796..691229) [1434 bp, 477 aa] {...    76   1e-13
NCAS0A11180 Chr1 complement(2216701..2218173) [1473 bp, 490 aa] ...    75   2e-13
Skud_16.353 Chr16 complement(647799..649214) [1416 bp, 471 aa] {...    74   6e-13
Kpol_376.15 s376 complement(25558..27114) [1557 bp, 518 aa] {ON}...    74   7e-13
ZYRO0C16390g Chr3 complement(1274651..1275961) [1311 bp, 436 aa]...    73   9e-13
KLTH0F10582g Chr6 (910298..911722) [1425 bp, 474 aa] {ON} simila...    72   1e-12
Kwal_23.3724 s23 (406773..408194) [1422 bp, 473 aa] {ON} YPR068C...    72   2e-12
CAGL0D01430g Chr4 (158990..160327) [1338 bp, 445 aa] {ON} simila...    72   3e-12
KAFR0H00890 Chr8 (167453..168877) [1425 bp, 474 aa] {ON} Anc_3.3...    72   3e-12
YPR068C Chr16 complement(682941..684353) [1413 bp, 470 aa] {ON} ...    71   3e-12
KLLA0B09394g Chr2 (822629..823954) [1326 bp, 441 aa] {ON} simila...    71   4e-12
Smik_16.309 Chr16 complement(559713..561125) [1413 bp, 470 aa] {...    70   6e-12
ADL339W Chr4 (110772..112085) [1314 bp, 437 aa] {ON} Syntenic ho...    70   1e-11
KNAG0H00630 Chr8 (105506..106876) [1371 bp, 456 aa] {ON} Anc_3.3...    69   2e-11
SAKL0H08338g Chr8 (716414..718486) [2073 bp, 690 aa] {ON} simila...    68   7e-11
ADL265W Chr4 (237911..239995) [2085 bp, 694 aa] {ON} Syntenic ho...    66   2e-10
Ecym_8290 Chr8 complement(589795..591924) [2130 bp, 709 aa] {ON}...    65   4e-10
Suva_16.194 Chr16 (339127..341226) [2100 bp, 699 aa] {ON} YPL116...    65   5e-10
KAFR0H02790 Chr8 complement(531813..533966) [2154 bp, 717 aa] {O...    65   5e-10
NCAS0C01760 Chr3 (324446..326548) [2103 bp, 700 aa] {ON} Anc_8.6...    65   5e-10
Smik_6.315 Chr6 complement(492590..494683) [2094 bp, 697 aa] {ON...    64   8e-10
KLLA0F00858g Chr6 complement(78519..80666) [2148 bp, 715 aa] {ON...    64   9e-10
KLTH0D09592g Chr4 complement(792708..794825) [2118 bp, 705 aa] {...    64   9e-10
NDAI0E02480 Chr5 (512966..515020) [2055 bp, 684 aa] {ON} Anc_8.6...    64   1e-09
TDEL0A05520 Chr1 complement(970572..972596) [2025 bp, 674 aa] {O...    64   1e-09
Ecym_3465 Chr3 (874618..875955) [1338 bp, 445 aa] {ON} similar t...    62   2e-09
TBLA0E04080 Chr5 complement(1026669..1028753) [2085 bp, 694 aa] ...    63   3e-09
Kwal_26.8505 s26 complement(815901..818027) [2127 bp, 708 aa] {O...    63   3e-09
Skud_16.164 Chr16 (301141..303234) [2094 bp, 697 aa] {ON} YPL116...    62   4e-09
YPL116W Chr16 (329606..331699) [2094 bp, 697 aa] {ON}  HOS3Trich...    62   5e-09
TPHA0A01120 Chr1 (216522..218618) [2097 bp, 698 aa] {ON} Anc_8.6...    62   5e-09
ZYRO0F10780g Chr6 complement(879680..881686) [2007 bp, 668 aa] {...    61   1e-08
Kpol_479.6 s479 complement(10892..12958) [2067 bp, 688 aa] {ON} ...    60   1e-08
CAGL0J06974g Chr10 (667811..669847) [2037 bp, 678 aa] {ON} highl...    58   7e-08
KNAG0J01300 Chr10 (232784..234817) [2034 bp, 677 aa] {ON} Anc_8....    57   1e-07
TPHA0M01590 Chr13 complement(332934..334418) [1485 bp, 494 aa] {...    56   2e-07
Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON} (29882..3...    35   0.74 
TBLA0G01400 Chr7 complement(370536..371594) [1059 bp, 352 aa] {O...    33   2.3  
KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly...    33   3.4  

>TBLA0B06950 Chr2 complement(1643756..1646143) [2388 bp, 795 aa]
           {ON} Anc_2.285 YNL021W
          Length = 795

 Score = 1503 bits (3891), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 736/795 (92%), Positives = 736/795 (92%)

Query: 1   MSIKVEDNSGGLKRNHEELETGTKNVSTNNILNKNPPNYKKQIIVPVQAPKIHYVPLKTG 60
           MSIKVEDNSGGLKRNHEELETGTKNVSTNNILNKNPPNYKKQIIVPVQAPKIHYVPLKTG
Sbjct: 1   MSIKVEDNSGGLKRNHEELETGTKNVSTNNILNKNPPNYKKQIIVPVQAPKIHYVPLKTG 60

Query: 61  LCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLML 120
           LCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLML
Sbjct: 61  LCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLML 120

Query: 121 KLPIREATMNEILEVHSIEHFKYLEKTSNDNREQLLKETENGDSVYFNNDSFQSAKLSCG 180
           KLPIREATMNEILEVHSIEHFKYLEKTSNDNREQLLKETENGDSVYFNNDSFQSAKLSCG
Sbjct: 121 KLPIREATMNEILEVHSIEHFKYLEKTSNDNREQLLKETENGDSVYFNNDSFQSAKLSCG 180

Query: 181 GAIEACKAVVEGRVKNAMAVVRPPGHHSEPESAGGFCLFSNVAVATKNILKNYPESVRKV 240
           GAIEACKAVVEGRVKNAMAVVRPPGHHSEPESAGGFCLFSNVAVATKNILKNYPESVRKV
Sbjct: 181 GAIEACKAVVEGRVKNAMAVVRPPGHHSEPESAGGFCLFSNVAVATKNILKNYPESVRKV 240

Query: 241 LILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNI 300
           LILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNI
Sbjct: 241 LILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNI 300

Query: 301 TWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMT 360
           TWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMT
Sbjct: 301 TWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMT 360

Query: 361 HMLKSLARGNLCVVLEGGYNLDAIARSALSVSKILIGXXXXXXXXXXXXXXXXVIEMIDK 420
           HMLKSLARGNLCVVLEGGYNLDAIARSALSVSKILIG                VIEMIDK
Sbjct: 361 HMLKSLARGNLCVVLEGGYNLDAIARSALSVSKILIGEPPDELPDPLKDPKPEVIEMIDK 420

Query: 421 IIRLQSKYWKCFRRRHGNLGCNFKESINDSLISKNFPLQTAIRNFQSKKLFDELNFLTLP 480
           IIRLQSKYWKCFRRRHGNLGCNFKESINDSLISKNFPLQTAIRNFQSKKLFDELNFLTLP
Sbjct: 421 IIRLQSKYWKCFRRRHGNLGCNFKESINDSLISKNFPLQTAIRNFQSKKLFDELNFLTLP 480

Query: 481 IKNFQKXXXXXXXXXXXXXXXXXXXXXXXXXXXPGNSKEKXXXXXXXXXXXXXXXXHSSD 540
           IKNFQK                           PGNSKEK                HSSD
Sbjct: 481 IKNFQKNNMSTSTTNSINNKTTSTVISSTSTGTPGNSKEKNDTDDINGNNTTTETNHSSD 540

Query: 541 SIVPPDGSTETKSSSINSKKLENSTTNIKTISPLNENTILCSPAIIRSKTLVVLVHDSPD 600
           SIVPPDGSTETKSSSINSKKLENSTTNIKTISPLNENTILCSPAIIRSKTLVVLVHDSPD
Sbjct: 541 SIVPPDGSTETKSSSINSKKLENSTTNIKTISPLNENTILCSPAIIRSKTLVVLVHDSPD 600

Query: 601 LWTKRDVSTGVVDLSSTIIIDSTLDFIKWSLDRNYGVIDINIPQTLFEQDNYSSILAAQE 660
           LWTKRDVSTGVVDLSSTIIIDSTLDFIKWSLDRNYGVIDINIPQTLFEQDNYSSILAAQE
Sbjct: 601 LWTKRDVSTGVVDLSSTIIIDSTLDFIKWSLDRNYGVIDINIPQTLFEQDNYSSILAAQE 660

Query: 661 TLLSFWDNYLKYFPYIEKIVFIGFGDAHAGIVHLLGHRDTRSVVKSVINFLGKKPLKALV 720
           TLLSFWDNYLKYFPYIEKIVFIGFGDAHAGIVHLLGHRDTRSVVKSVINFLGKKPLKALV
Sbjct: 661 TLLSFWDNYLKYFPYIEKIVFIGFGDAHAGIVHLLGHRDTRSVVKSVINFLGKKPLKALV 720

Query: 721 PLVDETLSDWYFKNSLVFTDKNHPFWADNENKKPRKKFGRVLRSQQDGIANLIEERFDEA 780
           PLVDETLSDWYFKNSLVFTDKNHPFWADNENKKPRKKFGRVLRSQQDGIANLIEERFDEA
Sbjct: 721 PLVDETLSDWYFKNSLVFTDKNHPFWADNENKKPRKKFGRVLRSQQDGIANLIEERFDEA 780

Query: 781 TDFILDSFEEWSDEE 795
           TDFILDSFEEWSDEE
Sbjct: 781 TDFILDSFEEWSDEE 795

>Smik_14.310 Chr14 (555609..557729) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score =  786 bits (2031), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/479 (76%), Positives = 406/479 (84%), Gaps = 7/479 (1%)

Query: 6   EDNSGGLKRNHEELETGTKNVSTNNILNKNPPNYKKQIIVPVQAPKIHYVPLKTGLCYDV 65
           E+  G LKR  EE +    ++ST +       N K+Q+IVP   PKIHY PLKTGLCYDV
Sbjct: 12  ENPDGNLKRRLEETKEDQNSLSTTS-------NNKRQVIVPACTPKIHYSPLKTGLCYDV 64

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKLPIR 125
           RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVD++GDLMLK+P+R
Sbjct: 65  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVR 124

Query: 126 EATMNEILEVHSIEHFKYLEKTSNDNREQLLKETENGDSVYFNNDSFQSAKLSCGGAIEA 185
            AT  EILEVH+ EH +++E T   +REQLLKETE GDSVYFNNDS+ SA+L CGGAIEA
Sbjct: 125 AATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAIEA 184

Query: 186 CKAVVEGRVKNAMAVVRPPGHHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVLILDW 245
           CKAVVEGRVKN++AVVRPPGHH+EP++AGGFCLFSNVAVA KNILKNYPESVR+++ILDW
Sbjct: 185 CKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDW 244

Query: 246 DIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNITWPIG 305
           DIHHGNGTQK+FY DD VLY+SLHRFE+GKYYPGTIQGQYDQ GEGKGEGFNCNITWP+G
Sbjct: 245 DIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQAGEGKGEGFNCNITWPVG 304

Query: 306 AVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKS 365
            VGDAEYMWAFEQVVMPM REF+PDLVIISSGFDAADGDTIGQCHV+PSCYGHMTHMLKS
Sbjct: 305 GVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKS 364

Query: 366 LARGNLCVVLEGGYNLDAIARSALSVSKILIGXXXXXXXXXXXXXXXXVIEMIDKIIRLQ 425
           LARGNLCVVLEGGYNLDAIARSALSV+K+LIG                VIEMIDK+IRLQ
Sbjct: 365 LARGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPDELPDSSSDPKPEVIEMIDKVIRLQ 424

Query: 426 SKYWKCFRRRHGNLGCNFKESINDSLISKNFPLQTAIRNFQSKKLFDELNFLTLPIKNF 484
           SKYW CFRRRH N GCNF E INDS++SKNFPLQ AIR  Q   L DE N +TLP+ N 
Sbjct: 425 SKYWNCFRRRHANSGCNFNEPINDSIVSKNFPLQKAIRQQQQHYLSDEFNLVTLPLINM 483

 Score =  331 bits (849), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 147/222 (66%), Positives = 186/222 (83%)

Query: 574 LNENTILCSPAIIRSKTLVVLVHDSPDLWTKRDVSTGVVDLSSTIIIDSTLDFIKWSLDR 633
           L +NT+LC+P +  S TL+V+VHD+ D+W KR+V +G +DLSS++IID+ LDFIKW LDR
Sbjct: 485 LPDNTVLCTPNVYESTTLLVVVHDTSDIWAKRNVISGTIDLSSSVIIDNCLDFIKWGLDR 544

Query: 634 NYGVIDINIPQTLFEQDNYSSILAAQETLLSFWDNYLKYFPYIEKIVFIGFGDAHAGIVH 693
            YG+ID+NIP +LFE DNYS ++ +QE L+  WDNY+KYFP + KI F+G GD+++GIVH
Sbjct: 545 KYGIIDVNIPLSLFEPDNYSGMITSQEVLIYLWDNYIKYFPAVAKIAFVGIGDSYSGIVH 604

Query: 694 LLGHRDTRSVVKSVINFLGKKPLKALVPLVDETLSDWYFKNSLVFTDKNHPFWADNENKK 753
           LLGHRDTR+V K+VINFLG K LK LVPLVDETLS+WYFKNSL+F++ +H  W +NE++K
Sbjct: 605 LLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKENESRK 664

Query: 754 PRKKFGRVLRSQQDGIANLIEERFDEATDFILDSFEEWSDEE 795
           PRKKFGRVLR   DG+ N IEERF+EATDFILDSFEEWSDEE
Sbjct: 665 PRKKFGRVLRCDTDGLNNTIEERFEEATDFILDSFEEWSDEE 706

>Skud_14.308 Chr14 (563902..566022) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score =  782 bits (2019), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/480 (76%), Positives = 407/480 (84%), Gaps = 7/480 (1%)

Query: 5   VEDNSGGLKRNHEELETGTKNVSTNNILNKNPPNYKKQIIVPVQAPKIHYVPLKTGLCYD 64
           +E+    LKR  E  +    ++ST +         K+Q+IVP   PKIHY PLKTGLCYD
Sbjct: 11  LENPDHDLKRTLENTKEDQNSLSTTS-------RNKRQVIVPACTPKIHYSPLKTGLCYD 63

Query: 65  VRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKLPI 124
           VRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVD+IGDLMLK+P+
Sbjct: 64  VRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDIGDLMLKIPV 123

Query: 125 REATMNEILEVHSIEHFKYLEKTSNDNREQLLKETENGDSVYFNNDSFQSAKLSCGGAIE 184
           R AT  EILEVH+ EH +++E T   +REQLLKETE GDSVYFNNDS+ SA+L CGGAIE
Sbjct: 124 RAATSEEILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAIE 183

Query: 185 ACKAVVEGRVKNAMAVVRPPGHHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVLILD 244
           ACKAVVEGRVKN++AVVRPPGHH+EP++AGGFCLFSNVAVA KNILKNYPESVR+++ILD
Sbjct: 184 ACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILD 243

Query: 245 WDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNITWPI 304
           WDIHHGNGTQK+FY DD VLY+SLHRFE+GKYYPGTIQGQYDQTGEGKGEGFNCNITWP+
Sbjct: 244 WDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPGTIQGQYDQTGEGKGEGFNCNITWPV 303

Query: 305 GAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLK 364
           G VGDAEYMWAFEQVVMPM REF+PDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLK
Sbjct: 304 GGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLK 363

Query: 365 SLARGNLCVVLEGGYNLDAIARSALSVSKILIGXXXXXXXXXXXXXXXXVIEMIDKIIRL 424
           SLARGNLCVVLEGGYNLDAIARSALSV+K+LIG                VIEMIDK+IRL
Sbjct: 364 SLARGNLCVVLEGGYNLDAIARSALSVAKVLIGEPPDELPDSLSDPKPEVIEMIDKVIRL 423

Query: 425 QSKYWKCFRRRHGNLGCNFKESINDSLISKNFPLQTAIRNFQSKKLFDELNFLTLPIKNF 484
           QSKYW CFRRRH N GCNF E INDS+ISKNFPLQ AIR  Q + L +E +F+TLP+ N 
Sbjct: 424 QSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQKAIRQQQLQYLSNEFSFVTLPLINM 483

 Score =  332 bits (850), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 147/222 (66%), Positives = 185/222 (83%)

Query: 574 LNENTILCSPAIIRSKTLVVLVHDSPDLWTKRDVSTGVVDLSSTIIIDSTLDFIKWSLDR 633
           L +NT LC+P +  S  L+V+VHD+ D+W KR+V +G +DLSS++IID+ +DFIKW LDR
Sbjct: 485 LPDNTALCTPNVFESNALLVVVHDTSDVWAKRNVISGTIDLSSSVIIDNCIDFIKWGLDR 544

Query: 634 NYGVIDINIPQTLFEQDNYSSILAAQETLLSFWDNYLKYFPYIEKIVFIGFGDAHAGIVH 693
            YG+ID+NIP TLFE DNYS ++ +QE L+  WDNY+KYFP + KI FIG GD+H+GIVH
Sbjct: 545 KYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWDNYIKYFPNVAKIAFIGIGDSHSGIVH 604

Query: 694 LLGHRDTRSVVKSVINFLGKKPLKALVPLVDETLSDWYFKNSLVFTDKNHPFWADNENKK 753
           LLGHRDTR+V K+VINFLG K LK LVPLVDETLS+WYFKNSL+F++ +H  W +NE++K
Sbjct: 605 LLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKENESRK 664

Query: 754 PRKKFGRVLRSQQDGIANLIEERFDEATDFILDSFEEWSDEE 795
           PRKKFGRVLR   DG++N IEERF+EATDFILDSFEEWSD+E
Sbjct: 665 PRKKFGRVLRCDTDGLSNTIEERFEEATDFILDSFEEWSDDE 706

>Suva_14.326 Chr14 (576098..578218) [2121 bp, 706 aa] {ON} YNL021W
           (REAL)
          Length = 706

 Score =  781 bits (2017), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/475 (76%), Positives = 401/475 (84%), Gaps = 14/475 (2%)

Query: 11  GLKRNHEELETGTKNVSTNNILNKNPPNYKKQIIVPVQAPKIHYVPLKTGLCYDVRMRYH 70
           G+K     L T +KN              K+Q+IVP   PK+HY PL+TGLCYDVRMRYH
Sbjct: 24  GMKEEQNSLSTTSKN--------------KRQVIVPACTPKLHYTPLRTGLCYDVRMRYH 69

Query: 71  AKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKLPIREATMN 130
           AKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVD++GDLMLK+P+R AT  
Sbjct: 70  AKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDDLGDLMLKIPVRAATSE 129

Query: 131 EILEVHSIEHFKYLEKTSNDNREQLLKETENGDSVYFNNDSFQSAKLSCGGAIEACKAVV 190
           EILEVH+ EH +++E T   +REQLLKETE GDSVYFNNDS+ SA+L CGGAIEACKAVV
Sbjct: 130 EILEVHTKEHLEFIESTEKMSREQLLKETEKGDSVYFNNDSYASARLPCGGAIEACKAVV 189

Query: 191 EGRVKNAMAVVRPPGHHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVLILDWDIHHG 250
           EGRVKN++AVVRPPGHH+EP++AGGFCLFSNVAVA KNILKNYPESVR+++ILDWDIHHG
Sbjct: 190 EGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAVAAKNILKNYPESVRRIMILDWDIHHG 249

Query: 251 NGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNITWPIGAVGDA 310
           NGTQK+FY DD VLYISLHRFE+GKYYPGTIQGQYDQTGEGKGEGFNCNITWP+G VGDA
Sbjct: 250 NGTQKSFYQDDQVLYISLHRFEIGKYYPGTIQGQYDQTGEGKGEGFNCNITWPVGGVGDA 309

Query: 311 EYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGN 370
           EYMWAFEQVVMPM REF+PDLVIISSGFDAADGDTIGQCHV+PSCYGHMTHMLKSLARGN
Sbjct: 310 EYMWAFEQVVMPMGREFKPDLVIISSGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGN 369

Query: 371 LCVVLEGGYNLDAIARSALSVSKILIGXXXXXXXXXXXXXXXXVIEMIDKIIRLQSKYWK 430
           LCVVLEGGYNLDAIA SALSV+K+LIG                VIEMIDK++RLQSKYW 
Sbjct: 370 LCVVLEGGYNLDAIAISALSVAKVLIGEPPDELPDPLSDPKPEVIEMIDKVVRLQSKYWN 429

Query: 431 CFRRRHGNLGCNFKESINDSLISKNFPLQTAIRNFQSKKLFDELNFLTLPIKNFQ 485
           CFRRRH N GCNF E INDS+ISKNFPLQ AIR  Q   L DE NF+TLP+ N +
Sbjct: 430 CFRRRHANSGCNFNEPINDSIISKNFPLQKAIRQQQLHYLSDEFNFVTLPLINME 484

 Score =  331 bits (849), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 146/222 (65%), Positives = 186/222 (83%)

Query: 574 LNENTILCSPAIIRSKTLVVLVHDSPDLWTKRDVSTGVVDLSSTIIIDSTLDFIKWSLDR 633
           L +N +LC+P +  S TL+V+VHD+ D+W KR+V +G +DLSS+++ID+ LDFIKW LDR
Sbjct: 485 LPDNIVLCTPNVSESSTLLVVVHDTSDVWAKRNVISGTIDLSSSVVIDNCLDFIKWGLDR 544

Query: 634 NYGVIDINIPQTLFEQDNYSSILAAQETLLSFWDNYLKYFPYIEKIVFIGFGDAHAGIVH 693
            YG+ID+NIP TLFE DNYS ++ +QE L+  WDNY+KYFP + KI +IG GD+++GIVH
Sbjct: 545 KYGIIDVNIPLTLFEADNYSGMITSQEVLIYLWDNYIKYFPAVAKIAYIGIGDSYSGIVH 604

Query: 694 LLGHRDTRSVVKSVINFLGKKPLKALVPLVDETLSDWYFKNSLVFTDKNHPFWADNENKK 753
           LLGHRDTR+V K+VINFLG K LK LVPLVDETL++WYFKNSLVFT+ +H  W +NE++K
Sbjct: 605 LLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLTEWYFKNSLVFTNNSHQCWKENESRK 664

Query: 754 PRKKFGRVLRSQQDGIANLIEERFDEATDFILDSFEEWSDEE 795
           PRKKFGRVLR   DG++N +EERF+EATDFILDSFEEWSDEE
Sbjct: 665 PRKKFGRVLRCDTDGLSNTVEERFEEATDFILDSFEEWSDEE 706

>YNL021W Chr14 (593227..595347) [2121 bp, 706 aa] {ON}  HDA1Putative
           catalytic subunit of a class II histone deacetylase
           complex that also contains Hda2p and Hda3p; Hda1p
           interacts with the Hda2p-Hda3p subcomplex to form an
           active tetramer; deletion increases histone H2B, H3 and
           H4 acetylation
          Length = 706

 Score =  781 bits (2016), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/442 (81%), Positives = 393/442 (88%)

Query: 40  KKQIIVPVQAPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 99
           K+Q+IVPV  PKIHY PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA
Sbjct: 39  KRQVIVPVCMPKIHYSPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 98

Query: 100 ENGLINDPTLSGVDNIGDLMLKLPIREATMNEILEVHSIEHFKYLEKTSNDNREQLLKET 159
           ENGLINDPTLSGVD++GDLMLK+P+R AT  EILEVH+ EH +++E T   +RE+LLKET
Sbjct: 99  ENGLINDPTLSGVDDLGDLMLKIPVRAATSEEILEVHTKEHLEFIESTEKMSREELLKET 158

Query: 160 ENGDSVYFNNDSFQSAKLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHSEPESAGGFCLF 219
           E GDSVYFNNDS+ SA+L CGGAIEACKAVVEGRVKN++AVVRPPGHH+EP++AGGFCLF
Sbjct: 159 EKGDSVYFNNDSYASARLPCGGAIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLF 218

Query: 220 SNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPG 279
           SNVAVA KNILKNYPESVR+++ILDWDIHHGNGTQK+FY DD VLY+SLHRFE+GKYYPG
Sbjct: 219 SNVAVAAKNILKNYPESVRRIMILDWDIHHGNGTQKSFYQDDQVLYVSLHRFEMGKYYPG 278

Query: 280 TIQGQYDQTGEGKGEGFNCNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFD 339
           TIQGQYDQTGEGKGEGFNCNITWP+G VGDAEYMWAFEQVVMPM REF+PDLVIISSGFD
Sbjct: 279 TIQGQYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMGREFKPDLVIISSGFD 338

Query: 340 AADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVSKILIGXX 399
           AADGDTIGQCHV+PSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSV+K+LIG  
Sbjct: 339 AADGDTIGQCHVTPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVAKVLIGEP 398

Query: 400 XXXXXXXXXXXXXXVIEMIDKIIRLQSKYWKCFRRRHGNLGCNFKESINDSLISKNFPLQ 459
                         VIEMIDK+IRLQSKYW CFRRRH N GCNF E INDS+ISKNFPLQ
Sbjct: 399 PDELPDPLSDPKPEVIEMIDKVIRLQSKYWNCFRRRHANSGCNFNEPINDSIISKNFPLQ 458

Query: 460 TAIRNFQSKKLFDELNFLTLPI 481
            AIR  Q   L DE NF+TLP+
Sbjct: 459 KAIRQQQQHYLSDEFNFVTLPL 480

 Score =  334 bits (856), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 148/222 (66%), Positives = 188/222 (84%)

Query: 574 LNENTILCSPAIIRSKTLVVLVHDSPDLWTKRDVSTGVVDLSSTIIIDSTLDFIKWSLDR 633
           L +NT+LC+P I  S T++++VHD+ D+W KR+V +G +DLSS++IID++LDFIKW LDR
Sbjct: 485 LPDNTVLCTPNISESNTIIIVVHDTSDIWAKRNVISGTIDLSSSVIIDNSLDFIKWGLDR 544

Query: 634 NYGVIDINIPQTLFEQDNYSSILAAQETLLSFWDNYLKYFPYIEKIVFIGFGDAHAGIVH 693
            YG+ID+NIP TLFE DNYS ++ +QE L+  WDNY+KYFP + KI FIG GD+++GIVH
Sbjct: 545 KYGIIDVNIPLTLFEPDNYSGMITSQEVLIYLWDNYIKYFPSVAKIAFIGIGDSYSGIVH 604

Query: 694 LLGHRDTRSVVKSVINFLGKKPLKALVPLVDETLSDWYFKNSLVFTDKNHPFWADNENKK 753
           LLGHRDTR+V K+VINFLG K LK LVPLVDETLS+WYFKNSL+F++ +H  W +NE++K
Sbjct: 605 LLGHRDTRAVTKTVINFLGDKQLKPLVPLVDETLSEWYFKNSLIFSNNSHQCWKENESRK 664

Query: 754 PRKKFGRVLRSQQDGIANLIEERFDEATDFILDSFEEWSDEE 795
           PRKKFGRVLR   DG+ N+IEERF+EATDFILDSFEEWSDEE
Sbjct: 665 PRKKFGRVLRCDTDGLNNIIEERFEEATDFILDSFEEWSDEE 706

>ZYRO0A01870g Chr1 complement(154507..156630) [2124 bp, 707 aa] {ON}
           highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021W HDA1 Putative catalytic subunit of a
           class II histone deacetylase complex that also contains
           Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
           subcomplex to form an active tetramer deletion increases
           histone H2B H3 and H4 acetylation
          Length = 707

 Score =  761 bits (1964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/483 (75%), Positives = 404/483 (83%), Gaps = 4/483 (0%)

Query: 3   IKVEDNSGGLKRNHEELETGTKNVSTNNILNKNPPNYKKQIIVPVQAPKIHYVPLKTGLC 62
           +K ED   G KR  EE   G       N+ + +    K+QIIVP   PKIHY PLKTGLC
Sbjct: 7   VKQEDE--GSKRKLEESPNGPVE-KKPNVASVSNGRQKRQIIVPACEPKIHYTPLKTGLC 63

Query: 63  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKL 122
           YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSG D+IG+LMLK+
Sbjct: 64  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGEDDIGELMLKI 123

Query: 123 PIREATMNEILEVHSIEHFKYLEKTSNDNREQLLKETENGDSVYFNNDSFQSAKLSCGGA 182
           P+REAT+ E+L+VH+ EH +++EKTS  NRE+LLKETE GDSVYFN+DS+ +AKL CGGA
Sbjct: 124 PVREATVEELLQVHTKEHLEFIEKTSQMNREELLKETETGDSVYFNSDSYSAAKLPCGGA 183

Query: 183 IEACKAVVEGRVKNAMAVVRPPGHHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVLI 242
           IEACKAVVEGRVKNA+AV+RPPGHH+EPE AGGFCLFSNVAVA +NILKNYPESVR++LI
Sbjct: 184 IEACKAVVEGRVKNALAVIRPPGHHAEPEMAGGFCLFSNVAVAAQNILKNYPESVRRILI 243

Query: 243 LDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNITW 302
           LDWDIHHGNGTQKAFYNDD VLYISLHRFELGKYYPGTI GQYDQTGEGKGEGFNCNITW
Sbjct: 244 LDWDIHHGNGTQKAFYNDDRVLYISLHRFELGKYYPGTIHGQYDQTGEGKGEGFNCNITW 303

Query: 303 PIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHM 362
           P+G VGDAEYM AFEQ+VMPM+RE++PDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHM
Sbjct: 304 PVGGVGDAEYMLAFEQIVMPMAREYRPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHM 363

Query: 363 LKSLARGNLCVVLEGGYNLDAIARSALSVSKILIGXXXXXXXXXXXXXXXXVIEMIDKII 422
           LKSLARGNLCV LEGGYNLDAIA SALSV+KILIG                 IEMIDK+I
Sbjct: 364 LKSLARGNLCVALEGGYNLDAIATSALSVAKILIGEPPEELPDPSKNPKLEAIEMIDKVI 423

Query: 423 RLQSKYWKCFRRRHGNLGCNFKESINDSLISKNFPLQTAIRNFQSKKLFDELNFLTLPIK 482
            +QSKYWKCFRR  GN GCNFKE + +SLI+KNFPLQ AIR  Q  +L  E  F+TLP+ 
Sbjct: 424 HVQSKYWKCFRRL-GNSGCNFKEPVTESLITKNFPLQKAIRQEQFHQLEKEYGFVTLPVP 482

Query: 483 NFQ 485
             +
Sbjct: 483 KLE 485

 Score =  347 bits (889), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 152/222 (68%), Positives = 191/222 (86%)

Query: 574 LNENTILCSPAIIRSKTLVVLVHDSPDLWTKRDVSTGVVDLSSTIIIDSTLDFIKWSLDR 633
           L E+T+LCSP + +  T+++ VHD+P++W KRDV TG++D S++I +DS LDFIKWSL R
Sbjct: 486 LPEDTVLCSPDVFQESTVIIFVHDTPEIWAKRDVITGMIDPSTSITVDSPLDFIKWSLAR 545

Query: 634 NYGVIDINIPQTLFEQDNYSSILAAQETLLSFWDNYLKYFPYIEKIVFIGFGDAHAGIVH 693
            YGVID+NIPQ+LFEQDNYS+++ +QE L+  WDN++KYFP + K+ F+G GDA++GIVH
Sbjct: 546 KYGVIDVNIPQSLFEQDNYSAMITSQEVLIYLWDNFVKYFPSLSKVAFVGVGDAYSGIVH 605

Query: 694 LLGHRDTRSVVKSVINFLGKKPLKALVPLVDETLSDWYFKNSLVFTDKNHPFWADNENKK 753
           LLGHRDTRSVVK+VINF+G+K LK LVPLVDE+L DWYFKNSLVF+D+N+P W DNENKK
Sbjct: 606 LLGHRDTRSVVKAVINFVGRKQLKPLVPLVDESLGDWYFKNSLVFSDRNNPCWVDNENKK 665

Query: 754 PRKKFGRVLRSQQDGIANLIEERFDEATDFILDSFEEWSDEE 795
           PR+KFGRVLR + DGI N +EERFDEATDFILDSFEEWSD E
Sbjct: 666 PRRKFGRVLRCESDGINNNMEERFDEATDFILDSFEEWSDSE 707

>NCAS0G03800 Chr7 (701547..703727) [2181 bp, 726 aa] {ON} 
          Length = 726

 Score =  758 bits (1958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/487 (73%), Positives = 404/487 (82%), Gaps = 9/487 (1%)

Query: 4   KVEDNSGGLKRNHEELETGTKNVSTNNILNKNPPNYKKQ---------IIVPVQAPKIHY 54
           K ++++  L + +++          N    K  P  KKQ         +IVP +  ++ Y
Sbjct: 14  KTKESATVLLQTNKQFTQSDTTQKRNMTAVKEEPELKKQKITDVSERPVIVPPRDAELSY 73

Query: 55  VPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDN 114
            PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSG+++
Sbjct: 74  TPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIKDPTLSGIED 133

Query: 115 IGDLMLKLPIREATMNEILEVHSIEHFKYLEKTSNDNREQLLKETENGDSVYFNNDSFQS 174
           IGDLMLK+P+R+AT  EILEVHS EH+ ++EKTS  NRE+LLK TE GDSVYFNNDSF S
Sbjct: 134 IGDLMLKIPVRDATEEEILEVHSKEHYDFIEKTSTMNREELLKATEKGDSVYFNNDSFAS 193

Query: 175 AKLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHSEPESAGGFCLFSNVAVATKNILKNYP 234
           AKL  GG+IEACKAVVEGRVKN++AVVRPPGHH+EP++AGGFCLFSNVA+A KNILKNYP
Sbjct: 194 AKLPVGGSIEACKAVVEGRVKNSLAVVRPPGHHAEPQAAGGFCLFSNVAIAAKNILKNYP 253

Query: 235 ESVRKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGE 294
           ESVR+++ILDWDIHHGNGTQKAFY+DD VLYISLHRFELGKYYPGTI GQYDQTGEGKGE
Sbjct: 254 ESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTINGQYDQTGEGKGE 313

Query: 295 GFNCNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPS 354
           GFNCNITWP+G VGDAEY+WAFEQVVMPM+REFQPDLVIISSGFDAADGD+IGQCHV+PS
Sbjct: 314 GFNCNITWPVGGVGDAEYIWAFEQVVMPMAREFQPDLVIISSGFDAADGDSIGQCHVTPS 373

Query: 355 CYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVSKILIGXXXXXXXXXXXXXXXXV 414
           CYGHMTHMLKSLA+GNLCVVLEGGYNLDAIARSALSV+KILIG                 
Sbjct: 374 CYGHMTHMLKSLAKGNLCVVLEGGYNLDAIARSALSVAKILIGEPPDELPDPLRDPKPEA 433

Query: 415 IEMIDKIIRLQSKYWKCFRRRHGNLGCNFKESINDSLISKNFPLQTAIRNFQSKKLFDEL 474
           IE+IDK+IRLQSKYWKCF+RR+GN GCNFK+ IN+SLISKNFPLQ AIR  Q   L  + 
Sbjct: 434 IEIIDKVIRLQSKYWKCFKRRYGNAGCNFKDEINESLISKNFPLQQAIREQQLNTLSQDF 493

Query: 475 NFLTLPI 481
            F TLP+
Sbjct: 494 KFATLPL 500

 Score =  346 bits (888), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 154/222 (69%), Positives = 192/222 (86%)

Query: 574 LNENTILCSPAIIRSKTLVVLVHDSPDLWTKRDVSTGVVDLSSTIIIDSTLDFIKWSLDR 633
           L ++T+LCSP + +SKT+++  HD+P++W KRDV  G +D SS+II+DSTLDFIKW+ ++
Sbjct: 505 LPKDTVLCSPNVYQSKTVIICAHDTPEIWAKRDVIQGTIDPSSSIIVDSTLDFIKWANEK 564

Query: 634 NYGVIDINIPQTLFEQDNYSSILAAQETLLSFWDNYLKYFPYIEKIVFIGFGDAHAGIVH 693
            YGVIDINIPQ LFEQ+NYS+I+ +QE L   WDNYLKYFP +EK+ FIG GDA++GIVH
Sbjct: 565 KYGVIDINIPQNLFEQENYSAIVTSQEVLTYIWDNYLKYFPNVEKVAFIGIGDAYSGIVH 624

Query: 694 LLGHRDTRSVVKSVINFLGKKPLKALVPLVDETLSDWYFKNSLVFTDKNHPFWADNENKK 753
           LLGHRDTRSVVKSVINF+ +K L+ALVPLVDE+LSDWYFKNSLVF+DK+H +W D ENKK
Sbjct: 625 LLGHRDTRSVVKSVINFIAQKQLRALVPLVDESLSDWYFKNSLVFSDKSHTYWGDKENKK 684

Query: 754 PRKKFGRVLRSQQDGIANLIEERFDEATDFILDSFEEWSDEE 795
           PRKK+GR+LR + DGI N++EERF+EATDFILDSFEEWSD E
Sbjct: 685 PRKKYGRLLRCETDGINNIVEERFEEATDFILDSFEEWSDSE 726

>NDAI0G00650 Chr7 complement(141981..144050) [2070 bp, 689 aa] {ON}
           Anc_2.285 YNL021W
          Length = 689

 Score =  751 bits (1939), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/461 (75%), Positives = 396/461 (85%), Gaps = 1/461 (0%)

Query: 22  GTKNVSTNNILNKNPPNYK-KQIIVPVQAPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEY 80
           G +  S N+ + K   + + +QIIVP +  +IHY PLKTGLCYDVRMRYHAKIFTSYFEY
Sbjct: 3   GGETTSNNDTIKKRKIDPESRQIIVPPRDAQIHYTPLKTGLCYDVRMRYHAKIFTSYFEY 62

Query: 81  IDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKLPIREATMNEILEVHSIEH 140
           IDPHPEDPRRIYRIYKILAENGLI DPTLSG+D+IGDLMLK+P+REAT  EILEVHS EH
Sbjct: 63  IDPHPEDPRRIYRIYKILAENGLIKDPTLSGIDDIGDLMLKIPVREATSEEILEVHSKEH 122

Query: 141 FKYLEKTSNDNREQLLKETENGDSVYFNNDSFQSAKLSCGGAIEACKAVVEGRVKNAMAV 200
             ++E TS  NREQLLK TE+GDSVYFN+DS+ SAKL  GGAIEACKAVVEGRVKNA+AV
Sbjct: 123 LDFIESTSKMNREQLLKATESGDSVYFNSDSYASAKLPVGGAIEACKAVVEGRVKNALAV 182

Query: 201 VRPPGHHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQKAFYND 260
           VRPPGHH+EPE+AGGFCLFSNVA+A KNILKNYPESVRK+LILDWDIHHGNGTQKAFY+D
Sbjct: 183 VRPPGHHAEPEAAGGFCLFSNVAIAAKNILKNYPESVRKILILDWDIHHGNGTQKAFYDD 242

Query: 261 DNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNITWPIGAVGDAEYMWAFEQVV 320
           D +LY+SLHRF++GKYYPGTI G+YDQTGEGKGEGFNCNITWP+G VGDAEYMWAFEQ+V
Sbjct: 243 DRILYVSLHRFKMGKYYPGTIHGRYDQTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQIV 302

Query: 321 MPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYN 380
           MPM REFQPDLVIIS+GFDAADGDTIGQCHV+PSCYGHMTHMLKSLARGN+ VVLEGGYN
Sbjct: 303 MPMGREFQPDLVIISAGFDAADGDTIGQCHVTPSCYGHMTHMLKSLARGNMAVVLEGGYN 362

Query: 381 LDAIARSALSVSKILIGXXXXXXXXXXXXXXXXVIEMIDKIIRLQSKYWKCFRRRHGNLG 440
           LD+IA SALSV+KILIG                VIEMIDK++R+QSKYWKCF+ + GN G
Sbjct: 363 LDSIAISALSVAKILIGEPPDELPDVTRDPKPEVIEMIDKVLRIQSKYWKCFKSKFGNAG 422

Query: 441 CNFKESINDSLISKNFPLQTAIRNFQSKKLFDELNFLTLPI 481
           C+F+E IN+S+ +KNFPLQ+AIR  Q + L  E NF  LPI
Sbjct: 423 CDFQEQINNSIATKNFPLQSAIRQQQVRNLSKEFNFSELPI 463

 Score =  339 bits (869), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 153/224 (68%), Positives = 188/224 (83%)

Query: 572 SPLNENTILCSPAIIRSKTLVVLVHDSPDLWTKRDVSTGVVDLSSTIIIDSTLDFIKWSL 631
           S L E+TILCS  I  S T+++ VHD+P++W KRD   G +D SS+II+DS+LD IKW++
Sbjct: 466 SELPEDTILCSSNIYESNTIIICVHDTPEIWAKRDAIQGTIDPSSSIIVDSSLDMIKWAI 525

Query: 632 DRNYGVIDINIPQTLFEQDNYSSILAAQETLLSFWDNYLKYFPYIEKIVFIGFGDAHAGI 691
           +R YGVIDINIPQ L EQ+NY SI+ AQE L++ WDNYLKYFP + KI F+G GDA++GI
Sbjct: 526 ERKYGVIDINIPQNLLEQENYYSIITAQEVLINLWDNYLKYFPNVNKIAFVGIGDAYSGI 585

Query: 692 VHLLGHRDTRSVVKSVINFLGKKPLKALVPLVDETLSDWYFKNSLVFTDKNHPFWADNEN 751
           VHLLGHRDTRSVVK+VINF+G+K LK LVPLVDE+L +WYFKNSLVF++KNH +W D EN
Sbjct: 586 VHLLGHRDTRSVVKAVINFVGQKQLKPLVPLVDESLGEWYFKNSLVFSNKNHIYWGDKEN 645

Query: 752 KKPRKKFGRVLRSQQDGIANLIEERFDEATDFILDSFEEWSDEE 795
           KKPRKK+GRVLR   DGI+N++EERF+EATDFILDSFEEWSD E
Sbjct: 646 KKPRKKYGRVLRCDTDGISNIMEERFEEATDFILDSFEEWSDSE 689

>KAFR0H03320 Chr8 (633105..635213) [2109 bp, 702 aa] {ON} Anc_2.285
           YNL021W
          Length = 702

 Score =  751 bits (1938), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/476 (73%), Positives = 395/476 (82%), Gaps = 11/476 (2%)

Query: 10  GGLKRNHEELETGTKNVSTNNILNKNPPNYKKQIIVPVQAPKIHYVPLKTGLCYDVRMRY 69
           G  KR  EE     +N+ + N++ K      +Q+IVP + P++HY+PLKTGLCYDVRMRY
Sbjct: 12  GSTKRKQEE-----ENLESLNVVPK------RQVIVPTKKPQVHYIPLKTGLCYDVRMRY 60

Query: 70  HAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKLPIREATM 129
           HAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIND  LSGVD+IGD+MLK+P+REAT 
Sbjct: 61  HAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDTMLSGVDDIGDIMLKIPVREATA 120

Query: 130 NEILEVHSIEHFKYLEKTSNDNREQLLKETENGDSVYFNNDSFQSAKLSCGGAIEACKAV 189
           +EILEVHS EH ++LE T+  NRE LLKETE GDSVYFNNDS+ SAKLSCGGAIEACKAV
Sbjct: 121 DEILEVHSREHLEFLESTTTMNREVLLKETEKGDSVYFNNDSYMSAKLSCGGAIEACKAV 180

Query: 190 VEGRVKNAMAVVRPPGHHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVLILDWDIHH 249
           VEG+VKNA+AVVRPPGHHSEPES+GGFCLFSNVAVA KNILKNYPESVRK++ILDWDIHH
Sbjct: 181 VEGKVKNALAVVRPPGHHSEPESSGGFCLFSNVAVAAKNILKNYPESVRKIMILDWDIHH 240

Query: 250 GNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNITWPIGAVGD 309
           GNGTQKAFY D+ VLY+SLHRFE GKYYPGT+QGQYDQ GEGKGEGFNCNITWP G VGD
Sbjct: 241 GNGTQKAFYQDERVLYVSLHRFEAGKYYPGTVQGQYDQCGEGKGEGFNCNITWPTGGVGD 300

Query: 310 AEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARG 369
           AEYMWAFEQ+VMPM REFQPDLVIISSGFDAADGD IGQCHV+PSCYGHMTHMLKSLARG
Sbjct: 301 AEYMWAFEQIVMPMGREFQPDLVIISSGFDAADGDVIGQCHVTPSCYGHMTHMLKSLARG 360

Query: 370 NLCVVLEGGYNLDAIARSALSVSKILIGXXXXXXXXXXXXXXXXVIEMIDKIIRLQSKYW 429
           NL VVLEGGYNLD+IA SALSV+K LIG                 +EMI K+I++QSKYW
Sbjct: 361 NLVVVLEGGYNLDSIAISALSVAKTLIGEPPDELPDPLKDPKPEALEMIYKVIKIQSKYW 420

Query: 430 KCFRRRHGNLGCNFKESINDSLISKNFPLQTAIRNFQSKKLFDELNFLTLPIKNFQ 485
           KCF+RRHGN   NF E  +D+L +K FPLQTAIR  Q   LF E +F+  P  N +
Sbjct: 421 KCFKRRHGNYNINFSEVASDTLATKTFPLQTAIRQQQYYNLFKEYDFVKFPTANLK 476

 Score =  301 bits (771), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 141/235 (60%), Positives = 182/235 (77%), Gaps = 8/235 (3%)

Query: 565 TTNIKTISPLNENTILCSPAIIRSKTLVVLVHDSPDLWTKRDVSTGVVDLSSTIIIDSTL 624
           T N+K    L ++ ILCSP I  ++T++++VHD+P +W ++D+ +  VD  S+IIIDSTL
Sbjct: 472 TANLK----LPDDLILCSPNIHTAETVIIIVHDTPQIWLEKDIISNTVDPCSSIIIDSTL 527

Query: 625 DFIKWSLDRNYGVIDINIPQTLF----EQDNYSSILAAQETLLSFWDNYLKYFPYIEKIV 680
           DF+KW+ +R YG+ID+NIPQ+L       DNYSS++ AQE LL  WDN++K+   + KI 
Sbjct: 528 DFLKWAHNRKYGIIDVNIPQSLIYGDENPDNYSSLINAQEILLFLWDNHIKFLNEVNKIA 587

Query: 681 FIGFGDAHAGIVHLLGHRDTRSVVKSVINFLGKKPLKALVPLVDETLSDWYFKNSLVFTD 740
           FIG GD+ +G+VHLLGHRDT+  VK+VINF+  K LK LVPLVDE+LSDWYFKNSLVF++
Sbjct: 588 FIGVGDSVSGVVHLLGHRDTKERVKAVINFMADKQLKPLVPLVDESLSDWYFKNSLVFSN 647

Query: 741 KNHPFWADNENKKPRKKFGRVLRSQQDGIANLIEERFDEATDFILDSFEEWSDEE 795
           + HP W D ENKKPRKK+GRVLR   DG+ + IEERFDEATDFILDSFEEWSD E
Sbjct: 648 RTHPCWGDKENKKPRKKYGRVLRCDTDGLNSTIEERFDEATDFILDSFEEWSDSE 702

>CAGL0J03454g Chr10 complement(332090..334171) [2082 bp, 693 aa]
           {ON} highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021w HDA1 histone deacetylase A
          Length = 693

 Score =  745 bits (1924), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/485 (72%), Positives = 404/485 (83%), Gaps = 14/485 (2%)

Query: 1   MSIKVEDNSGGLKRNHEELETGTKNVSTNNILNKNPPNYKKQIIVPVQAPKIHYVPLKTG 60
           M ++++   G  KR  E+      +V++ ++        K+ +IVP +  +IHY PLKTG
Sbjct: 1   MGVELKQEPGESKRKLED------DVASQDV--------KRPVIVPTRKAQIHYTPLKTG 46

Query: 61  LCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLML 120
           +CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGV++IGDLML
Sbjct: 47  ICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVNDIGDLML 106

Query: 121 KLPIREATMNEILEVHSIEHFKYLEKTSNDNREQLLKETENGDSVYFNNDSFQSAKLSCG 180
           K+PIR AT  EILEVHS EH +++EKT   NRE+LLKETE GDSVYFNNDS+ +++L CG
Sbjct: 107 KIPIRAATAEEILEVHSKEHLEFIEKTEKMNREELLKETEKGDSVYFNNDSYATSRLPCG 166

Query: 181 GAIEACKAVVEGRVKNAMAVVRPPGHHSEPESAGGFCLFSNVAVATKNILKNYPESVRKV 240
           GAIEACKAVVEGRVKN++AVVRPPGHH+EPE+AGGFCLFSNVAVA KNILKNYPESVR++
Sbjct: 167 GAIEACKAVVEGRVKNSLAVVRPPGHHAEPEAAGGFCLFSNVAVAAKNILKNYPESVRRI 226

Query: 241 LILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNI 300
           LILDWD+HHGNGTQKAFY+DD VLYISLHRFELGKYYPGTIQGQYDQ GEGKG+GFNCNI
Sbjct: 227 LILDWDVHHGNGTQKAFYDDDRVLYISLHRFELGKYYPGTIQGQYDQIGEGKGKGFNCNI 286

Query: 301 TWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMT 360
           TWP+G VGDAEYMWAFEQVVMPM REFQPDLVIISSGFDAADGDTIGQCHV+PSCYGHMT
Sbjct: 287 TWPVGGVGDAEYMWAFEQVVMPMGREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGHMT 346

Query: 361 HMLKSLARGNLCVVLEGGYNLDAIARSALSVSKILIGXXXXXXXXXXXXXXXXVIEMIDK 420
           HMLKSLARGNLCVVLEGGYNLDAIA SALSV+KILIG                 +E+IDK
Sbjct: 347 HMLKSLARGNLCVVLEGGYNLDAIAISALSVAKILIGEPPDELPDPLREPKAEALEIIDK 406

Query: 421 IIRLQSKYWKCFRRRHGNLGCNFKESINDSLISKNFPLQTAIRNFQSKKLFDELNFLTLP 480
           +I LQSKYWKCF +R+GNLG   +  +   ++SK+FPLQTAIR  Q  +L ++  F+TLP
Sbjct: 407 VISLQSKYWKCFGKRYGNLGLPSENVVKALMMSKSFPLQTAIRQEQFHQLSEDFGFVTLP 466

Query: 481 IKNFQ 485
           + N +
Sbjct: 467 LLNME 471

 Score =  324 bits (830), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 140/220 (63%), Positives = 185/220 (84%)

Query: 576 ENTILCSPAIIRSKTLVVLVHDSPDLWTKRDVSTGVVDLSSTIIIDSTLDFIKWSLDRNY 635
           +++++CSP +    T++V+VHD+P++W KR+V TG +D S+++++DS  +FIKW L+R Y
Sbjct: 474 QDSVICSPNLFNETTILVVVHDTPEIWAKRNVITGTIDPSTSLVVDSGAEFIKWGLERKY 533

Query: 636 GVIDINIPQTLFEQDNYSSILAAQETLLSFWDNYLKYFPYIEKIVFIGFGDAHAGIVHLL 695
           G++DINIPQ+LFEQ+NY+++L +QE L+  WDNYLK+FP + K+ FIG GDA AGIVHLL
Sbjct: 534 GIMDINIPQSLFEQENYTAVLTSQEILIYIWDNYLKFFPSLTKVAFIGIGDASAGIVHLL 593

Query: 696 GHRDTRSVVKSVINFLGKKPLKALVPLVDETLSDWYFKNSLVFTDKNHPFWADNENKKPR 755
           GHRDTRSVVKSV++F+GKK LK LVPLV+E+L DWYFKNSLVFTD +H  W DNEN+KPR
Sbjct: 594 GHRDTRSVVKSVVSFIGKKSLKPLVPLVNESLGDWYFKNSLVFTDHSHSCWGDNENRKPR 653

Query: 756 KKFGRVLRSQQDGIANLIEERFDEATDFILDSFEEWSDEE 795
           KKFGRVLR   +G+ N+IEER +E+TDFILDSFEEWSD E
Sbjct: 654 KKFGRVLRCDAEGMNNIIEERLEESTDFILDSFEEWSDSE 693

>KNAG0H02010 Chr8 (354923..357004) [2082 bp, 693 aa] {ON} Anc_2.285
           YNL021W
          Length = 693

 Score =  743 bits (1919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/442 (77%), Positives = 382/442 (86%)

Query: 40  KKQIIVPVQAPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 99
           K+Q+IV   APK+ Y PLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA
Sbjct: 24  KRQMIVAPCAPKLRYTPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 83

Query: 100 ENGLINDPTLSGVDNIGDLMLKLPIREATMNEILEVHSIEHFKYLEKTSNDNREQLLKET 159
           ENGLI DP LSG+D+IGDLMLK+P+REAT  E+LEVHS EH +++E  +  + ++LLK T
Sbjct: 84  ENGLITDPMLSGIDDIGDLMLKIPVREATSQEVLEVHSKEHLEFIESVTKMSHDELLKST 143

Query: 160 ENGDSVYFNNDSFQSAKLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHSEPESAGGFCLF 219
           E GDSVYFNNDS  SAKLSCGGAIEACKAVVEGRVKNA AVVRPPGHHSEPESAGGFCLF
Sbjct: 144 ETGDSVYFNNDSSSSAKLSCGGAIEACKAVVEGRVKNAFAVVRPPGHHSEPESAGGFCLF 203

Query: 220 SNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPG 279
           SNVAVA+KNIL+NYPESVR+++ILDWDIHHGNGTQKAFY+DD VLYISLHRFELGKYYPG
Sbjct: 204 SNVAVASKNILRNYPESVRRIMILDWDIHHGNGTQKAFYDDDRVLYISLHRFELGKYYPG 263

Query: 280 TIQGQYDQTGEGKGEGFNCNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFD 339
           T QG YD+TGEGKGEGFNCNITWP+G VGDAEYMWAFEQVVMPMSREF+PDLVIIS+GFD
Sbjct: 264 TAQGHYDKTGEGKGEGFNCNITWPVGGVGDAEYMWAFEQVVMPMSREFRPDLVIISAGFD 323

Query: 340 AADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVSKILIGXX 399
           AADGDTIGQCHVSPSCYGHMTHMLKSLA GNLCVVLEGGYNLDAIARSALSV+K+LIG  
Sbjct: 324 AADGDTIGQCHVSPSCYGHMTHMLKSLANGNLCVVLEGGYNLDAIARSALSVAKVLIGEP 383

Query: 400 XXXXXXXXXXXXXXVIEMIDKIIRLQSKYWKCFRRRHGNLGCNFKESINDSLISKNFPLQ 459
                          IE+I+K+IRLQSKYWKCF+RRHGN GC F++ + +S+ + NFPLQ
Sbjct: 384 PEELLDPVKDPKPEAIEIINKVIRLQSKYWKCFQRRHGNSGCTFEKHMTESISTDNFPLQ 443

Query: 460 TAIRNFQSKKLFDELNFLTLPI 481
           +AIR  Q   L  E  F+  P+
Sbjct: 444 SAIRQQQFSALSKEFGFVKFPL 465

 Score =  322 bits (824), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 143/224 (63%), Positives = 183/224 (81%), Gaps = 2/224 (0%)

Query: 574 LNENTILCSPAIIRSKTLVVLVHDSPDLWTKRDVSTGVVDLSSTIIIDSTLDFIKWSLDR 633
           L+++T++CSP +    T+++LV D+P++W KRDV  G +D S++II D+ L FIKW+++R
Sbjct: 470 LSDDTVICSPEVYNKDTIIILVRDTPEIWAKRDVIQGTIDPSASIITDAALAFIKWAMER 529

Query: 634 NYGVIDINIPQTLFEQDNYSSILAAQETLLSFWDNYLKYFPYIEKIVFIGFGDAHAGIVH 693
           NYGVID+NIPQ+LFEQDNYS+++ AQE +   WDNY+++F    KI F+G GDA +GIVH
Sbjct: 530 NYGVIDVNIPQSLFEQDNYSAMITAQEVMSFMWDNYIRFFGSASKIAFVGVGDACSGIVH 589

Query: 694 LLGHRDTRSVVKSVINFLGKKPLKALVPLVDETLSDWYFKNSLVFTDKNHPFWAD--NEN 751
           LLGHRDTRS VKSVINF+ +K LK L+PLVDETL DWYFKNSLVF+DKNH  W D  NEN
Sbjct: 590 LLGHRDTRSKVKSVINFIAQKTLKPLIPLVDETLGDWYFKNSLVFSDKNHACWGDNENEN 649

Query: 752 KKPRKKFGRVLRSQQDGIANLIEERFDEATDFILDSFEEWSDEE 795
           KKPRKKFGRVLR   DG+ N+IEERF+EATDF+LDSFEEWS+ +
Sbjct: 650 KKPRKKFGRVLRCNSDGLTNIIEERFEEATDFMLDSFEEWSESD 693

>TDEL0G02160 Chr7 complement(424838..426982) [2145 bp, 714 aa] {ON}
           Anc_2.285 YNL021W
          Length = 714

 Score =  743 bits (1917), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/479 (72%), Positives = 394/479 (82%), Gaps = 1/479 (0%)

Query: 7   DNSGGLKRNHEELETGTKNVSTNNILNKNPPNYKKQIIVPVQAPKIHYVPLKTGLCYDVR 66
           D +  +KR  EE   G     +     +N     K++IVP  AP +HY PLKT LCYDVR
Sbjct: 15  DTTLQVKRKMEEQNDGLDPKKSQLARTQNGAA-GKRVIVPACAPNLHYTPLKTALCYDVR 73

Query: 67  MRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKLPIRE 126
           MRYHAKIFTSYFEYIDPHPEDPRRIYR+YKILAENGLINDPTLSG+D IGDLMLK+P+RE
Sbjct: 74  MRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILAENGLINDPTLSGIDEIGDLMLKIPVRE 133

Query: 127 ATMNEILEVHSIEHFKYLEKTSNDNREQLLKETENGDSVYFNNDSFQSAKLSCGGAIEAC 186
           AT  EILEVHS E+ +++E++S   RE+LLKETE GDSVYFNNDS+ SAKLSCGG I+AC
Sbjct: 134 ATDEEILEVHSKENLEFVERSSRMKREELLKETEKGDSVYFNNDSYVSAKLSCGGVIDAC 193

Query: 187 KAVVEGRVKNAMAVVRPPGHHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVLILDWD 246
           KAVVEGRVKNA+AVVRPPGHH+EPE+ GGFCLFSNVAVA +NILK YPESVR++LILDWD
Sbjct: 194 KAVVEGRVKNALAVVRPPGHHAEPEAPGGFCLFSNVAVAAQNILKQYPESVRRILILDWD 253

Query: 247 IHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNITWPIGA 306
           IHHGNGTQKAFYND  VLYISLHRFE+GKYYPGTI G+YDQTGEGKGEGFNCNITWP+G 
Sbjct: 254 IHHGNGTQKAFYNDPRVLYISLHRFEMGKYYPGTINGRYDQTGEGKGEGFNCNITWPVGG 313

Query: 307 VGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSL 366
           VGDAEYM AFEQ+VMPM+REFQPDLVIISSGFDAADGDTIGQCHV+PSCYG MTHMLKSL
Sbjct: 314 VGDAEYMLAFEQIVMPMAREFQPDLVIISSGFDAADGDTIGQCHVTPSCYGQMTHMLKSL 373

Query: 367 ARGNLCVVLEGGYNLDAIARSALSVSKILIGXXXXXXXXXXXXXXXXVIEMIDKIIRLQS 426
           ARGNLCV LEGGYNLDAIA SALSV+K+LIG                 IEMID +I  QS
Sbjct: 374 ARGNLCVALEGGYNLDAIAISALSVAKVLIGEPPDELPDPTKDPKLEAIEMIDTVIHTQS 433

Query: 427 KYWKCFRRRHGNLGCNFKESINDSLISKNFPLQTAIRNFQSKKLFDELNFLTLPIKNFQ 485
           KYWKCF+R+ GN GCNF E + +++ISK+FPLQTAIR  Q ++L  E  F+TLPI   +
Sbjct: 434 KYWKCFQRKFGNAGCNFSEPVTETVISKSFPLQTAIRQEQFRQLSKEYGFVTLPISKLE 492

 Score =  345 bits (885), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 149/222 (67%), Positives = 192/222 (86%)

Query: 574 LNENTILCSPAIIRSKTLVVLVHDSPDLWTKRDVSTGVVDLSSTIIIDSTLDFIKWSLDR 633
           + ++++LCSP + +  T+V++VHD+P++W KRDV TGV+D S++II+DS LDF KW ++R
Sbjct: 493 IPDDSVLCSPEVFQQSTIVIIVHDTPEIWAKRDVITGVIDPSTSIIVDSPLDFTKWCMNR 552

Query: 634 NYGVIDINIPQTLFEQDNYSSILAAQETLLSFWDNYLKYFPYIEKIVFIGFGDAHAGIVH 693
            YGVID+NIPQ+LFEQDNYS+++ +QE LL  WDNY+KYFP + K+ F+GFGDA+AGIVH
Sbjct: 553 KYGVIDVNIPQSLFEQDNYSAMITSQEVLLYIWDNYIKYFPSLAKVAFVGFGDAYAGIVH 612

Query: 694 LLGHRDTRSVVKSVINFLGKKPLKALVPLVDETLSDWYFKNSLVFTDKNHPFWADNENKK 753
           LLGHRDTR+ VK+V++F+G+K LK LVPLVDE+LSDWYFKNSL+FTDKNHP WADNE+KK
Sbjct: 613 LLGHRDTRATVKAVVSFIGRKQLKPLVPLVDESLSDWYFKNSLIFTDKNHPCWADNESKK 672

Query: 754 PRKKFGRVLRSQQDGIANLIEERFDEATDFILDSFEEWSDEE 795
           PRKKFGRVLR   DG+ + +EERF+EATDFILD FEEWSD E
Sbjct: 673 PRKKFGRVLRCDTDGLNSNMEERFEEATDFILDLFEEWSDSE 714

>SAKL0E07700g Chr5 (622822..624960) [2139 bp, 712 aa] {ON} highly
           similar to uniprot|P53973 Saccharomyces cerevisiae
           YNL021W HDA1 Putative catalytic subunit of a class II
           histone deacetylase complex that also contains Hda2p and
           Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
           form an active tetramer deletion increases histone H2B
           H3 and H4 acetylation
          Length = 712

 Score =  738 bits (1904), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/443 (76%), Positives = 377/443 (85%)

Query: 43  IIVPVQAPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENG 102
           +IVP   P+IHY  LKTGLCYDVRMRYHAKI+TSYFEYIDPHPEDPRRIYRIYKILAENG
Sbjct: 46  VIVPEVPPRIHYTQLKTGLCYDVRMRYHAKIYTSYFEYIDPHPEDPRRIYRIYKILAENG 105

Query: 103 LINDPTLSGVDNIGDLMLKLPIREATMNEILEVHSIEHFKYLEKTSNDNREQLLKETENG 162
           LI DPTLSGVD IG+LMLK+P+REAT  EIL+VH+ EH  +LEKT    REQLLKETE G
Sbjct: 106 LIRDPTLSGVDEIGELMLKIPVREATAEEILQVHTKEHLAFLEKTPKMTREQLLKETETG 165

Query: 163 DSVYFNNDSFQSAKLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHSEPESAGGFCLFSNV 222
           DSVYFNNDS  SAKLSCGGAIEACKAVVEGRVKNA+AV+RPPGHH+EPE AGGFCLFSNV
Sbjct: 166 DSVYFNNDSLLSAKLSCGGAIEACKAVVEGRVKNALAVIRPPGHHAEPEIAGGFCLFSNV 225

Query: 223 AVATKNILKNYPESVRKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQ 282
           AVA +NILKNYPESVR+++ILDWDIHHGNGTQKAFY+D+ VLY+SLHR+ELGKYYPGT+ 
Sbjct: 226 AVAAQNILKNYPESVRRIMILDWDIHHGNGTQKAFYSDNRVLYVSLHRYELGKYYPGTVH 285

Query: 283 GQYDQTGEGKGEGFNCNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAAD 342
           G Y+QTGEGKGEGFNCNI WP G +GDAEYMWAF+QVVMPM REFQPDLVIISSGFDAAD
Sbjct: 286 GNYEQTGEGKGEGFNCNIPWPYGGLGDAEYMWAFQQVVMPMGREFQPDLVIISSGFDAAD 345

Query: 343 GDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVSKILIGXXXXX 402
           GDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLD+IA+SAL V+KILIG     
Sbjct: 346 GDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDSIAKSALGVAKILIGEPPDE 405

Query: 403 XXXXXXXXXXXVIEMIDKIIRLQSKYWKCFRRRHGNLGCNFKESINDSLISKNFPLQTAI 462
                       IE I+ +IR QSKYW CF+  H N GCNFKE + +S ISKNFPLQ AI
Sbjct: 406 LPHPTQQPKPEAIETIETVIRTQSKYWNCFKSTHSNDGCNFKEEVTESTISKNFPLQQAI 465

Query: 463 RNFQSKKLFDELNFLTLPIKNFQ 485
           R  Q ++L ++  F+TLP+ N +
Sbjct: 466 RQEQLQQLSEKFGFVTLPLLNME 488

 Score =  321 bits (822), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 143/222 (64%), Positives = 183/222 (82%), Gaps = 2/222 (0%)

Query: 576 ENTILCSPAIIRSKTLVVLVHDSPDLWTKRDVSTGVVDLSSTIIIDSTLDFIKWSLDRNY 635
           ++T++CSP I  ++T+VV VHD+P++W +R+  TG +D S++II+D+TLD IKWSL R Y
Sbjct: 491 QDTVICSPNIYDAETVVVCVHDTPEIWAQRNPITGTIDPSTSIIVDTTLDIIKWSLQRKY 550

Query: 636 GVIDINIPQTLFEQDNYSSILAAQETLLSFWDNYLKYFPYIEKIVFIGFGDAHAGIVHLL 695
            VID+NIPQ+LFEQDNYS+++ +QE L+  WDNYLKYFP + K+ FIG GDA++GIVHLL
Sbjct: 551 SVIDVNIPQSLFEQDNYSAMITSQEVLVYIWDNYLKYFPSLAKVAFIGVGDAYSGIVHLL 610

Query: 696 GHRDTRSVVKSVINFLGKKPLKALVPLVDETLSDWYFKNSLVFTDKNHPFWAD--NENKK 753
           GHRDTRSVVK+ ++F+  KPLK+LVPLVDE+L +WYFKNSLVFT KNH  W    NENKK
Sbjct: 611 GHRDTRSVVKAAVSFVDTKPLKSLVPLVDESLGNWYFKNSLVFTSKNHSCWGTDGNENKK 670

Query: 754 PRKKFGRVLRSQQDGIANLIEERFDEATDFILDSFEEWSDEE 795
           PRK+FGRVL+    G+ N++EERF EATDFILDSFEEWSD E
Sbjct: 671 PRKRFGRVLKCDTTGMNNIVEERFQEATDFILDSFEEWSDSE 712

>KLTH0G10340g Chr7 complement(874566..876692) [2127 bp, 708 aa] {ON}
           highly similar to uniprot|P53973 Saccharomyces
           cerevisiae YNL021W HDA1 Putative catalytic subunit of a
           class II histone deacetylase complex that also contains
           Hda2p and Hda3p Hda1p interacts with the Hda2p-Hda3p
           subcomplex to form an active tetramer deletion increases
           histone H2B H3 and H4 acetylation
          Length = 708

 Score =  730 bits (1884), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/471 (72%), Positives = 391/471 (83%), Gaps = 8/471 (1%)

Query: 11  GLKRNHEELETGTKNVSTNNILNKNPPNYKKQIIVPVQAPKIHYVPLKTGLCYDVRMRYH 70
           GLKR+HE   + T N  T N         K+  IVP   PK+HY PLKTGLCYDVRMRYH
Sbjct: 18  GLKRDHE---SATLNDGTGN----QASVAKRPTIVPACRPKLHYTPLKTGLCYDVRMRYH 70

Query: 71  AKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKLPIREATMN 130
           AKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLI+DPTLSGVD+IGDLMLK+P+REAT  
Sbjct: 71  AKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLIDDPTLSGVDSIGDLMLKIPVREATDE 130

Query: 131 EILEVHSIEHFKYLEKTSNDNREQLLKETENGDSVYFNNDSFQSAKLSCGGAIEACKAVV 190
           EIL+VH+ EH +++ KT++  R+QLLKETE GDSVYFNNDS+ SAKLSCGGAIEACKAVV
Sbjct: 131 EILQVHTKEHLEFISKTTSMTRDQLLKETEKGDSVYFNNDSYLSAKLSCGGAIEACKAVV 190

Query: 191 EGRVKNAMAVVRPPGHHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVLILDWDIHHG 250
           EGRVKNA+AVVRPPGHH+EPE AGGFCLFSNVAVA +NILKNYPESVRK+++LDWD+HHG
Sbjct: 191 EGRVKNALAVVRPPGHHAEPEVAGGFCLFSNVAVAAQNILKNYPESVRKIMVLDWDVHHG 250

Query: 251 NGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNITWPIGAVGDA 310
           NGTQKAFY+DD VLYISLHR ELGKYYPGTI G  D+ GEGKGEGFNCNI WP   VGD+
Sbjct: 251 NGTQKAFYDDDRVLYISLHRHELGKYYPGTIHGNSDRVGEGKGEGFNCNIPWPWKGVGDS 310

Query: 311 EYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGN 370
           EY+WAFEQV+MPM REF+PDLVIISSGFDAADGDT+GQCHV+PSCYGHMTHMLKSLARGN
Sbjct: 311 EYLWAFEQVIMPMGREFRPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLARGN 370

Query: 371 LCVVLEGGYNLDAIARSALSVSKILIGXXXXXXXXXXXXXXXXVIEMIDKIIRLQSKYWK 430
           LC VLEGGY+LD+IA+SAL+V+K+LIG                V E+ID +I+ QSKYWK
Sbjct: 371 LCAVLEGGYSLDSIAKSALAVAKVLIGEPPDELPVVKQPKLEAV-EVIDSVIKTQSKYWK 429

Query: 431 CFRRRHGNLGCNFKESINDSLISKNFPLQTAIRNFQSKKLFDELNFLTLPI 481
           CF+  HGN GC+FKE   D+ I+KNFPLQ AIR  Q + L +E  F+TLP+
Sbjct: 430 CFKSTHGNDGCSFKEQATDTAINKNFPLQNAIRQQQMRLLANEFRFVTLPL 480

 Score =  317 bits (813), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 139/224 (62%), Positives = 180/224 (80%), Gaps = 2/224 (0%)

Query: 574 LNENTILCSPAIIRSKTLVVLVHDSPDLWTKRDVSTGVVDLSSTIIIDSTLDFIKWSLDR 633
           L ++T +CSP I  +  ++V VHD+P +W +R  +TG +D S++II+D+TLD IKW+  R
Sbjct: 485 LPDDTAICSPNIYDASAIIVCVHDTPSIWAQRSRATGTIDPSTSIIVDTTLDVIKWASSR 544

Query: 634 NYGVIDINIPQTLFEQDNYSSILAAQETLLSFWDNYLKYFPYIEKIVFIGFGDAHAGIVH 693
           NYGVIDINIPQ+L EQDNYS+++ AQE L+  WDNYLKYFP + ++ F+  GDAH+G+VH
Sbjct: 545 NYGVIDINIPQSLHEQDNYSAVITAQEVLVHIWDNYLKYFPSLNRVAFVAIGDAHSGVVH 604

Query: 694 LLGHRDTRSVVKSVINFLGKKPLKALVPLVDETLSDWYFKNSLVFTDKNHPFWAD--NEN 751
           LLGHRDTRSVVKS ++F+ ++PL+ L+PLVDETL+DWYFKNSLVF    H  W +  NEN
Sbjct: 605 LLGHRDTRSVVKSAVSFVDQRPLRPLIPLVDETLADWYFKNSLVFASAEHTCWGNDGNEN 664

Query: 752 KKPRKKFGRVLRSQQDGIANLIEERFDEATDFILDSFEEWSDEE 795
           KKPRKKFGRVL+   DGI N++EERF+EATDFILD+FEEWSD E
Sbjct: 665 KKPRKKFGRVLKCDSDGINNILEERFEEATDFILDTFEEWSDSE 708

>Ecym_3324 Chr3 complement(620836..622956) [2121 bp, 706 aa] {ON}
           similar to Ashbya gossypii ADL216C
          Length = 706

 Score =  723 bits (1866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/446 (75%), Positives = 382/446 (85%)

Query: 40  KKQIIVPVQAPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 99
           K+ IIVPV  PKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA
Sbjct: 37  KRPIIVPVVKPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 96

Query: 100 ENGLINDPTLSGVDNIGDLMLKLPIREATMNEILEVHSIEHFKYLEKTSNDNREQLLKET 159
           ENGLI DPTLSGVD+IG+LMLK+PIREAT +EIL VHS EH ++L+ T+  +REQLLKET
Sbjct: 97  ENGLIEDPTLSGVDDIGNLMLKIPIREATEDEILLVHSKEHVEFLKTTNTMSREQLLKET 156

Query: 160 ENGDSVYFNNDSFQSAKLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHSEPESAGGFCLF 219
           E GDSVY+NNDS  SAKLSCGGAIEACKAVVEGRVKNA+AVVRPPGHH+EPE AGGFCLF
Sbjct: 157 EAGDSVYYNNDSLVSAKLSCGGAIEACKAVVEGRVKNALAVVRPPGHHAEPEVAGGFCLF 216

Query: 220 SNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPG 279
           SNVAVA +NILKNYPESVRKV+ILDWDIHHGNGTQ+AFYND+ VLY+SLHR+ELG+YYPG
Sbjct: 217 SNVAVAARNILKNYPESVRKVMILDWDIHHGNGTQRAFYNDNRVLYVSLHRYELGRYYPG 276

Query: 280 TIQGQYDQTGEGKGEGFNCNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFD 339
           T  G Y+Q+GEGKGEGFNCNI W  G VGDAEYMWAFEQ+V+PM REFQPDLVIISSGFD
Sbjct: 277 TEYGNYNQSGEGKGEGFNCNIPWSCGGVGDAEYMWAFEQIVIPMGREFQPDLVIISSGFD 336

Query: 340 AADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVSKILIGXX 399
           AADGDTIGQCHVSP+CYGHMTHMLKSLA+GN+CVVLEGGYNLD+IA+SAL V K+LIG  
Sbjct: 337 AADGDTIGQCHVSPACYGHMTHMLKSLAKGNMCVVLEGGYNLDSIAKSALGVVKVLIGEP 396

Query: 400 XXXXXXXXXXXXXXVIEMIDKIIRLQSKYWKCFRRRHGNLGCNFKESINDSLISKNFPLQ 459
                          I  I+ +IR Q+KYW CF+ +HGN G N+KE +++SL  KNFPLQ
Sbjct: 397 PDELPDPFKQPKPEAIATIETVIREQAKYWDCFKSKHGNCGVNWKEPVDESLTFKNFPLQ 456

Query: 460 TAIRNFQSKKLFDELNFLTLPIKNFQ 485
           +A+R  Q ++L  E  F+TLP+ + +
Sbjct: 457 SAVRQEQFRRLSKEYKFVTLPLLDME 482

 Score =  299 bits (765), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 134/224 (59%), Positives = 177/224 (79%), Gaps = 2/224 (0%)

Query: 574 LNENTILCSPAIIRSKTLVVLVHDSPDLWTKRDVSTGVVDLSSTIIIDSTLDFIKWSLDR 633
           L+ +TI+CSP I  + TL++ VHD+P++W KR+  TG +D S++II+D+TL    W+L R
Sbjct: 483 LSGDTIICSPNIHETDTLIICVHDTPEVWAKRNPLTGYIDPSTSIIVDTTLSITNWALGR 542

Query: 634 NYGVIDINIPQTLFEQDNYSSILAAQETLLSFWDNYLKYFPYIEKIVFIGFGDAHAGIVH 693
           +YG+IDINIPQ+LFE DNYS++L +QE L   WD+YLK+F  + ++ F+G GDA++G VH
Sbjct: 543 SYGIIDINIPQSLFELDNYSAVLTSQEVLSYLWDHYLKFFAQLTRVAFVGIGDAYSGFVH 602

Query: 694 LLGHRDTRSVVKSVINFLGKKPLKALVPLVDETLSDWYFKNSLVFTDKNHPFWAD--NEN 751
           LLGHRDTRS+VK  I+F  KK L+ LVPLVDE++SDWYFKNSL+FT K H  W    N++
Sbjct: 603 LLGHRDTRSIVKCAISFTDKKQLRPLVPLVDESISDWYFKNSLIFTSKYHSCWGTEGNDS 662

Query: 752 KKPRKKFGRVLRSQQDGIANLIEERFDEATDFILDSFEEWSDEE 795
           KKPRKKFGRVL+   DG+ N++EERF+EATDFILDSFEEWSD E
Sbjct: 663 KKPRKKFGRVLKCNSDGMNNILEERFEEATDFILDSFEEWSDSE 706

>Kwal_27.11537 s27 (839198..841324) [2127 bp, 708 aa] {ON} YNL021W
           (HDA1) - histone deacetylase, shares sequence similarity
           with Rpd3p, Hos1p, Hos2p, and Hos3p [contig 27] FULL
          Length = 708

 Score =  719 bits (1855), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/466 (71%), Positives = 388/466 (83%), Gaps = 5/466 (1%)

Query: 20  ETGTKNVSTNNILNK----NPPNYKKQIIVPVQAPKIHYVPLKTGLCYDVRMRYHAKIFT 75
           E G K  + N +L +    +    K+ +IVP    K+HY PLKTGLCYDVRMRYHAKIFT
Sbjct: 16  ENGFKRDAENALLEEENGGSETKVKRPVIVPACRAKLHYTPLKTGLCYDVRMRYHAKIFT 75

Query: 76  SYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKLPIREATMNEILEV 135
           SYFEYIDPHPEDPRRIYRIYKILAENGLI DPTLSGVD+IGDLMLK+P REAT  EIL+V
Sbjct: 76  SYFEYIDPHPEDPRRIYRIYKILAENGLIIDPTLSGVDDIGDLMLKIPAREATDEEILQV 135

Query: 136 HSIEHFKYLEKTSNDNREQLLKETENGDSVYFNNDSFQSAKLSCGGAIEACKAVVEGRVK 195
           H+ EH ++L KT++  REQLLKETE GDSVYFNNDS+ SAKLSCGGAIEAC+AVVEGRVK
Sbjct: 136 HTPEHLEFLSKTTSMTREQLLKETEKGDSVYFNNDSYLSAKLSCGGAIEACRAVVEGRVK 195

Query: 196 NAMAVVRPPGHHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQK 255
           NA+AVVRPPGHH+EP+ AGGFCLFSNVAVA +NILKNYPESV+K++ILDWD+HHGNGTQK
Sbjct: 196 NALAVVRPPGHHAEPDLAGGFCLFSNVAVAAQNILKNYPESVKKIMILDWDVHHGNGTQK 255

Query: 256 AFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNITWPIGAVGDAEYMWA 315
           AFYNDD VLY+SLHR ELGKYYPGTI G  D+ GEGKGEGFNCNI WP   VGDAEY+WA
Sbjct: 256 AFYNDDRVLYVSLHRHELGKYYPGTIHGNADRVGEGKGEGFNCNIPWPWKGVGDAEYIWA 315

Query: 316 FEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVL 375
           FEQVV+PM REFQPDLVIISSGFDAADGDT+GQCHV+PSCYGHMTHMLKSLARGN+C VL
Sbjct: 316 FEQVVLPMGREFQPDLVIISSGFDAADGDTVGQCHVTPSCYGHMTHMLKSLARGNICAVL 375

Query: 376 EGGYNLDAIARSALSVSKILIGXXXXXXXXXXXXXXXXVIEMIDKIIRLQSKYWKCFRRR 435
           EGGY+LD+IA+SAL V+K+LIG                V E+ID +I++QS+YW+CF+  
Sbjct: 376 EGGYSLDSIAKSALGVAKVLIGEPPDELPVVKQPKPEAV-EVIDAVIKMQSRYWQCFKST 434

Query: 436 HGNLGCNFKESINDSLISKNFPLQTAIRNFQSKKLFDELNFLTLPI 481
           H N GC+FKE + ++L+++NFPLQTAIR  Q + L  E NF+TLP+
Sbjct: 435 HANDGCSFKEPVTETLLNRNFPLQTAIRQQQVRLLTTEYNFVTLPL 480

 Score =  309 bits (792), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 182/224 (81%), Gaps = 2/224 (0%)

Query: 574 LNENTILCSPAIIRSKTLVVLVHDSPDLWTKRDVSTGVVDLSSTIIIDSTLDFIKWSLDR 633
           L ++T LCSP I  S++++V VHD+P++W +R  +TG +D S++II+D+TLD IKW+  R
Sbjct: 485 LPDDTALCSPNIYDSQSIIVCVHDTPEIWAQRSRATGTIDPSTSIIVDTTLDVIKWASKR 544

Query: 634 NYGVIDINIPQTLFEQDNYSSILAAQETLLSFWDNYLKYFPYIEKIVFIGFGDAHAGIVH 693
           NYGVIDINIPQ+L EQDNYS++L AQE L+  WD+YLKYF  + K+ F+  GDA++G+VH
Sbjct: 545 NYGVIDINIPQSLHEQDNYSAVLTAQEVLVYIWDSYLKYFTSLSKVAFVSIGDAYSGVVH 604

Query: 694 LLGHRDTRSVVKSVINFLGKKPLKALVPLVDETLSDWYFKNSLVFTDKNHPFWADN--EN 751
           LLGHRDTR+VVK+ I+F+ ++PL+ LVPLVDE+L+DWYFKNSLVF    H  W ++  EN
Sbjct: 605 LLGHRDTRNVVKAAISFIDQRPLRPLVPLVDESLADWYFKNSLVFASAGHTCWGNDGAEN 664

Query: 752 KKPRKKFGRVLRSQQDGIANLIEERFDEATDFILDSFEEWSDEE 795
           KKPRKKFGRVL+   DG+ N++EERF+EATDFILD+FEEWSD E
Sbjct: 665 KKPRKKFGRVLKCNSDGLNNILEERFEEATDFILDTFEEWSDSE 708

>KLLA0E08383g Chr5 (754048..756162) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P53973 Saccharomyces cerevisiae
           YNL021W HDA1 Putative catalytic subunit of a class II
           histone deacetylase complex that also contains Hda2p and
           Hda3p Hda1p interacts with the Hda2p-Hda3p subcomplex to
           form an active tetramer deletion increases histone H2B
           H3 and H4 acetylation
          Length = 704

 Score =  711 bits (1835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/442 (72%), Positives = 372/442 (84%)

Query: 40  KKQIIVPVQAPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 99
           ++ +IVP   PKI Y  LKTG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYR+YKILA
Sbjct: 35  QRPVIVPPTKPKIRYSLLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRVYKILA 94

Query: 100 ENGLINDPTLSGVDNIGDLMLKLPIREATMNEILEVHSIEHFKYLEKTSNDNREQLLKET 159
           ENGLI DPTLSG D+IGDLM+K+P+REA   EIL+VHS +H  ++ +T    RE LLKET
Sbjct: 95  ENGLIQDPTLSGADSIGDLMVKVPVREAEEEEILQVHSRQHLDFISQTEQLERESLLKET 154

Query: 160 ENGDSVYFNNDSFQSAKLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHSEPESAGGFCLF 219
           E GDSVYFNNDS+ SAKLSCGGAIEACKAVVEGRVKN++AVVRPPGHH+EPE AGGFCLF
Sbjct: 155 EGGDSVYFNNDSYLSAKLSCGGAIEACKAVVEGRVKNSIAVVRPPGHHAEPEIAGGFCLF 214

Query: 220 SNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPG 279
           SNVAVA  N+LK+YPESVRK++I+DWDIHHGNGTQKAFY+DD VLY+SLHR++LGKYYPG
Sbjct: 215 SNVAVAAANMLKSYPESVRKIMIVDWDIHHGNGTQKAFYDDDRVLYVSLHRYQLGKYYPG 274

Query: 280 TIQGQYDQTGEGKGEGFNCNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFD 339
           TI G YDQTGEGKGEGFNCNITWP G VGDAEYMWAFEQV+MPM REF+PDLV+ISSGFD
Sbjct: 275 TIHGNYDQTGEGKGEGFNCNITWPTGGVGDAEYMWAFEQVIMPMGREFEPDLVLISSGFD 334

Query: 340 AADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVSKILIGXX 399
           AADGDTIGQCHV+P+CYGHMTHML SLA+GNLCVVLEGGYNLD+IA+SAL V K+L+G  
Sbjct: 335 AADGDTIGQCHVTPACYGHMTHMLLSLAKGNLCVVLEGGYNLDSIAKSALGVCKVLVGEP 394

Query: 400 XXXXXXXXXXXXXXVIEMIDKIIRLQSKYWKCFRRRHGNLGCNFKESINDSLISKNFPLQ 459
                           +MI+ +IR QSKYW CF+ RHGN G NFK++I  +L ++NFPLQ
Sbjct: 395 PDELPAPKKQPTPEAKKMIETVIRTQSKYWSCFKNRHGNDGINFKDAITSTLDTRNFPLQ 454

Query: 460 TAIRNFQSKKLFDELNFLTLPI 481
            AIR +Q  +L  + NF+ LPI
Sbjct: 455 NAIREYQVSQLSSQFNFVQLPI 476

 Score =  310 bits (794), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 140/224 (62%), Positives = 177/224 (79%), Gaps = 2/224 (0%)

Query: 574 LNENTILCSPAIIRSKTLVVLVHDSPDLWTKRDVSTGVVDLSSTIIIDSTLDFIKWSLDR 633
           L  NT+LC+  I  S+TLVV+VHD+P++W++RD  TG++D SS+II+D+ L  I W++DR
Sbjct: 481 LPANTMLCTSGIQDSETLVVIVHDTPEIWSERDTQTGIIDPSSSIIVDNALKMINWAMDR 540

Query: 634 NYGVIDINIPQTLFEQDNYSSILAAQETLLSFWDNYLKYFPYIEKIVFIGFGDAHAGIVH 693
            YG+IDINIPQTLFE  NY  + ++QE L+  WDNYLK+F  ++K+ FIG GDA+ GIVH
Sbjct: 541 RYGIIDINIPQTLFEHANYPGVASSQEILIYLWDNYLKFFQNLQKVAFIGIGDAYGGIVH 600

Query: 694 LLGHRDTRSVVKSVINFLGKKPLKALVPLVDETLSDWYFKNSLVFTDKNHPFWAD--NEN 751
           LLGHRDTRSVVK  I+FL KKPLK +VPL+DETL DWYFKNSLVFT   H  W    NEN
Sbjct: 601 LLGHRDTRSVVKCAISFLDKKPLKVMVPLIDETLGDWYFKNSLVFTSSTHSCWGSTANEN 660

Query: 752 KKPRKKFGRVLRSQQDGIANLIEERFDEATDFILDSFEEWSDEE 795
           KK RKK+GRVL++  DG+ N+ +ERF+EATDFILDSFEEWS+ E
Sbjct: 661 KKLRKKYGRVLKADCDGMTNIFDERFEEATDFILDSFEEWSESE 704

>TPHA0C03390 Chr3 complement(743315..745420) [2106 bp, 701 aa] {ON}
           Anc_2.285 YNL021W
          Length = 701

 Score =  697 bits (1800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/445 (71%), Positives = 377/445 (84%), Gaps = 1/445 (0%)

Query: 40  KKQIIVPVQAPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 99
           K+ +IVP Q P +HY PLKTG+CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA
Sbjct: 34  KRPVIVPTQKPNLHYTPLKTGICYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 93

Query: 100 ENGLINDPTLSGVDNIGDLMLKLPIREATMNEILEVHSIEHFKYLEKTSNDNREQLLKET 159
           ENGLINDP+L+GV +IGDLMLK+P+REAT  EIL+VH+ EH ++LE T    RE+LL +T
Sbjct: 94  ENGLINDPSLTGVSDIGDLMLKIPVREATKEEILDVHTEEHMQFLESTEKMTREELLSKT 153

Query: 160 ENGDSVYFNNDSFQSAKLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHSEPESAGGFCLF 219
           E GDSVY NNDS+ SA+LSCGGAIEACKAVVEGRVKNA+A+VRPPGHH+EP++AGGFCLF
Sbjct: 154 EKGDSVYLNNDSYISARLSCGGAIEACKAVVEGRVKNALAIVRPPGHHAEPQAAGGFCLF 213

Query: 220 SNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPG 279
           SNV+VA K+ILK YPESVRK+LI+DWDIHHGNGTQKAFY DDNVLYISLHRFELGK+YPG
Sbjct: 214 SNVSVAAKSILKTYPESVRKILIVDWDIHHGNGTQKAFYEDDNVLYISLHRFELGKFYPG 273

Query: 280 TIQGQYDQTGEGKGEGFNCNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFD 339
             +G YD+ G+GKG+GFNCNITWP+  VGD EY+WAFEQ+V+PM+REF+PDLVI+SSGFD
Sbjct: 274 FPEGNYDKVGDGKGKGFNCNITWPVKGVGDVEYIWAFEQIVIPMAREFRPDLVIVSSGFD 333

Query: 340 AADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVSKILIGXX 399
           AA GDTIGQCHV+P+CYG+MTHMLKSLARGNLCVVLEGGYNLD+I+ SAL+V+KILIG  
Sbjct: 334 AAHGDTIGQCHVTPNCYGYMTHMLKSLARGNLCVVLEGGYNLDSISNSALAVAKILIGEP 393

Query: 400 XXXXXXXXXXXXXXVIEMIDKIIRLQSKYWKCFRRRHGNLGCNFKESINDSLISKNFPLQ 459
                         V+EMI+K+IR+QSKYWKCFRR+ GN G  ++ +I +S I K FPLQ
Sbjct: 394 PDEIPESDRDPKPGVLEMINKVIRVQSKYWKCFRRKFGNFGGEYENAI-ESQIPKMFPLQ 452

Query: 460 TAIRNFQSKKLFDELNFLTLPIKNF 484
            AIRN Q    +D+   ++L + N 
Sbjct: 453 DAIRNAQLSHYYDDFGMISLSLPNL 477

 Score =  285 bits (730), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 130/222 (58%), Positives = 174/222 (78%), Gaps = 1/222 (0%)

Query: 574 LNENTILCSPAIIRSKTLVVLVHDSPDLWTKRDVSTGVVDLSSTIIIDSTLDFIKWSLDR 633
           L +N+I+CS    ++K+L VL+HD+P++W  RD+ TG++D S++II DS+L FI W+++R
Sbjct: 479 LPKNSIICSSNFFKAKSLCVLLHDTPEVWGNRDIITGIIDPSTSIIFDSSLKFINWAIER 538

Query: 634 NYGVIDINIPQTLFEQDNYSSILAAQETLLSFWDNYLKYFPYIEKIVFIGFGDAHAGIVH 693
              VIDINIP++ FE DNYSS L +Q+ ++S WDN+ KY   +EK+ FIG G+A +GIVH
Sbjct: 539 ETAVIDINIPRSAFEADNYSSNLLSQDVMISLWDNHFKYIESLEKLCFIGIGEATSGIVH 598

Query: 694 LLGHRDTRSVVKSVINFLGKKPLKALVPLVDETLSDWYFKNSLVFTDKNHPFWADNENKK 753
           LLG RDTR+V K+ INF+G   LK +VP +DE+L DWYFKNSLVFTD  H  W++N+ KK
Sbjct: 599 LLGKRDTRTVTKAAINFVGSSSLKPIVPSLDESLGDWYFKNSLVFTDHFHGCWSEND-KK 657

Query: 754 PRKKFGRVLRSQQDGIANLIEERFDEATDFILDSFEEWSDEE 795
           PRKK+GRVLR   DGI N+IEERF+EATDFILD+F+EWSD E
Sbjct: 658 PRKKYGRVLRCDTDGIHNIIEERFEEATDFILDAFDEWSDTE 699

>ADL216C Chr4 complement(324197..326314) [2118 bp, 705 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL021W
           (HDA1)
          Length = 705

 Score =  695 bits (1793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/449 (73%), Positives = 372/449 (82%), Gaps = 3/449 (0%)

Query: 40  KKQIIVPVQAPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 99
           K+ +IVP   PKI YVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA
Sbjct: 33  KRPVIVPPVRPKISYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILA 92

Query: 100 ENGLINDPTLSGVDNIGDLMLKLPIREATMNEILEVHSIEHFKYLEKTSNDNREQLLKET 159
           ENGLI DPTLSG+D IG+LM K+P+REAT  EIL VHS EH ++L+ T+  +REQLLKET
Sbjct: 93  ENGLIEDPTLSGIDEIGELMQKIPVREATEEEILTVHSKEHVEFLKTTNTMDREQLLKET 152

Query: 160 ENGDSVYFNNDSFQSAKLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHSEPESAGGFCLF 219
           E GDSVY+NNDS  SA+LSCGGAIEACKAVVEGRVKNAMAVVRPPGHH+EP  AGGFCLF
Sbjct: 153 EAGDSVYYNNDSLISARLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHAEPGVAGGFCLF 212

Query: 220 SNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPG 279
           SNVAVA +NILKNYPESVR+V+ILDWDIHHGNGTQKAFY D+ VLY+SLHR+ELGKYYPG
Sbjct: 213 SNVAVAAQNILKNYPESVRRVMILDWDIHHGNGTQKAFYGDNRVLYVSLHRYELGKYYPG 272

Query: 280 TIQGQYDQTGEGKGEGFNCNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFD 339
           T  G YDQ G+GKGEGFNCNI W    VGDAEYMWAFEQVV+PM REFQPDLVIISSGFD
Sbjct: 273 TSYGNYDQCGDGKGEGFNCNIPWSCSGVGDAEYMWAFEQVVIPMGREFQPDLVIISSGFD 332

Query: 340 AADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVSKILIGXX 399
           AADGDTIGQCHVSP+CYGH+THMLKSLARGN+CVVLEGGYNLD+IA+SAL V+K+LIG  
Sbjct: 333 AADGDTIGQCHVSPACYGHLTHMLKSLARGNMCVVLEGGYNLDSIAKSALGVAKVLIGEP 392

Query: 400 XXXXXXXXXXXXXXVIEMID-KIIRLQSKYWKCFRRRHGNLGCNFKE-SINDSLISKNFP 457
                          I  ID  +++ QSKYW CF+ RHGN G N++E ++NDSL SKNFP
Sbjct: 393 PDELPQPLKQPKPEAIVTIDMGLVKEQSKYWNCFKGRHGNDGINWREGAVNDSLTSKNFP 452

Query: 458 LQTAIR-NFQSKKLFDELNFLTLPIKNFQ 485
           LQ       Q ++L  E  F+TLP+ N +
Sbjct: 453 LQKCCSPTTQFRRLAKEYKFVTLPLLNME 481

 Score =  302 bits (773), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 136/224 (60%), Positives = 176/224 (78%), Gaps = 2/224 (0%)

Query: 574 LNENTILCSPAIIRSKTLVVLVHDSPDLWTKRDVSTGVVDLSSTIIIDSTLDFIKWSLDR 633
           L  +TI+CSP I  +  +++ VHD+P++W +RD  TG +D S++II+D+T+  I W+L R
Sbjct: 482 LPSDTIICSPNIHTTDAIIICVHDTPEIWAQRDSLTGHIDPSTSIIVDTTVSVINWALGR 541

Query: 634 NYGVIDINIPQTLFEQDNYSSILAAQETLLSFWDNYLKYFPYIEKIVFIGFGDAHAGIVH 693
           NYGVIDINIPQ+LFEQDNYS++L++QE +   WD+YLK FP++ ++ F+G GDA++G VH
Sbjct: 542 NYGVIDINIPQSLFEQDNYSAVLSSQEVVTYLWDSYLKTFPHLARVAFVGIGDAYSGFVH 601

Query: 694 LLGHRDTRSVVKSVINFLGKKPLKALVPLVDETLSDWYFKNSLVFTDKNHPFWA--DNEN 751
           LLGHRDTRSVVK  I F  KK L+ LVPLVDE+L DWYFKNSLVFT   HP W    N++
Sbjct: 602 LLGHRDTRSVVKCAIAFADKKQLRPLVPLVDESLGDWYFKNSLVFTSTYHPCWGTDGNDS 661

Query: 752 KKPRKKFGRVLRSQQDGIANLIEERFDEATDFILDSFEEWSDEE 795
           KKPRKKFGRVLR   DG+ N++EER +EATDFILDSFEEWS+ E
Sbjct: 662 KKPRKKFGRVLRWTCDGMNNIVEERLEEATDFILDSFEEWSESE 705

>Kpol_1039.32 s1039 (99859..101838) [1980 bp, 659 aa] {ON}
           (99859..101838) [1980 nt, 660 aa]
          Length = 659

 Score =  692 bits (1787), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/432 (73%), Positives = 366/432 (84%)

Query: 52  IHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSG 111
           + Y PLKTGLCYDVRMRYHAKI+TSY+EYIDPHPEDPRRIYRIYKILAENGLI DP LSG
Sbjct: 5   LSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDPALSG 64

Query: 112 VDNIGDLMLKLPIREATMNEILEVHSIEHFKYLEKTSNDNREQLLKETENGDSVYFNNDS 171
           +D+IGDLM K+P+REAT  EILEVH  E  +YLEKT   NR++LL +TE GDSVYFNNDS
Sbjct: 65  IDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYFNNDS 124

Query: 172 FQSAKLSCGGAIEACKAVVEGRVKNAMAVVRPPGHHSEPESAGGFCLFSNVAVATKNILK 231
           + SAKLSCGGAIEACKA+V+G+VKN++A+VRPPGHHSEPE AGGFCLFSNVAVATKNILK
Sbjct: 125 YFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATKNILK 184

Query: 232 NYPESVRKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEG 291
           NYP+ V+KV+I+DWDIHHGNGTQKAFYNDD VLY+SLHRFELGKYYPGTI GQYDQ GEG
Sbjct: 185 NYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQVGEG 244

Query: 292 KGEGFNCNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHV 351
           KGEGFNCNI W +G +GDAEY+WAFEQ+VMPM REF+PDLVI+SSGFDAADGDTIG+CHV
Sbjct: 245 KGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIGKCHV 304

Query: 352 SPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIARSALSVSKILIGXXXXXXXXXXXXXX 411
           +PSCYGHMTHMLKSLA G LCVVLEGGYNLDAIARSAL+V+K+LIG              
Sbjct: 305 TPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPDKDPK 364

Query: 412 XXVIEMIDKIIRLQSKYWKCFRRRHGNLGCNFKESINDSLISKNFPLQTAIRNFQSKKLF 471
              IEMID++I L+SKYWKCF+R+  N  C +K  I++S  +K FP+Q AIR  Q + L 
Sbjct: 365 PEAIEMIDRVIDLKSKYWKCFKRQITNSNCEYKGPISESFFAKKFPIQDAIRAQQIQYLT 424

Query: 472 DELNFLTLPIKN 483
           ++ N + LP+ N
Sbjct: 425 NDYNMVPLPLMN 436

 Score =  318 bits (815), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 139/223 (62%), Positives = 185/223 (82%)

Query: 572 SPLNENTILCSPAIIRSKTLVVLVHDSPDLWTKRDVSTGVVDLSSTIIIDSTLDFIKWSL 631
           S L E+T++CS  I++S   ++ VHD+P++W+KRD   GV+D S+++ +D++L F  W+L
Sbjct: 437 SNLPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSSASLYMDASLQFYDWAL 496

Query: 632 DRNYGVIDINIPQTLFEQDNYSSILAAQETLLSFWDNYLKYFPYIEKIVFIGFGDAHAGI 691
           DR YG+ID+NIPQTL+EQDNYS+ L AQE L+  WDN LKYFP + KI +IG G+A++G+
Sbjct: 497 DRGYGIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPNVNKIAYIGVGEAYSGL 556

Query: 692 VHLLGHRDTRSVVKSVINFLGKKPLKALVPLVDETLSDWYFKNSLVFTDKNHPFWADNEN 751
           VHLLGHRDTRSVVKSVI F+GKKPLKALVPLV+E+L+DWYFK SL+F DKNH  W +N++
Sbjct: 557 VHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTSLLFADKNHSCWGENDS 616

Query: 752 KKPRKKFGRVLRSQQDGIANLIEERFDEATDFILDSFEEWSDE 794
           KKPRK++GRVLR   DGI +LIEERF+EATDFI+DS +EW++E
Sbjct: 617 KKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTEE 659

>Kpol_1003.37 s1003
           complement(91621..92301,92861..92869,92912..93958) [1737
           bp, 578 aa] {ON}
           complement(91621..92301,92861..92869,92912..93958) [1737
           nt, 579 aa]
          Length = 578

 Score =  515 bits (1327), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 233/326 (71%), Positives = 275/326 (84%), Gaps = 7/326 (2%)

Query: 18  ELETGTKNVSTNNILNKNPPN------YKKQIIVPVQAPKIHYVPLKTGLCYDVRMRYHA 71
           E+ TG  N     I+N N  N       K+Q+IVP++ PK+HY PLKTGLCYDVRMRYHA
Sbjct: 25  EMATGV-NGGKETIMNGNSKNDHFKKMPKRQVIVPIRQPKLHYTPLKTGLCYDVRMRYHA 83

Query: 72  KIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKLPIREATMNE 131
           KIFTS FEYIDPHPEDPRR+YRIYKILAENGLI D  LSG+D+IGD+MLK+P+R AT  E
Sbjct: 84  KIFTSNFEYIDPHPEDPRRVYRIYKILAENGLIKDENLSGLDDIGDIMLKIPVRTATEEE 143

Query: 132 ILEVHSIEHFKYLEKTSNDNREQLLKETENGDSVYFNNDSFQSAKLSCGGAIEACKAVVE 191
           IL VH+ EH  ++E   + +RE+L+K TE  DSVY+NNDS+ SAKLSCGG IEAC+AVVE
Sbjct: 144 ILAVHTREHLDFIENIESQSREELIKLTEKADSVYYNNDSYYSAKLSCGGVIEACRAVVE 203

Query: 192 GRVKNAMAVVRPPGHHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVLILDWDIHHGN 251
           GRVKN++A+VRPPGHH+EP++AGGFCLFSNV+VA ++IL+ YPESVRK+LILDWDIHHGN
Sbjct: 204 GRVKNSLAIVRPPGHHAEPQAAGGFCLFSNVSVAARSILRTYPESVRKILILDWDIHHGN 263

Query: 252 GTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNITWPIGAVGDAE 311
           GTQKAFY D+NVLYISLHR+E   +YPGTI G+YDQ GEGKGEGFNCNITWP+G VGDAE
Sbjct: 264 GTQKAFYEDENVLYISLHRYESTAFYPGTIHGRYDQVGEGKGEGFNCNITWPVGGVGDAE 323

Query: 312 YMWAFEQVVMPMSREFQPDLVIISSG 337
           YMWAFE VVMP+ REF+PDLVI+SSG
Sbjct: 324 YMWAFEHVVMPLGREFRPDLVIVSSG 349

 Score =  279 bits (714), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 173/221 (78%)

Query: 575 NENTILCSPAIIRSKTLVVLVHDSPDLWTKRDVSTGVVDLSSTIIIDSTLDFIKWSLDRN 634
           +E  +L S  I +++TLV+LVHD+P+LW  RD+ TGV+D S++++ID+++ FIKW+ DRN
Sbjct: 356 HEKLVLASQKIFKAETLVILVHDTPELWGDRDIITGVLDPSTSVLIDTSMKFIKWAADRN 415

Query: 635 YGVIDINIPQTLFEQDNYSSILAAQETLLSFWDNYLKYFPYIEKIVFIGFGDAHAGIVHL 694
           Y ++DINIP++  E++ +SS  AA E +LS WDN+L+Y   + KI FIG G+++ GIVHL
Sbjct: 416 YSILDINIPKSNLEKETFSSSKAANEIMLSLWDNHLQYISTLTKICFIGIGESYQGIVHL 475

Query: 695 LGHRDTRSVVKSVINFLGKKPLKALVPLVDETLSDWYFKNSLVFTDKNHPFWADNENKKP 754
           +G RD R + K+VINF+G  PLK+L    DET+ DWYFKNSLVFT+ +H  W ++E K+P
Sbjct: 476 IGERDLRVLSKAVINFVGNFPLKSLSSNFDETMVDWYFKNSLVFTNDSHNCWKESEEKRP 535

Query: 755 RKKFGRVLRSQQDGIANLIEERFDEATDFILDSFEEWSDEE 795
           RKKFGRVL+S  DGI ++I ERFDEATDFILD+FEEWSDEE
Sbjct: 536 RKKFGRVLKSDSDGIISIINERFDEATDFILDAFEEWSDEE 576

>SAKL0H25124g Chr8 (2184039..2185385) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 448

 Score =  141 bits (355), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 96/338 (28%), Positives = 170/338 (50%), Gaps = 28/338 (8%)

Query: 54  YVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVD 113
           Y+P + G  Y   + YH     S + Y   HP  P R+     +++  GL          
Sbjct: 14  YLPYEFGSTYSPHVSYHFNSDVSQYHYGVRHPMKPFRLMLTDHLVSSYGL---------H 64

Query: 114 NIGDLMLKLPIREATMNEILEVHSIEHFKYLEKTSNDNREQL----LKETENGDSVYFNN 169
            I DL      REAT +E+LE HS ++ ++L K S D   ++    L++   GD      
Sbjct: 65  KIMDLY---ETREATRDELLEFHSADYIEFLSKVSPDTLSKMPRGSLEKFNIGDDCPIFQ 121

Query: 170 DSFQSAKLSCGGAIEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKN 228
             F+ + L  G +++A + ++ G  ++ +A+    G HH++     GFC  +++ +A  N
Sbjct: 122 GIFEYSSLYAGASLDASRKLIAG--QSEIAINWSGGLHHAKKAKPSGFCYVNDIVLAILN 179

Query: 229 ILKNYPESVRKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQT 288
           +L+ +P    +VL +D D+HHG+G Q+AFY  D V  +S H++  G+++PGT  G +D+ 
Sbjct: 180 LLRFHP----RVLYVDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDFDEI 232

Query: 289 GEGKGEGFNCNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQ 348
           G  +G+ F  N+    G + D  Y+  F+ ++ P+   ++P ++I   G D+   D +G 
Sbjct: 233 GCSRGKHFALNVPLDDG-IDDDSYINLFKSIMDPLITSYKPTVIIQQCGADSLGHDRLGC 291

Query: 349 CHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAR 386
            +++   +G     +KS     L VV  GGY    ++R
Sbjct: 292 FNLNIRAHGECVKFVKSFGIPML-VVGGGGYTPRNVSR 328

>TPHA0H00320 Chr8 complement(62605..63957) [1353 bp, 450 aa] {ON}
           Anc_8.153 YGL194C
          Length = 450

 Score =  140 bits (353), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 98/334 (29%), Positives = 170/334 (50%), Gaps = 32/334 (9%)

Query: 60  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLS--GVDNIGD 117
           G  Y  R+ YH     S + Y   HP  P R            ++ D  +S  G+ NI D
Sbjct: 22  GSTYSPRVSYHYNPKVSNYHYGVKHPMKPFRF-----------MLTDHLVSSYGLHNIMD 70

Query: 118 LMLKLPIREATMNEILEVHSIEHFKYLEKTSNDNREQLLKETEN----GDSVYFNNDSFQ 173
           L      REAT  E+L+ HS ++ ++L K S DN  ++ + T +    GD      + ++
Sbjct: 71  L---YETREATKEELLQFHSEDYVEFLSKVSPDNISKMPRGTFDKYNIGDDCPIFQNIYE 127

Query: 174 SAKLSCGGAIEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNILKN 232
             KL  G +++A + ++    ++ +A+    G HH++  +  GFC  +++ +AT N+L+ 
Sbjct: 128 YCKLYAGASLDASRKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLATLNLLRY 185

Query: 233 YPESVRKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGK 292
           +P    +VL +D D+HHG+G Q+AFY  D V  +S H++  G+++PGT  G YD+ G  +
Sbjct: 186 HP----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNYDEIGCAE 238

Query: 293 GEGFNCNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVS 352
           G+ F  N+    G + D  Y+  F+ V+ P+   F+P  +I   G D+   D +G  +++
Sbjct: 239 GKHFAMNVPLNDG-IDDDSYINLFKSVMEPIITSFKPTAIIQQCGADSLGHDRLGCFNLN 297

Query: 353 PSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAR 386
              +G     ++S     + VV  GGY    ++R
Sbjct: 298 IKAHGECVKFIRSFGIP-MVVVGGGGYTPRNVSR 330

>KLTH0E06446g Chr5 complement(594807..596156) [1350 bp, 449 aa] {ON}
           highly similar to uniprot|P53096 Saccharomyces
           cerevisiae YGL194C HOS2 Histone deacetylase required for
           gene activation via specific deacetylation of lysines in
           H3 and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 449

 Score =  137 bits (344), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 95/332 (28%), Positives = 166/332 (50%), Gaps = 28/332 (8%)

Query: 60  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLM 119
           G  Y+  + YH     S F Y   HP  P R+     +++  GL           I DL 
Sbjct: 21  GAPYEPNVSYHFNSDVSQFHYGVRHPMKPFRLMLTDHLVSSYGL---------HKIMDLY 71

Query: 120 LKLPIREATMNEILEVHSIEHFKYLEKTSNDNREQL----LKETENGDSVYFNNDSFQSA 175
                R AT  E+ E H+ ++ ++L K S DN  +L    L++   GD        +Q +
Sbjct: 72  ---ETRPATREELCEFHADDYVEFLAKVSPDNLSKLPRGTLEKFNIGDDCPIFQGLYQYS 128

Query: 176 KLSCGGAIEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNILKNYP 234
            L  G +++A + ++ G  ++ +A+    G HH++  S  GFC  +++ ++  N+L+ +P
Sbjct: 129 TLYAGASLDATRKLING--QSEIAINWSGGLHHAKKSSPSGFCYVNDIVLSVLNLLRYHP 186

Query: 235 ESVRKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGE 294
               +VL +D D+HHG+G Q+AFY  D V  +S H++  G+++PGT  G  D+TG  +G+
Sbjct: 187 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNLDETGCSRGK 239

Query: 295 GFNCNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPS 354
            F  N+    G + D  Y+  F+ ++ P+   F+P ++I   G D+   D +G  +++  
Sbjct: 240 HFALNVPLEDG-IDDDSYINLFKSIIDPLITSFKPTVIIQQCGADSLGHDRLGCFNLNVK 298

Query: 355 CYGHMTHMLKSLARGNLCVVLEGGYNLDAIAR 386
            +G     +KS     L V+  GGY    ++R
Sbjct: 299 AHGECVRFVKSFGIPML-VLGGGGYTPRNVSR 329

>KNAG0G01350 Chr7 (300791..302146) [1356 bp, 451 aa] {ON} Anc_8.153
           YGL194C
          Length = 451

 Score =  134 bits (338), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 96/335 (28%), Positives = 167/335 (49%), Gaps = 28/335 (8%)

Query: 57  LKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIG 116
            + G    +R+ YH     S++ Y   HP  P R+           ++ D  +SG   + 
Sbjct: 19  FELGAARPLRVSYHFNPKVSHYHYGVKHPMKPFRL-----------MLTDHLVSGY-GMH 66

Query: 117 DLMLKLPIREATMNEILEVHSIEHFKYLEKTSNDNREQL----LKETENGDSVYFNNDSF 172
            +M     R AT +E+ E H+ ++  +L+K S DN  +L    L++   GD      + +
Sbjct: 67  KVMDLYETRAATNDELTEFHTEDYVHFLQKVSPDNLGKLPRGTLEKFNIGDDCPIFQNLY 126

Query: 173 QSAKLSCGGAIEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNILK 231
             A L  G +++A + ++ G  ++ +A+    G HH++  S  GFC  +++ ++  N+L+
Sbjct: 127 DYATLYTGASLDATRKLING--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSIVNLLR 184

Query: 232 NYPESVRKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEG 291
            +P    +VL +D D+HHG+G Q+AFY  D V  IS H++  G ++PGT  G  D+TG  
Sbjct: 185 YHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTISFHKYN-GDFFPGT--GDIDETGCD 237

Query: 292 KGEGFNCNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHV 351
            GE F  N+    G + D  Y+  F+ V+ P+   + P ++I   G D+   D +G  ++
Sbjct: 238 AGERFALNVPLEDG-IDDDSYINLFKSVIGPLITAYNPTVIIQQCGADSLGHDRLGCFNL 296

Query: 352 SPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAR 386
           +   +G     +KS     L VV  GGY    ++R
Sbjct: 297 NIKAHGECVKFVKSFGIPML-VVGGGGYTPRNVSR 330

>Skud_7.79 Chr7 complement(146016..147374) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  134 bits (338), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 96/329 (29%), Positives = 164/329 (49%), Gaps = 28/329 (8%)

Query: 63  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKL 122
           Y  R+ YH     S++ Y   HP  P R+     +++  GL           I DL    
Sbjct: 24  YSPRVSYHFNPKVSHYHYGVKHPMKPFRLMLTDHLVSSYGL---------HKIMDLY--- 71

Query: 123 PIREATMNEILEVHSIEHFKYLEKTSNDNREQLLKET-EN---GDSVYFNNDSFQSAKLS 178
             R AT +E+LE HS ++  +L K S DN  +L + T EN   GD      + +    L 
Sbjct: 72  ETRSATRDELLEFHSEDYINFLSKVSPDNSNKLPRGTLENFNIGDDCPIFQNLYDYTTLY 131

Query: 179 CGGAIEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNILKNYPESV 237
            G +++A + ++    ++ +A+    G HH++  S  GFC  +++ ++  N+L+ +P   
Sbjct: 132 TGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP--- 186

Query: 238 RKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFN 297
            ++L +D D+HHG+G Q+AFY  D V  +S H++  G+++PGT  G   + G  KG+ F 
Sbjct: 187 -RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHFA 242

Query: 298 CNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYG 357
            N+    G + D  Y+  F+ +V P+   F+P L++   G D+   D +G  +++   +G
Sbjct: 243 LNVPLEDG-IDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSLGHDRLGCFNLNIKAHG 301

Query: 358 HMTHMLKSLARGNLCVVLEGGYNLDAIAR 386
                +KS     L VV  GGY    ++R
Sbjct: 302 ECVKFVKSFGLPML-VVGGGGYTPRNVSR 329

>TBLA0D02140 Chr4 complement(539873..541243) [1371 bp, 456 aa] {ON}
           Anc_8.153 YGL194C
          Length = 456

 Score =  134 bits (337), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 93/342 (27%), Positives = 176/342 (51%), Gaps = 31/342 (9%)

Query: 50  PKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTL 109
           P+ +Y   + G  Y  R+ YH     S + +   HP  P R+           ++ D  +
Sbjct: 16  PQFNY---EFGSTYAPRVSYHFNPKVSSYHFGVRHPMKPFRL-----------MLTDHLV 61

Query: 110 SGVDNIGDLMLKLPIREATMNEILEVHSIEHFKYLEKTSNDNREQLLKETEN----GDSV 165
           SG   +  +M     R+A+ +E+LE H+ ++  +L+K + DN  ++ + T +    GD  
Sbjct: 62  SGY-GLHKIMDLYETRKASDDELLEFHTDDYINFLKKVNPDNVNKMPRGTLDKFNIGDDC 120

Query: 166 YFNNDSFQSAKLSCGGAIEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAV 224
              ++ ++ + L  G +++A + ++ G  ++ +A+    G HH++  S  GFC  +++ +
Sbjct: 121 PIFHNLYEYSSLYTGASLDASRKLLNG--QSDIAINWSGGLHHAKKTSPSGFCYINDIVL 178

Query: 225 ATKNILKNYPESVRKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQ 284
           +  N+L+ +P    +VL +D D+HHG+G Q+AFY  D V  +S H++  G+++PGT  G 
Sbjct: 179 SILNLLRFHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT--GN 231

Query: 285 YDQTGEGKGEGFNCNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGD 344
           YD+TG   G+ F  N+    G + D  Y+  F+ ++ P+   + P ++I   G D+   D
Sbjct: 232 YDETGCSNGKHFALNVPLKDG-IDDDSYINLFKSIIDPLITSYNPTVIIQQCGADSLGHD 290

Query: 345 TIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAR 386
            +G  +++   +G     +KS     L VV  GGY    ++R
Sbjct: 291 RLGCFNLNIKAHGECVKFVKSFGIPML-VVGGGGYTPKNVSR 331

>Ecym_2346 Chr2 complement(678792..680249) [1458 bp, 485 aa] {ON}
           similar to Ashbya gossypii AFR172C
          Length = 485

 Score =  134 bits (336), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 91/337 (27%), Positives = 171/337 (50%), Gaps = 28/337 (8%)

Query: 55  VPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDN 114
           +P + G  Y  ++ YH     S + Y   HP  P      ++++  + L+   +  G+  
Sbjct: 52  LPFEFGSSYSPQVSYHFNPKVSQYHYGVRHPMKP------FRLMLTDHLV---SCYGLHK 102

Query: 115 IGDLMLKLPIREATMNEILEVHSIEHFKYLEKTSNDNREQL----LKETENGDSVYFNND 170
           I DL      REAT  E+LE H+ ++ ++L   + +N  +L    L++   GD       
Sbjct: 103 IMDLY---ETREATKEELLEFHAPDYIEFLSHVTPENLNKLPRGSLEKFNIGDDCPIFQG 159

Query: 171 SFQSAKLSCGGAIEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNI 229
            F  + L  G +++A + ++    ++ +A+    G HH++  +  GFC  +++ +A  ++
Sbjct: 160 MFDYSILYAGASLDAARKLINN--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLAIISL 217

Query: 230 LKNYPESVRKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTG 289
           L+ +P    +VL +D D+HHG+G Q+AFY  D V  +S H++  G+++PGT  G  D+ G
Sbjct: 218 LRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIG 270

Query: 290 EGKGEGFNCNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQC 349
             KG+ F+ N+    G + D  Y+  F+ ++ P+   ++P ++I   G D+   D +G  
Sbjct: 271 CSKGKKFSLNVPLQDG-IDDDSYINLFKSIIDPLVTSYKPTVIIQQCGADSLGHDRLGCF 329

Query: 350 HVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAR 386
           +++   +G     +KS     LCV   GGY    ++R
Sbjct: 330 NLNIKAHGECVKFVKSFGIPILCVG-GGGYTPRNVSR 365

>CAGL0A03322g Chr1 (338516..339868) [1353 bp, 450 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194c HOS2 or uniprot|P32561 Saccharomyces cerevisiae
           YNL330c RPD3
          Length = 450

 Score =  133 bits (334), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 94/332 (28%), Positives = 168/332 (50%), Gaps = 28/332 (8%)

Query: 60  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLM 119
           G  Y  R+ YH     S++ Y   HP  P R+           ++ D  +SG   +  +M
Sbjct: 21  GSNYAPRVSYHINPEVSHYHYGVRHPMKPFRL-----------MLTDHLVSGY-GLHKIM 68

Query: 120 LKLPIREATMNEILEVHSIEHFKYLEKTSNDNREQL----LKETENGDSVYFNNDSFQSA 175
                R+AT  E+ E HS ++  +L K + +N  +L    L++   GD      + FQ +
Sbjct: 69  DLYKTRKATAEEMEEFHSEDYVNFLSKVTPENLSKLPRGTLEKFNIGDDCPIFPNIFQYS 128

Query: 176 KLSCGGAIEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNILKNYP 234
            L  G +++A + ++    ++ +A+    G HH++  S  GFC  +++ +A  N+L+ +P
Sbjct: 129 SLYTGASLDASRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYINDIVLAILNLLRYHP 186

Query: 235 ESVRKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGE 294
               +VL +D D+HHG+G Q+AFY  D V  IS H++  G+++PGT  G+ D+TG   G+
Sbjct: 187 ----RVLYIDIDLHHGDGVQEAFYTTDRVYTISFHKYN-GEFFPGT--GKNDETGCADGK 239

Query: 295 GFNCNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPS 354
            F  N+    G + D  Y+  F+ ++ P+   F+P +++   G D+   D +G  +++  
Sbjct: 240 HFAMNVPLEDG-IDDDSYINLFKSIIDPLITTFKPTVILQQCGADSLGHDRLGCFNLNIK 298

Query: 355 CYGHMTHMLKSLARGNLCVVLEGGYNLDAIAR 386
            +G     ++S     L VV  GGY    ++R
Sbjct: 299 AHGECVKFVRSFGIPML-VVGGGGYTPRNVSR 329

>Kpol_1038.11 s1038 complement(25267..26568) [1302 bp, 433 aa] {ON}
           complement(25267..26568) [1302 nt, 434 aa]
          Length = 433

 Score =  132 bits (333), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 157/326 (48%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKLPIR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 67

Query: 126 EATMNEILEVHSIEHFKYLEKTSNDNREQLLKETEN---GDSVYFNNDSFQSAKLSCGGA 182
            AT  E+ + H+ E+  +L + + DN +   KE+     GD     +  ++   +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVL 241
           +E    +  G+    +A+    G HH++   A GFC  +++ +    +L+ +P    +VL
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 ILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNIT 301
            +D D+HHG+G ++AFY  D V+  S H++  G+++PGT  G+   TG GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKNYAVNVP 237

Query: 302 WPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 361
              G + DA Y   FE V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LRDG-IDDATYRAVFESVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 362 MLKSLARGNLCVVLEGGYNLDAIARS 387
            +KS     L VV  GGY +  +AR+
Sbjct: 297 FVKSFGI-PLMVVGGGGYTMRNVART 321

>KLTH0F19668g Chr6 (1595709..1597007) [1299 bp, 432 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 432

 Score =  132 bits (332), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 92/326 (28%), Positives = 158/326 (48%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKLPIR 125
           R+ Y      S + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDSDVSNYSYGASHPMKPARIRMAHSLVMNYGLYKK------------MEIYRAK 67

Query: 126 EATMNEILEVHSIEHFKYLEKTSNDNREQLLKETEN---GDSVYFNNDSFQSAKLSCGGA 182
            AT  E+ + HS E+  +L + + DN E   KE+     GD     +  ++   +S GG+
Sbjct: 68  PATKQEMCQFHSDEYIDFLSRVTPDNLEMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVL 241
           +E    +  G+    +A+    G HH++   A GFC  +++ +    +L+ +P    +VL
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 ILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNIT 301
            +D D+HHG+G ++AFY  D V+  S H++  G+++PGT  G+   TG GKG+ ++ N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVP 237

Query: 302 WPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 361
              G + D  Y   FE V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LRDG-IDDTTYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 362 MLKSLARGNLCVVLEGGYNLDAIARS 387
            +KS     L VV  GGY +  +AR+
Sbjct: 297 YVKSFGIPML-VVGGGGYTMRNVART 321

>Smik_7.79 Chr7 complement(134747..136105) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  132 bits (333), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 95/330 (28%), Positives = 164/330 (49%), Gaps = 28/330 (8%)

Query: 62  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLK 121
            Y  R+ YH     S++ Y   HP  P R+     +++  GL           I DL   
Sbjct: 23  AYSPRVSYHFNSKVSHYHYGVKHPMKPFRLMLTDHLVSSYGL---------HKIMDLY-- 71

Query: 122 LPIREATMNEILEVHSIEHFKYLEKTSNDNREQLLKET-EN---GDSVYFNNDSFQSAKL 177
              R AT +E+L+ HS ++  +L K S DN  +L + T EN   GD      + +    L
Sbjct: 72  -ETRSATRDELLQFHSEDYVNFLSKVSPDNANKLPRGTLENFNIGDDCPIFQNLYDYTTL 130

Query: 178 SCGGAIEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNILKNYPES 236
             G +++A + ++    ++ +A+    G HH++  S  GFC  +++ ++  N+L+ +P  
Sbjct: 131 YTGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP-- 186

Query: 237 VRKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGF 296
             ++L +D D+HHG+G Q+AFY  D V  +S H++  G+++PGT  G   + G  KG+ F
Sbjct: 187 --RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHF 241

Query: 297 NCNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCY 356
             N+    G + D  Y+  F+ +V P+   F+P L++   G D+   D +G  +++   +
Sbjct: 242 ALNVPLEDG-IDDDSYINLFKSIVDPLIITFKPTLIVQQCGADSLGHDRLGCFNLNIKAH 300

Query: 357 GHMTHMLKSLARGNLCVVLEGGYNLDAIAR 386
           G     +KS     L VV  GGY    ++R
Sbjct: 301 GECVKFVKSFGLPML-VVGGGGYTPRNVSR 329

>KLLA0F09119g Chr6 (848467..849825) [1359 bp, 452 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 452

 Score =  132 bits (331), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 93/332 (28%), Positives = 163/332 (49%), Gaps = 28/332 (8%)

Query: 60  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLM 119
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL           + DL 
Sbjct: 24  GTSYSPRVSYHFNSKVSQYHYGVKHPMKPFRLMLTDHLVSAYGL---------HKVMDLY 74

Query: 120 LKLPIREATMNEILEVHSIEHFKYLEKTSNDNREQL----LKETENGDSVYFNNDSFQSA 175
                R AT +E+ + HS ++  +L K + D   +L    L++   GD        F  A
Sbjct: 75  ---ETRSATKDELTKFHSEDYVNFLAKVTPDTLNKLPRGSLEKFNIGDDCPIFQGMFDYA 131

Query: 176 KLSCGGAIEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNILKNYP 234
            L  G +++A + ++ G  ++ +A+    G HH++  +  GFC  +++ +A  N+L+ +P
Sbjct: 132 ALYAGASLDASRKLLNG--QSEIAINWSGGLHHAKKNNPSGFCYVNDIVLAIVNLLRYHP 189

Query: 235 ESVRKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGE 294
               +VL +D D+HHG+G Q+AFY  D V  +S H++  G+++PGT  G  D+ G  +G+
Sbjct: 190 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIGCSRGK 242

Query: 295 GFNCNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPS 354
            F  N+    G + D  Y+  F+ ++ P+   F+P ++I   G D+   D +G  +++  
Sbjct: 243 HFALNVPLQDG-IEDDSYINLFKSIIDPVITSFRPSVIIQQCGADSLGHDRLGCFNLNIK 301

Query: 355 CYGHMTHMLKSLARGNLCVVLEGGYNLDAIAR 386
            +G     +KS     L VV  GGY    ++R
Sbjct: 302 AHGECVRFVKSFGVPML-VVGGGGYTPRNVSR 332

>AFR172C Chr6 complement(754470..755819) [1350 bp, 449 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL194C
           (HOS2)
          Length = 449

 Score =  132 bits (331), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 89/332 (26%), Positives = 163/332 (49%), Gaps = 28/332 (8%)

Query: 60  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLM 119
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL              +M
Sbjct: 21  GASYTPRVSYHYNSRVSQYHYGVRHPMKPFRLMLTDHLVSRYGL------------HKVM 68

Query: 120 LKLPIREATMNEILEVHSIEHFKYLEKTSNDNREQL----LKETENGDSVYFNNDSFQSA 175
                R AT  E+L  H+ ++  +L   + +N  +L    L++   GD        F+ +
Sbjct: 69  DLYETRAATKEEVLAFHAQDYVDFLSHVAPENLNKLPRGSLEKFNIGDDCPIFQGLFEYS 128

Query: 176 KLSCGGAIEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNILKNYP 234
            L  G +++A + ++ G  ++ +A+    G HH++  +  GFC  +++ +A  N+L+ +P
Sbjct: 129 MLYAGASLDASRKLING--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLAILNLLRYHP 186

Query: 235 ESVRKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGE 294
               +VL +D D+HHG+G Q+AFY  D V  +S H++  G+++PGT  G  D+ G  +G+
Sbjct: 187 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GDLDEIGCSRGK 239

Query: 295 GFNCNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPS 354
            F+ N+    G + D  Y+  F+ ++ P+   ++P ++I   G D+   D +G  +++  
Sbjct: 240 HFSLNVPLNDG-IDDDSYINLFKSIIDPLVTSYKPTVIIQQCGADSLGHDRLGCFNLNIR 298

Query: 355 CYGHMTHMLKSLARGNLCVVLEGGYNLDAIAR 386
            +G     +KS     LCV   GGY    ++R
Sbjct: 299 AHGECVKFVKSFGIPMLCVG-GGGYTPRNVSR 329

>Kwal_55.20790 s55 complement(559958..561307) [1350 bp, 449 aa] {ON}
           YGL194C (HOS2) - (putative) histone deacetylase [contig
           139] FULL
          Length = 449

 Score =  131 bits (330), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 93/332 (28%), Positives = 164/332 (49%), Gaps = 28/332 (8%)

Query: 60  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLM 119
           G  +   + YH     S F Y   HP  P R+     +++  GL           I DL 
Sbjct: 21  GASHQPAVSYHFNDDVSQFHYGVKHPMKPFRLMLTDHLVSSYGL---------HKIMDLY 71

Query: 120 LKLPIREATMNEILEVHSIEHFKYLEKTSNDNREQL----LKETENGDSVYFNNDSFQSA 175
                R AT  E+ E HS ++ ++L + S DN  +L    L++   GD        +Q +
Sbjct: 72  ---ETRPATREELCEFHSEDYVEFLARVSPDNLAKLPRGSLEKFNIGDDCPIFQGLYQYS 128

Query: 176 KLSCGGAIEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNILKNYP 234
            L  G +++A + ++ G  ++ +A+    G HH++  +  GFC  +++ ++  N+L+ +P
Sbjct: 129 TLYAGASLDATRKLING--QSEIAINWSGGLHHAKKSNPSGFCYVNDIVLSVLNLLRYHP 186

Query: 235 ESVRKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGE 294
               +VL +D D+HHG+G Q+AFY  D V  +S H++  G+++PGT  G  D+ G  +G+
Sbjct: 187 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTVSFHKYN-GEFFPGT--GNLDEIGCSRGK 239

Query: 295 GFNCNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPS 354
            F  N+    G + D  Y+  F+ ++ P+   F+P ++I   G D+   D +G  +++  
Sbjct: 240 HFALNVPLDDG-IDDDSYINLFKSIIDPLITSFKPTVIIQQCGADSLGHDRLGCFNLNVK 298

Query: 355 CYGHMTHMLKSLARGNLCVVLEGGYNLDAIAR 386
            +G     +KS     L VV  GGY    ++R
Sbjct: 299 AHGECVKYVKSFGLPML-VVGGGGYTPRNVSR 329

>Kwal_55.22142 s55 (1130691..1131989) [1299 bp, 432 aa] {ON} YNL330C
           (RPD3) - histone deacetylase [contig 124] FULL
          Length = 432

 Score =  131 bits (329), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 91/326 (27%), Positives = 158/326 (48%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKLPIR 125
           R+ Y      S + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDSDVSNYSYGASHPMKPARIRMAHSLVMNYGLYKK------------MEIYRAK 67

Query: 126 EATMNEILEVHSIEHFKYLEKTSNDNREQLLKETEN---GDSVYFNNDSFQSAKLSCGGA 182
            AT  E+ + H+ E+  +L + + DN E   KE+     GD     +  ++   +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVL 241
           +E    +  G+    +A+    G HH++   A GFC  +++ +    +L+ +P    +VL
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 ILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNIT 301
            +D D+HHG+G ++AFY  D V+  S H++  G+++PGT  G+   TG GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 237

Query: 302 WPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 361
              G + D+ Y   FE V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LRDG-IDDSTYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 362 MLKSLARGNLCVVLEGGYNLDAIARS 387
            +KS     L VV  GGY +  +AR+
Sbjct: 297 YVKSFGIPML-VVGGGGYTMRNVART 321

>KLLA0E01981g Chr5 complement(186177..187475) [1299 bp, 432 aa] {ON}
           highly similar to uniprot|P32561 Saccharomyces
           cerevisiae YNL330C RPD3 Histone deacetylase regulates
           transcription and silencing
          Length = 432

 Score =  131 bits (329), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 91/334 (27%), Positives = 160/334 (47%), Gaps = 28/334 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKLPIR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 126 EATMNEILEVHSIEHFKYLEKTSNDNREQLLKETEN---GDSVYFNNDSFQSAKLSCGGA 182
            AT  E+ + H+ E+  +L + + DN +   KE+     GD     +  ++   +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVL 241
           +E    +  G+    +A+    G HH++   A GFC  +++ +    +L+ +P    +VL
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 ILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNIT 301
            +D D+HHG+G ++AFY  D V+  S H++  G+++PGT  G+   TG GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 237

Query: 302 WPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 361
              G + DA Y   FE V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LRDG-IDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMKGHANCVN 296

Query: 362 MLKSLARGNLCVVLEGGYNLDAIARSALSVSKIL 395
            +KS     L +V  GGY +  +AR+    + IL
Sbjct: 297 YMKSFGV-PLMIVGGGGYTMRNVARTWAFETGIL 329

>Kpol_246.5 s246 (11759..13120) [1362 bp, 453 aa] {ON}
           (11759..13120) [1362 nt, 454 aa]
          Length = 453

 Score =  131 bits (330), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 91/332 (27%), Positives = 167/332 (50%), Gaps = 28/332 (8%)

Query: 60  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLM 119
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL           I DL 
Sbjct: 25  GSAYCPRVSYHFNPKVSNYHYGVKHPMKPFRLMLTDHLVSSYGL---------HKIMDLY 75

Query: 120 LKLPIREATMNEILEVHSIEHFKYLEKTSNDNREQL----LKETENGDSVYFNNDSFQSA 175
                R AT +E+L+ HS ++  +L+K + +N  ++    L++   GD      + +  +
Sbjct: 76  ---ETRSATKDELLDFHSDDYVSFLQKVTPENLSKMPRGTLEKYNIGDDCPIFQNLYDYS 132

Query: 176 KLSCGGAIEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNILKNYP 234
            L  G +++A + ++    ++ +A+    G HH++  +  GFC  +++ +A  N+L+ +P
Sbjct: 133 ALYAGASLDASRKLINN--QSDIAINWSGGLHHAKKTNPSGFCYVNDIVLAILNLLRYHP 190

Query: 235 ESVRKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGE 294
               +VL +D D+HHG+G Q+AFY  D V  IS H++  G+++PGT  G YD+ G  +G+
Sbjct: 191 ----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKYN-GEFFPGT--GNYDEIGCAQGK 243

Query: 295 GFNCNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPS 354
            F  N+    G + D  Y+  F+ ++ P+   ++P ++I   G D+   D +G  +++  
Sbjct: 244 HFAMNVPLEDG-IDDDSYINLFKSIIDPLITSYKPTVIIQQCGADSLGHDRLGCFNLNIK 302

Query: 355 CYGHMTHMLKSLARGNLCVVLEGGYNLDAIAR 386
            +G     ++S     L VV  GGY    ++R
Sbjct: 303 AHGECVKFIRSFGIPML-VVGGGGYTPRNVSR 333

>YGL194C Chr7 complement(140368..141726) [1359 bp, 452 aa] {ON}
           HOS2Histone deacetylase required for gene activation via
           specific deacetylation of lysines in H3 and H4 histone
           tails; subunit of the Set3 complex, a meiotic-specific
           repressor of sporulation specific genes that contains
           deacetylase activity
          Length = 452

 Score =  131 bits (330), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 94/330 (28%), Positives = 164/330 (49%), Gaps = 28/330 (8%)

Query: 62  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLK 121
            Y  R+ YH     S++ Y   HP  P R+     +++  GL           I DL   
Sbjct: 23  AYSPRVSYHFNSKVSHYHYGVKHPMKPFRLMLTDHLVSSYGL---------HKIMDLY-- 71

Query: 122 LPIREATMNEILEVHSIEHFKYLEKTSNDNREQLLKET-EN---GDSVYFNNDSFQSAKL 177
              R AT +E+L+ HS ++  +L K S +N  +L + T EN   GD      + +    L
Sbjct: 72  -ETRSATRDELLQFHSEDYVNFLSKVSPENANKLPRGTLENFNIGDDCPIFQNLYDYTTL 130

Query: 178 SCGGAIEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNILKNYPES 236
             G +++A + ++    ++ +A+    G HH++  S  GFC  +++ ++  N+L+ +P  
Sbjct: 131 YTGASLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP-- 186

Query: 237 VRKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGF 296
             ++L +D D+HHG+G Q+AFY  D V  +S H++  G+++PGT  G   + G  KG+ F
Sbjct: 187 --RILYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHF 241

Query: 297 NCNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCY 356
             N+    G + D  Y+  F+ +V P+   F+P L++   G D+   D +G  +++   +
Sbjct: 242 ALNVPLEDG-IDDDSYINLFKSIVDPLIMTFKPTLIVQQCGADSLGHDRLGCFNLNIKAH 300

Query: 357 GHMTHMLKSLARGNLCVVLEGGYNLDAIAR 386
           G     +KS     L VV  GGY    ++R
Sbjct: 301 GECVKFVKSFGLPML-VVGGGGYTPRNVSR 329

>Suva_14.11 Chr14 complement(13144..14445) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  131 bits (329), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 158/326 (48%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKLPIR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 126 EATMNEILEVHSIEHFKYLEKTSNDNREQLLKETEN---GDSVYFNNDSFQSAKLSCGGA 182
            AT  E+ + H+ E+  +L + + DN E   +E+     GD     +  ++   +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVL 241
           +E    +  G+    +AV    G HH++   A GFC  +++ +    +L+ +P    +VL
Sbjct: 128 MEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 ILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNIT 301
            +D D+HHG+G ++AFY  D V+  S H++  G+++PGT  G+    G GKG+ ++ N+ 
Sbjct: 182 YVDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDVGVGKGKNYSVNVP 237

Query: 302 WPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 361
              G + DA Y   FE VV  +   +QP  V++ +G D+  GD +G  ++S   + +  +
Sbjct: 238 LRDG-IDDATYRAVFEPVVKRIMDWYQPSAVVLQTGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 362 MLKSLARGNLCVVLEGGYNLDAIARS 387
            +KS     + VV  GGY +  +AR+
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>NCAS0C04320 Chr3 (887622..888926) [1305 bp, 434 aa] {ON} Anc_3.8
          Length = 434

 Score =  131 bits (329), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 157/326 (48%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKLPIR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 21  RVAYFYDADVGNYAYGSGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 68

Query: 126 EATMNEILEVHSIEHFKYLEKTSNDNREQLLKETEN---GDSVYFNNDSFQSAKLSCGGA 182
            AT  E+ + H+ E+  +L + + DN E   KE+     GD     +  ++   +S GG+
Sbjct: 69  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 128

Query: 183 IEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVL 241
           +E    +  G+    +A+    G HH++   A GFC  +++ +    +L+ +P    +VL
Sbjct: 129 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRFHP----RVL 182

Query: 242 ILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNIT 301
            +D D+HHG+G ++AFY  D V+  S H++  G+++PGT  G+   TG GKG+ +  N+ 
Sbjct: 183 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 238

Query: 302 WPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 361
              G + DA Y   FE V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 239 LRDG-IDDATYRNVFEPVIKRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 297

Query: 362 MLKSLARGNLCVVLEGGYNLDAIARS 387
            +KS     + VV  GGY +  +AR+
Sbjct: 298 YVKSFGI-PMMVVGGGGYTMRNVART 322

>Ecym_2010 Chr2 complement(12699..14000) [1302 bp, 433 aa] {ON}
           similar to Ashbya gossypii AGR395W
          Length = 433

 Score =  130 bits (328), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 89/326 (27%), Positives = 158/326 (48%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKLPIR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 126 EATMNEILEVHSIEHFKYLEKTSNDNREQLLKETEN---GDSVYFNNDSFQSAKLSCGGA 182
            AT  E+ + H+ E+  +L + + DN +   KE+     GD     +  ++   +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVL 241
           +E    +  G+    +A+    G HH++   A GFC  +++ +    +L+ +P    +VL
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 ILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNIT 301
            +D D+HHG+G ++AFY  D V+  S H++  G+++PGT  G+   TG GKG+ ++ N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVP 237

Query: 302 WPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 361
              G + DA Y   FE V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LRDG-IDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 362 MLKSLARGNLCVVLEGGYNLDAIARS 387
            +KS     + VV  GGY +  +AR+
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>AGR395W Chr7 (1455659..1456960) [1302 bp, 433 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL330C (RPD3)
          Length = 433

 Score =  130 bits (328), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 89/326 (27%), Positives = 158/326 (48%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKLPIR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 126 EATMNEILEVHSIEHFKYLEKTSNDNREQLLKETEN---GDSVYFNNDSFQSAKLSCGGA 182
            AT  E+ + H+ E+  +L + + DN +   KE+     GD     +  ++   +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVL 241
           +E    +  G+    +A+    G HH++   A GFC  +++ +    +L+ +P    +VL
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 ILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNIT 301
            +D D+HHG+G ++AFY  D V+  S H++  G+++PGT  G+   TG GKG+ ++ N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVP 237

Query: 302 WPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 361
              G + DA Y   FE V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LRDG-IDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 362 MLKSLARGNLCVVLEGGYNLDAIARS 387
            +KS     + VV  GGY +  +AR+
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>NCAS0B05480 Chr2 complement(1033624..1034979) [1356 bp, 451 aa]
           {ON} Anc_8.153
          Length = 451

 Score =  131 bits (329), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 94/344 (27%), Positives = 171/344 (49%), Gaps = 31/344 (9%)

Query: 48  QAPKIHYVPLKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDP 107
           + P+  Y   + G  Y  R+ YH     S + Y   HP  P R+     +++  GL    
Sbjct: 14  EQPQFEY---EFGSSYTPRVSYHFNPKVSNYHYGVRHPMKPFRLMLTDHLVSSYGL---- 66

Query: 108 TLSGVDNIGDLMLKLPIREATMNEILEVHSIEHFKYLEKTSNDNREQL----LKETENGD 163
                  I DL      REAT  E+ + HS ++ ++L K + +N  ++    L++   GD
Sbjct: 67  -----HKIMDLY---ETREATREEMSQFHSQDYIEFLSKVTPENLSKMPRGTLEKFNIGD 118

Query: 164 SVYFNNDSFQSAKLSCGGAIEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNV 222
                 + +  + L  G +++A + ++    ++ +A+    G HH++  +  GFC  +++
Sbjct: 119 DCPIFQNIYDYSTLYTGASLDASRKLIND--QSDIAINWSGGLHHAKKNNPSGFCYVNDI 176

Query: 223 AVATKNILKNYPESVRKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQ 282
            ++  N+L+ +P    +VL +D D+HHG+G Q+AFY  D V  IS H+F  G+++PGT  
Sbjct: 177 VLSILNLLRYHP----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKFN-GEFFPGT-- 229

Query: 283 GQYDQTGEGKGEGFNCNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAAD 342
           G +D+ G  KG+ F  N+    G + D  Y+  F+ ++ P+   ++P ++I   G D+  
Sbjct: 230 GDFDEIGCAKGKHFAMNVPLEDG-IDDDSYINLFKSIIDPLITAYKPTVIIQQCGADSLG 288

Query: 343 GDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAR 386
            D +G  +++   +G     +KS     L VV  GGY    ++R
Sbjct: 289 HDRLGCFNLNIKAHGECVKFVKSFGIPML-VVGGGGYTPRNVSR 331

>TBLA0I00560 Chr9 (100393..101694) [1302 bp, 433 aa] {ON} Anc_3.8
           YNL330C
          Length = 433

 Score =  130 bits (327), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 88/326 (26%), Positives = 157/326 (48%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKLPIR 125
           R+ Y        + Y   HP  P RI   + ++   GL  +            M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKN------------MEIYRAK 67

Query: 126 EATMNEILEVHSIEHFKYLEKTSNDNREQLLKETEN---GDSVYFNNDSFQSAKLSCGGA 182
            AT  E+ + H+ E+  +L + + DN +   KE+     GD     +  ++   +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVL 241
           +E    +  G+    +A+    G HH++   A GFC  +++ +    +L+ +P    +VL
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCFLNDIVLGIIELLRYHP----RVL 181

Query: 242 ILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNIT 301
            +D D+HHG+G ++AFY  D V+  S H++  G+++PGT  G+   TG G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGNGKNYAVNVP 237

Query: 302 WPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 361
              G + DA Y   FE V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LRDG-IDDATYRSVFEPVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 362 MLKSLARGNLCVVLEGGYNLDAIARS 387
            +KS     + VV  GGY +  +AR+
Sbjct: 297 FVKSFNI-PMMVVGGGGYTMRNVART 321

>ZYRO0C03498g Chr3 (278064..279365) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 433

 Score =  130 bits (327), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 89/326 (27%), Positives = 157/326 (48%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKLPIR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYNYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 126 EATMNEILEVHSIEHFKYLEKTSNDNREQLLKETEN---GDSVYFNNDSFQSAKLSCGGA 182
            AT  E+ + H+ E+  +L + + DN +   KE+     GD     +  ++   +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVL 241
           +E    +  G+    +A+    G HH++   A GFC  +++ +    +L+ +P    +VL
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKTEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 ILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNIT 301
            +D D+HHG+G ++AFY  D V+  S H++  G+++PGT  G+   TG GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYAVNVP 237

Query: 302 WPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 361
              G + DA Y   FE VV  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LRDG-IDDATYKSVFEPVVSRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSIRGHANCVN 296

Query: 362 MLKSLARGNLCVVLEGGYNLDAIARS 387
            +KS     + +V  GGY +  +AR+
Sbjct: 297 FVKSFGL-PMMIVGGGGYTMRNVART 321

>SAKL0C13706g Chr3 (1207800..1209101) [1302 bp, 433 aa] {ON} highly
           similar to uniprot|P32561 Saccharomyces cerevisiae
           YNL330C RPD3 Histone deacetylase regulates transcription
           and silencing
          Length = 433

 Score =  130 bits (327), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 89/326 (27%), Positives = 157/326 (48%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKLPIR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 126 EATMNEILEVHSIEHFKYLEKTSNDNREQLLKETEN---GDSVYFNNDSFQSAKLSCGGA 182
            AT  E+ + H+ E+  +L + + DN     KE+     GD     +  ++   +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLNMFQKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVL 241
           +E    +  G+    +A+    G HH++   A GFC  +++ +    +L+ +P    +VL
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 ILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNIT 301
            +D D+HHG+G ++AFY  D V+  S H++  G+++PGT  G+   TG GKG+ ++ N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDTGVGKGKYYSVNVP 237

Query: 302 WPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 361
              G + DA Y   FE V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LRDG-IDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMKGHANCVN 296

Query: 362 MLKSLARGNLCVVLEGGYNLDAIARS 387
            +KS     + VV  GGY +  +AR+
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>KAFR0C02920 Chr3 complement(584668..586029) [1362 bp, 453 aa] {ON}
           Anc_8.153 YGL194C
          Length = 453

 Score =  130 bits (328), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 96/333 (28%), Positives = 162/333 (48%), Gaps = 30/333 (9%)

Query: 60  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLM 119
           G  Y  R+ YH     S + Y   HP  P R+     +++  GL           I DL 
Sbjct: 23  GSSYTPRVSYHFNPKVSNYHYGVNHPMKPFRLMLTDHLVSSYGL---------HKIMDLY 73

Query: 120 LKLPIREATMNEILEVHSIEHFKYLEKTSNDN-----REQLLKETENGDSVYFNNDSFQS 174
                REAT  E+ + HS ++  +LEK S D      R  L K     D   F N  +  
Sbjct: 74  ---ETREATKEEMSQFHSSDYLDFLEKISPDTLNKIPRGTLEKFNIGSDCPIFEN-IYDY 129

Query: 175 AKLSCGGAIEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNILKNY 233
           + L  G +++A + ++ G  ++ +A+    G HH++  +  GFC  +++ ++  N+L+ +
Sbjct: 130 STLYTGASLDASRKLING--QSEIAINWSGGLHHAKKNNPSGFCYINDIVLSILNLLRYH 187

Query: 234 PESVRKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKG 293
           P    +VL +D D+HHG+G Q+AFY  D V  IS H++  G+++PGT  G YD+ G   G
Sbjct: 188 P----RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKYN-GEFFPGT--GNYDEIGCSGG 240

Query: 294 EGFNCNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSP 353
           + F  N+    G + D  Y+  F+ ++ P+   +QP ++I   G D+   D +G  +++ 
Sbjct: 241 KHFAMNVPLNDG-IDDDSYIKLFKSIIDPLITSYQPTVIIQQCGADSLGHDRLGCFNLNI 299

Query: 354 SCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAR 386
             +G     + S     + VV  GGY    ++R
Sbjct: 300 KAHGECVKFVSSFGIP-MLVVGGGGYTPRNVSR 331

>Skud_14.11 Chr14 complement(11451..12752) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  130 bits (326), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 89/326 (27%), Positives = 157/326 (48%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKLPIR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 126 EATMNEILEVHSIEHFKYLEKTSNDNREQLLKETEN---GDSVYFNNDSFQSAKLSCGGA 182
            AT  E+ + H+ E+  +L + + DN E   +E+     GD     +  ++   +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVL 241
           +E    +  G+    +AV    G HH++   A GFC  +++ +    +L+ +P    +VL
Sbjct: 128 MEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 ILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNIT 301
            +D D+HHG+G ++AFY+ D V+  S H++  G+++PGT  G+    G G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYSTDRVMTCSFHKY--GEFFPGT--GELRDIGVGTGKNYAVNVP 237

Query: 302 WPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 361
              G + DA Y   FE V+  +   +QP  V++  G D+  GD +G  ++S   +G+  +
Sbjct: 238 LRDG-IDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHGNCVN 296

Query: 362 MLKSLARGNLCVVLEGGYNLDAIARS 387
            +KS     + VV  GGY +  +AR+
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>NDAI0G03740 Chr7 complement(900866..902167) [1302 bp, 433 aa] {ON}
           Anc_3.8
          Length = 433

 Score =  129 bits (325), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 157/326 (48%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKLPIR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGSGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 126 EATMNEILEVHSIEHFKYLEKTSNDNREQLLKETEN---GDSVYFNNDSFQSAKLSCGGA 182
            AT  E+ + H+ E+  +L + + DN E   KE+     GD     +  ++   +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLELFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVL 241
           +E    +  G+    +A+    G HH++   A GFC  +++ +    +L+ +P    +VL
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 ILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNIT 301
            +D D+HHG+G ++AFY+ D V+  S H++  G+++PGT  G+    G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYSTDRVMTCSFHKY--GEFFPGT--GELRDVGVGKGKYYAVNVP 237

Query: 302 WPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 361
              G + DA Y   FE VV  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LRDG-IDDATYRNVFEPVVKRIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 362 MLKSLARGNLCVVLEGGYNLDAIARS 387
            +KS     + VV  GGY +  +AR+
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>NDAI0B02710 Chr2 (674610..675971) [1362 bp, 453 aa] {ON} Anc_8.153
          Length = 453

 Score =  130 bits (326), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 91/329 (27%), Positives = 165/329 (50%), Gaps = 28/329 (8%)

Query: 63  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKL 122
           Y  R+ YH     S + Y   HP  P R+     +++  GL           I DL    
Sbjct: 28  YTPRVSYHFNPKVSNYHYGVKHPMKPFRLMLTDHLVSSYGL---------HKIMDLY--- 75

Query: 123 PIREATMNEILEVHSIEHFKYLEKTSNDNREQL----LKETENGDSVYFNNDSFQSAKLS 178
             R AT  E+++ HS ++  +L K + +N  ++    L++   GD      + +  + L 
Sbjct: 76  ETRPATNEEMVQFHSEDYLDFLSKVTPENLSKMPRGTLEKFNIGDDCPIFQNLYDYSTLY 135

Query: 179 CGGAIEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNILKNYPESV 237
            G +++A + ++    ++ +A+    G HH++  +  GFC  +++ ++  N+L+ +P   
Sbjct: 136 TGASLDATRKLIND--QSDIAINWSGGLHHAKKNNPSGFCYINDIVLSIVNLLRYHP--- 190

Query: 238 RKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFN 297
            +VL +D D+HHG+G Q+AFY  D V  IS H+F  G+++PGT  G YD+TG  KG+ F 
Sbjct: 191 -RVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKFN-GEFFPGT--GDYDETGCAKGKHFA 246

Query: 298 CNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYG 357
            N+    G + D  Y+  F+ ++ P+   ++P +++   G D+   D +G  +++   +G
Sbjct: 247 MNVPLEDG-IDDDSYINLFKSIMDPLITSYKPTVIVQQCGADSLGHDRLGCFNLNIKGHG 305

Query: 358 HMTHMLKSLARGNLCVVLEGGYNLDAIAR 386
                +KS     L VV  GGY    ++R
Sbjct: 306 ECVKFIKSFGIPML-VVGGGGYTPRNVSR 333

>KNAG0A01160 Chr1 complement(7229..8530) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  129 bits (325), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 156/326 (47%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKLPIR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 126 EATMNEILEVHSIEHFKYLEKTSNDNREQLLKETEN---GDSVYFNNDSFQSAKLSCGGA 182
            AT  E+ + H+ E+  +L + + DN E   KE+     GD     +  ++   +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVL 241
           +E+   +  G+    +A+    G HH++   A GFC  +++ +    +L+ +P    +VL
Sbjct: 128 MESAARLNRGKCD--IAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 ILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNIT 301
            +D D+HHG+G ++AFY  D V+  S H++  G+++PGT  G+    G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGQNYAVNVP 237

Query: 302 WPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 361
              G + DA Y   FE VV  +   +QP  V++  G D+  GD +G  ++S   +    +
Sbjct: 238 LRDG-IDDATYRSVFEPVVGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHASCVN 296

Query: 362 MLKSLARGNLCVVLEGGYNLDAIARS 387
            +KS     + VV  GGY +  +AR+
Sbjct: 297 YVKSFNI-PMMVVGGGGYTMRNVART 321

>TPHA0A00300 Chr1 complement(40868..42169) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  129 bits (323), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 89/326 (27%), Positives = 156/326 (47%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKLPIR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLVMNYGLYKK------------MEIYRAK 67

Query: 126 EATMNEILEVHSIEHFKYLEKTSNDNREQLLKETEN---GDSVYFNNDSFQSAKLSCGGA 182
            AT  E+ + H+ E+  +L + + DN +   KE+     GD     +  F+   +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLFEYCSISGGGS 127

Query: 183 IEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVL 241
           +E    +  G+    +A+    G HH++   A GFC  +++ +    +L+ +P    +VL
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 ILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNIT 301
            +D D+HHG+G ++AFY  D V+  S H++  G+++PGT  G+    G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDVGIGKGKNYAVNVP 237

Query: 302 WPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 361
              G + DA Y   FE V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LRDG-MDDATYRSVFESVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 362 MLKSLARGNLCVVLEGGYNLDAIARS 387
            +KS     + VV  GGY +  +AR+
Sbjct: 297 FVKSFNI-PMMVVGGGGYTMRNVART 321

>CAGL0B01441g Chr2 complement(130216..131517) [1302 bp, 433 aa] {ON}
           highly similar to uniprot|P32561 Saccharomyces
           cerevisiae YNL330c RPD3 histone deacetylase B or
           uniprot|P53096 Saccharomyces cerevisiae YGL194c HOS2
          Length = 433

 Score =  129 bits (323), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 89/326 (27%), Positives = 156/326 (47%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKLPIR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 126 EATMNEILEVHSIEHFKYLEKTSNDNREQLLKETEN---GDSVYFNNDSFQSAKLSCGGA 182
            AT  E+ + H+ E+  +L + + DN E   KE+     GD     +  ++   +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVL 241
           +E    +  G+    +A+    G HH++   A GFC  +++ +    +L+ +P    +VL
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 ILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNIT 301
            +D D+HHG+G ++AFY  D V+  S H++  G+++PGT  G+    G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGKYYAVNVP 237

Query: 302 WPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 361
              G + DA Y   FE V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LRDG-IDDATYRSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 362 MLKSLARGNLCVVLEGGYNLDAIARS 387
            +KS     + VV  GGY +  +AR+
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>Suva_7.71 Chr7 complement(135837..137195) [1359 bp, 452 aa] {ON}
           YGL194C (REAL)
          Length = 452

 Score =  129 bits (324), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 93/329 (28%), Positives = 162/329 (49%), Gaps = 28/329 (8%)

Query: 63  YDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKL 122
           Y  R+ YH     S++ Y   HP  P R+     +++  GL           I DL    
Sbjct: 24  YSPRVSYHFNPKASHYHYGVKHPMKPIRLMLTDHLVSSYGL---------HKIMDLY--- 71

Query: 123 PIREATMNEILEVHSIEHFKYLEKTSNDNREQLLKET-EN---GDSVYFNNDSFQSAKLS 178
             R AT +E+ E H+ ++  +L K S +N  +L + T EN   GD      + +    L 
Sbjct: 72  ETRSATKDELFEFHTEDYVNFLSKVSPENVNKLPRGTLENFNIGDDCPIFQNLYDYTTLY 131

Query: 179 CGGAIEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNILKNYPESV 237
            G  ++A + ++    ++ +A+    G HH++  S  GFC  +++ ++  N+L+ +P   
Sbjct: 132 TGATLDATRKLINN--QSDIAINWSGGLHHAKKNSPSGFCYVNDIVLSILNLLRYHP--- 186

Query: 238 RKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFN 297
            +VL +D D+HHG+G Q+AFY  D V  +S H++  G+++PGT  G   + G  KG+ F 
Sbjct: 187 -RVLYIDIDLHHGDGVQEAFYTTDRVFTLSFHKYN-GEFFPGT--GDLTEIGCDKGKHFA 242

Query: 298 CNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYG 357
            N+    G + D  Y+  F+ +V P+   F+P +++   G D+   D +G  +++   +G
Sbjct: 243 LNVPLEDG-IDDDSYINLFKSIVDPLITTFKPTVIVQQCGADSLGHDRLGCFNLNIKAHG 301

Query: 358 HMTHMLKSLARGNLCVVLEGGYNLDAIAR 386
                +KS     L VV  GGY    ++R
Sbjct: 302 ECVKFVKSFGLPML-VVGGGGYTPKNVSR 329

>KAFR0A08630 Chr1 (1731077..1732378) [1302 bp, 433 aa] {ON} Anc_3.8
           YNL330C
          Length = 433

 Score =  128 bits (321), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 88/326 (26%), Positives = 156/326 (47%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKLPIR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLIMNYGLYKK------------MEIYRAK 67

Query: 126 EATMNEILEVHSIEHFKYLEKTSNDNREQLLKETEN---GDSVYFNNDSFQSAKLSCGGA 182
            AT  E+ + H+ E+  +L + + DN +   KE+     GD     +  ++   +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVL 241
           +E    +  G+    +A+    G HH++   A GFC  +++ +    +L+ +P    +VL
Sbjct: 128 MEGAARLNRGKCD--IAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 ILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNIT 301
            +D D+HHG+G ++AFY  D V+  S H++  G+++PGT  G+    G GKG+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGKGKNYAVNVP 237

Query: 302 WPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 361
              G + DA Y   FE V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LRDG-IDDATYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMQGHANCVN 296

Query: 362 MLKSLARGNLCVVLEGGYNLDAIARS 387
            +KS     + VV  GGY +  +AR+
Sbjct: 297 YVKSFNI-PMMVVGGGGYTMRNVART 321

>TDEL0B04580 Chr2 complement(817368..818708) [1341 bp, 446 aa] {ON}
           Anc_8.153 YGL194C
          Length = 446

 Score =  128 bits (321), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 94/334 (28%), Positives = 165/334 (49%), Gaps = 32/334 (9%)

Query: 60  GLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLS--GVDNIGD 117
           G  Y  R+ YH     S + Y   HP  P R+           L+ D  +S  G+  I D
Sbjct: 21  GSAYCPRVSYHFNPKVSNYHYGVRHPMKPFRL-----------LLTDHLVSSYGLHKIMD 69

Query: 118 LMLKLPIREATMNEILEVHSIEHFKYLEKTSNDNREQL----LKETENGDSVYFNNDSFQ 173
           L      R AT  EI E H+ ++  +L K + +N  ++    L++   GD      + F 
Sbjct: 70  LY---ETRVATSEEIAEFHTQDYIDFLHKVTPENLSKMPRGTLEKFNIGDDCPIFQNLFN 126

Query: 174 SAKLSCGGAIEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNILKN 232
             KL  G +++A + ++    ++ +A+    G HH++  +  GFC  +++ +A  N+L+ 
Sbjct: 127 YCKLYAGASLDAARKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLAILNLLRY 184

Query: 233 YPESVRKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGK 292
           +P    +VL +D D+HHG+G Q+AFY  D V  +S H++  G+++PGT  G +D+ G   
Sbjct: 185 HP----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT--GNHDEVGCAN 237

Query: 293 GEGFNCNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVS 352
           G+ F  N+    G + D  Y+  F+ ++ P+   ++P ++I   G D+   D IG  +++
Sbjct: 238 GKHFAMNVPLEDG-IDDDSYINLFKSIMDPLITSYKPTVIIQQCGADSLGHDRIGCFNLT 296

Query: 353 PSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAR 386
              +G     ++S     L VV  GGY    ++R
Sbjct: 297 IKGHGECVKFIRSFGIPML-VVGGGGYTPRNVSR 329

>Smik_14.2 Chr14 complement(2435..3736) [1302 bp, 433 aa] {ON}
           YNL330C (REAL)
          Length = 433

 Score =  127 bits (320), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 88/326 (26%), Positives = 155/326 (47%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKLPIR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 126 EATMNEILEVHSIEHFKYLEKTSNDNREQLLKETEN---GDSVYFNNDSFQSAKLSCGGA 182
            AT  E+ + H+ E+  +L + + DN E   +E+     GD     +  ++   +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVL 241
           +E    +  G+    +AV    G HH++   A GFC  +++ +    +L+ +P    +VL
Sbjct: 128 MEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 ILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNIT 301
            +D D+HHG+G ++AFY  D V+  S H++  G+++PGT  G+    G G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGTGKNYAVNVP 237

Query: 302 WPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 361
              G + DA Y   FE V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LRDG-IDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 362 MLKSLARGNLCVVLEGGYNLDAIARS 387
            +KS     + VV  GGY +  +AR+
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>YNL330C Chr14 complement(18001..19302) [1302 bp, 433 aa] {ON}
           RPD3Histone deacetylase; regulates transcription,
           silencing, and other processes by influencing chromatin
           remodeling; forms at least two different complexes which
           have distinct functions and members
          Length = 433

 Score =  127 bits (319), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 88/326 (26%), Positives = 155/326 (47%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKLPIR 125
           R+ Y        + Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNYAYGAGHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 126 EATMNEILEVHSIEHFKYLEKTSNDNREQLLKETEN---GDSVYFNNDSFQSAKLSCGGA 182
            AT  E+ + H+ E+  +L + + DN E   +E+     GD     +  ++   +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLEMFKRESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVL 241
           +E    +  G+    +AV    G HH++   A GFC  +++ +    +L+ +P    +VL
Sbjct: 128 MEGAARLNRGKCD--VAVNYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 ILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNIT 301
            +D D+HHG+G ++AFY  D V+  S H++  G+++PGT  G+    G G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGAGKNYAVNVP 237

Query: 302 WPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 361
              G + DA Y   FE V+  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LRDG-IDDATYRSVFEPVIKKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMEGHANCVN 296

Query: 362 MLKSLARGNLCVVLEGGYNLDAIARS 387
            +KS     + VV  GGY +  +AR+
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>TDEL0A00270 Chr1 complement(44950..46251) [1302 bp, 433 aa] {ON}
           Anc_3.8 YNL330C
          Length = 433

 Score =  125 bits (315), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 89/326 (27%), Positives = 155/326 (47%), Gaps = 28/326 (8%)

Query: 66  RMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLKLPIR 125
           R+ Y        F Y   HP  P RI   + ++   GL               M     +
Sbjct: 20  RVAYFYDADVGNFSYGQYHPMKPHRIRMAHSLIMNYGLYKK------------MEIYRAK 67

Query: 126 EATMNEILEVHSIEHFKYLEKTSNDNREQLLKETEN---GDSVYFNNDSFQSAKLSCGGA 182
            AT  E+ + H+ E+  +L + + DN E   KE+     GD     +  ++   +S GG+
Sbjct: 68  PATKQEMCQFHTDEYIDFLSRVTPDNLELFKKESVKFNVGDDCPVFDGLYEYCSISGGGS 127

Query: 183 IEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVL 241
           +E    +  G+    +A+    G HH++   A GFC  +++ +    +L+ +P    +VL
Sbjct: 128 MEGAARLNRGKCD--VAINYAGGLHHAKKAEASGFCYLNDIVLGIIELLRYHP----RVL 181

Query: 242 ILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNIT 301
            +D D+HHG+G ++AFY  D V+  S H++  G+++PGT  G+    G G G+ +  N+ 
Sbjct: 182 YIDIDVHHGDGVEEAFYTTDRVMTCSFHKY--GEFFPGT--GELRDIGVGSGKYYAVNVP 237

Query: 302 WPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTH 361
              G + DA +   FE VV  +   +QP  V++  G D+  GD +G  ++S   + +  +
Sbjct: 238 LRDG-IDDATFRNVFEPVVGKIMEWYQPAAVVLQCGGDSLSGDRLGCFNLSMRGHANCVN 296

Query: 362 MLKSLARGNLCVVLEGGYNLDAIARS 387
            +KS     + VV  GGY +  +AR+
Sbjct: 297 YVKSFGI-PMMVVGGGGYTMRNVART 321

>ZYRO0G19316g Chr7 (1600375..1601721) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|P53096 Saccharomyces cerevisiae
           YGL194C HOS2 Histone deacetylase required for gene
           activation via specific deacetylation of lysines in H3
           and H4 histone tails subunit of the Set3 complex a
           meiotic-specific repressor of sporulation specific genes
           that contains deacetylase activity
          Length = 448

 Score =  125 bits (314), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 88/335 (26%), Positives = 167/335 (49%), Gaps = 28/335 (8%)

Query: 57  LKTGLCYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIG 116
            + G  Y  R+ YH     S + Y   HP  P R+     +++  GL           I 
Sbjct: 17  FQFGSSYCPRVSYHFNPKVSNYHYGTKHPMKPFRLMLTDHLVSSYGL---------HKIM 67

Query: 117 DLMLKLPIREATMNEILEVHSIEHFKYLEKTSNDNREQL----LKETENGDSVYFNNDSF 172
           DL      R AT  E+   HS E+  ++++ + +N  +L    L++   GD      + +
Sbjct: 68  DLY---ETRVATWEEMTAFHSEEYVDFMKRVTPENLNKLPRGTLEKFNIGDDCPIFPNLY 124

Query: 173 QSAKLSCGGAIEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNILK 231
             + L  G +++A + ++    ++ +A+    G HH++  +  GFC  +++ +AT N+L+
Sbjct: 125 DYSSLYAGASLDASRKLIND--QSDIAINWSGGLHHAKKSNPSGFCYVNDIVLATLNLLR 182

Query: 232 NYPESVRKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEG 291
            +P    +VL +D D+HHG+G Q+AFY  D V  +S H++  G+++PGT  G +D+ G  
Sbjct: 183 YHP----RVLYIDIDLHHGDGVQEAFYTTDRVYTVSFHKYN-GEFFPGT--GNHDEVGCA 235

Query: 292 KGEGFNCNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHV 351
           +G+ F  N+    G + D  Y+  F+ ++ P+   ++P +++   G D+   D +G  ++
Sbjct: 236 RGKHFALNVPLQDG-IDDDSYINLFKSIIDPLITSYKPTVIVQQCGADSLGHDRLGCFNL 294

Query: 352 SPSCYGHMTHMLKSLARGNLCVVLEGGYNLDAIAR 386
           +   +G   + ++S     L VV  GGY    ++R
Sbjct: 295 NVKAHGECVNFVRSFGLPML-VVGGGGYTPRNVSR 328

>TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {ON}
           Anc_3.362 YPR068C
          Length = 454

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 94/182 (51%), Gaps = 11/182 (6%)

Query: 206 HHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQKAFYNDDNVLY 265
           HH+  + A GFC  +++ +  + + +   +  +K+  +D+D+HHG+G +KAF    NV  
Sbjct: 206 HHAFKQKASGFCYVNDIVLLIQKLRR---KGFQKISYIDFDLHHGDGVEKAFQFSSNVQT 262

Query: 266 ISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNITWPIGAVGDAEYMWAFEQVVMPMSR 325
           ISLH FE+G ++PGT  G   ++ + +      NI    G + D       EQ+V P+  
Sbjct: 263 ISLHLFEVG-FFPGT--GNLSESDKRRNV---VNIPLLHG-LDDTSLEQLIEQIVKPVIE 315

Query: 326 EFQPDLVIISSGFDAADGDTIGQCHVSPSCYGH-MTHMLKSLARGNLCVVLEGGYNLDAI 384
             +PD+++I  G D   GD   +  +S       +T ++ +     + ++  GGYN+  +
Sbjct: 316 RHEPDVLVIQCGGDGLMGDGFNEWQLSIRGLAKCITELINNTKDCPVILLGGGGYNVTLM 375

Query: 385 AR 386
           +R
Sbjct: 376 SR 377

>NDAI0A05120 Chr1 (1164314..1165840) [1527 bp, 508 aa] {ON}
           Anc_3.362 YPR068C
          Length = 508

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 120/250 (48%), Gaps = 20/250 (8%)

Query: 145 EKTSNDNREQLLKETENGDSVYFNNDSFQSAKLSC----GGAIEACKAVVEGRVKNAMAV 200
           ++ SNDN +++++E   G ++  +   F    + C    G  +   K +     +  +AV
Sbjct: 167 KENSNDNEKEMIREKLKGYNLEGDCPIFSYLPVYCQVIVGATLSLAKHITAVANERTIAV 226

Query: 201 VRPPG-HHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQKAFYN 259
               G HH+    A GFC  +++ +  + +  N     +++  +D+D+HHG+G Q++F  
Sbjct: 227 NWDGGRHHALRNKASGFCYINDIVLLIQQLRSN---GYKRITYIDFDLHHGDGVQRSFQY 283

Query: 260 DDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNITWPIGAVGDAEYMWAFEQV 319
             +V  IS H FE G ++P T  G   ++  GK      NI   +  V D       E+V
Sbjct: 284 STSVQTISAHMFEPG-FFPCT--GSLKESKMGKN---IVNIPL-LHGVDDMLMNEIVEKV 336

Query: 320 VMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVL---E 376
           ++P  + + P++++I  G D   GD   +  +  + +G + ++LK L     C V+    
Sbjct: 337 MIPCVKRYDPEILVIQCGGDGLIGDGYAEWQL--TIHGLVNNILKLLRIFPGCPVVLLGG 394

Query: 377 GGYNLDAIAR 386
           GGYN   ++R
Sbjct: 395 GGYNETVMSR 404

>SAKL0B07854g Chr2 complement(669743..671212) [1470 bp, 489 aa] {ON}
           similar to uniprot|Q12214 Saccharomyces cerevisiae
           YPR068C
          Length = 489

 Score = 77.0 bits (188), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 89/182 (48%), Gaps = 12/182 (6%)

Query: 206 HHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQKAFYNDDNVLY 265
           HHS    A GFC  +++ +A + + +N+      +  +D+D+HHG+G ++AF    NV  
Sbjct: 242 HHSFKSRASGFCYINDIVLAIQRLRRNFS----NISYVDFDLHHGDGVERAFQYSKNVQT 297

Query: 266 ISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNITWPIGAVGDAEYMWAFEQVVMPMSR 325
           ISLH  E G ++PGT   +  Q G         NI    GA  D   M   E VV+P  +
Sbjct: 298 ISLHNHEPG-FFPGTGSMESSQDGHSI-----INIPLRHGADDDC-LMKITESVVIPCIQ 350

Query: 326 EFQPDLVIISSGFDAADGDTIGQCHVS-PSCYGHMTHMLKSLARGNLCVVLEGGYNLDAI 384
           +  P +++I  G D   GD   +  ++       +  +L SL   ++ ++  GGYN   +
Sbjct: 351 KHGPQVIVIQCGGDGLIGDKYEEWQLTIRGLTSSILKILSSLPDTHIILLGGGGYNDRVM 410

Query: 385 AR 386
           +R
Sbjct: 411 SR 412

>TBLA0B02390 Chr2 (558067..559806) [1740 bp, 579 aa] {ON} Anc_3.362
           YPR068C
          Length = 579

 Score = 77.0 bits (188), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 48/182 (26%), Positives = 95/182 (52%), Gaps = 11/182 (6%)

Query: 206 HHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQKAFYNDDNVLY 265
           HHS  + A GFC  +++ +    I K   +  RK+  LD+D+HHG+G +K+F    ++  
Sbjct: 299 HHSRKKKASGFCYVNDIVLC---IQKLGEKGFRKITYLDFDLHHGDGVEKSFQYSKHIQT 355

Query: 266 ISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNITWPIGAVGDAEYMWAFEQVVMPMSR 325
           IS+H FE G ++P T  G  ++T      GFN      +  + D    +   +V++P+ +
Sbjct: 356 ISVHLFEPG-FFPCT--GSLEET----KHGFNIVNIPTLHGLDDNYLTYLLNRVIIPLIK 408

Query: 326 EFQPDLVIISSGFDAADGDTIGQCHVSPS-CYGHMTHMLKSLARGNLCVVLEGGYNLDAI 384
           + +P+ +++  G D   GD   +  ++ S    ++  +L++    ++ ++  GGYN   +
Sbjct: 409 KHKPECLVVQCGGDGLIGDRYKEWQMTISGLTKNIMLVLQNFPECSVVLLGGGGYNERVM 468

Query: 385 AR 386
           +R
Sbjct: 469 SR 470

>Suva_16.396 Chr16 complement(689796..691229) [1434 bp, 477 aa] {ON}
           YPR068C (REAL)
          Length = 477

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 93/183 (50%), Gaps = 13/183 (7%)

Query: 206 HHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQKAFYNDDNVLY 265
           HH+  + A GFC  ++V +  + + K     + KV  LD+D+HHG+G +KAF     +  
Sbjct: 212 HHAFKQKANGFCYINDVVLLIQRLRK---LKLSKVTYLDFDLHHGDGVEKAFQYSRQIQT 268

Query: 266 ISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNITWPIGAVGDAEYM-WAFEQVVMPMS 324
           IS+H +E G ++PGT  G  + +  GK       +  P+    D  Y+     +++ P+ 
Sbjct: 269 ISVHLYEPG-FFPGT--GSLNDSQNGKNI-----VNIPLKHGCDDNYLNLVASKIIHPLI 320

Query: 325 REFQPDLVIISSGFDAADGDTIGQCHVSPSCYGH-MTHMLKSLARGNLCVVLEGGYNLDA 383
           +   P+++I+  G D   GD   +  ++       + +++KS  + ++ ++  GGYN   
Sbjct: 321 KRHDPEVIIMECGGDGLQGDRFNEWQLTIRGLSRTIVNIMKSYPQAHIFLLGGGGYNDLL 380

Query: 384 IAR 386
           ++R
Sbjct: 381 MSR 383

>NCAS0A11180 Chr1 complement(2216701..2218173) [1473 bp, 490 aa]
           {ON} Anc_3.362 YPR068C
          Length = 490

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 102/209 (48%), Gaps = 14/209 (6%)

Query: 181 GAIEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNILKNYPESVRK 239
           GA  +    ++   + ++A+    G HH+    A GFC  +++ +  + I KN     + 
Sbjct: 189 GATLSLSKFLQPNSERSIAINWDGGRHHAFKNKASGFCYVNDIVLLIQKIRKN---GFKN 245

Query: 240 VLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCN 299
           +  +D+D+HHG+G QKAF    NV  +SLH FE G ++P T   Q     E K      N
Sbjct: 246 ISYVDFDLHHGDGVQKAFQFSKNVQTVSLHMFEPG-FFPCTGSLQ-----EAKAGSSIVN 299

Query: 300 ITWPIGAVGDAEYMWAFEQ-VVMPMSREFQPDLVIISSGFDAADGDTIGQCHVS-PSCYG 357
           I  P+    D  ++    + +++P+  + +P++++I  G D   GD   +  ++     G
Sbjct: 300 I--PLLHGLDGTFLKQLTKDIIIPVVEQHEPEVLVIQCGGDGLIGDQYNEWQLTIHDLSG 357

Query: 358 HMTHMLKSLARGNLCVVLEGGYNLDAIAR 386
            +  ++ +    ++ ++  GGYN   ++R
Sbjct: 358 AIMKLINTFPSCSVVLLGGGGYNEKVMSR 386

>Skud_16.353 Chr16 complement(647799..649214) [1416 bp, 471 aa] {ON}
           YPR068C (REAL)
          Length = 471

 Score = 73.6 bits (179), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 92/183 (50%), Gaps = 13/183 (7%)

Query: 206 HHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQKAFYNDDNVLY 265
           HH+  + A GFC  ++V +  + + K     + K+  +D+D+HHG+G ++AF     +  
Sbjct: 212 HHAFKQKANGFCYINDVVLLIQRLRK---MKLNKITYVDFDLHHGDGVERAFQYSKQIQT 268

Query: 266 ISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNITWPIGAVGDAEYM-WAFEQVVMPMS 324
           IS+H +E G ++PGT  G  +   +GK       +  P+    D  Y+     +++ P+ 
Sbjct: 269 ISIHLYEPG-FFPGT--GSLNDARKGKSV-----VNIPLKHGCDDSYLDLVASKIISPLI 320

Query: 325 REFQPDLVIISSGFDAADGDTIGQCHVSPSCYGH-MTHMLKSLARGNLCVVLEGGYNLDA 383
           +   PD++II  G D   GD   +  ++       + +++K   R ++ ++  GGYN   
Sbjct: 321 KRHDPDVLIIECGGDGLLGDRFNEWQLTIRGLSRTIVNVMKLYPRAHIFLLGGGGYNDLL 380

Query: 384 IAR 386
           ++R
Sbjct: 381 MSR 383

>Kpol_376.15 s376 complement(25558..27114) [1557 bp, 518 aa] {ON}
           complement(25558..27114) [1557 nt, 519 aa]
          Length = 518

 Score = 73.6 bits (179), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 47/183 (25%), Positives = 93/183 (50%), Gaps = 13/183 (7%)

Query: 206 HHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQKAFYNDDNVLY 265
           HH+    A GFC  +++ +  + + K   + + KV  +D+D+HHG+G +KAF    N+  
Sbjct: 223 HHAIKNKASGFCYINDIVILIQKLRK---KGISKVSYIDFDLHHGDGVEKAFRYSSNIQT 279

Query: 266 ISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNITWPIGAVGDAEYMWAF-EQVVMPMS 324
           IS+H +E G ++P T  G  + T  GK       +  P+    D  YM     +++ P+ 
Sbjct: 280 ISMHMYEPG-FFPCT--GSLEDTLNGKN-----IVNVPLYHGVDDNYMTEIVNELIKPLI 331

Query: 325 REFQPDLVIISSGFDAADGDTIGQCHVSPS-CYGHMTHMLKSLARGNLCVVLEGGYNLDA 383
               P++++I  G D   GD   +  ++ S    ++ ++++   + ++ ++  GGYN   
Sbjct: 332 ERHSPEVLVIQCGGDGLIGDKFEEWQLTISGLTRNIQNLIEWFPKSDIILLGGGGYNELV 391

Query: 384 IAR 386
           ++R
Sbjct: 392 MSR 394

>ZYRO0C16390g Chr3 complement(1274651..1275961) [1311 bp, 436 aa]
           {ON} similar to uniprot|Q12214 Saccharomyces cerevisiae
           YPR068C
          Length = 436

 Score = 73.2 bits (178), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 56/195 (28%), Positives = 98/195 (50%), Gaps = 17/195 (8%)

Query: 206 HHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQKAFYNDDNVLY 265
           HH+  + A GFC  +++ +    I K   +  +++  +D+D+HHG+G ++AF    NV  
Sbjct: 195 HHAMKKRASGFCYVNDIVLL---IQKLRSKGFQRLSYIDFDLHHGDGVERAFQFSSNVQT 251

Query: 266 ISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNITWPIGAVGDAEYM-WAFEQVVMPMS 324
           IS+H FE G ++P +  G  +   +GK      NI  P+    + EY+     QVV+P++
Sbjct: 252 ISMHLFECG-FFPTS--GSLEDNKKGKNIA---NI--PLAHGLNDEYLNEIVTQVVIPLT 303

Query: 325 REFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVL---EGGYNL 381
               P ++II  G D   GD   +  ++    G   ++LK + R   C ++    GGYN 
Sbjct: 304 DRHSPQVIIIQCGGDGLMGDEYNEWQLTIK--GLCENILKIVNRYKNCSIVLLGGGGYNP 361

Query: 382 DAIARSALSVSKILI 396
             ++R    ++  LI
Sbjct: 362 TVMSRFYTYLTGKLI 376

>KLTH0F10582g Chr6 (910298..911722) [1425 bp, 474 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068C
          Length = 474

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 93/183 (50%), Gaps = 13/183 (7%)

Query: 206 HHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQKAFYNDDNVLY 265
           HH+    A GFC  +++A+  + + +     +R++  +D+D+HH +G ++AF +  +V  
Sbjct: 221 HHASRSRASGFCYINDIALLIQKLRR---RGIRRISYIDFDLHHCDGVERAFQHSQSVQT 277

Query: 266 ISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNITWPIGAVGDAEYM-WAFEQVVMPMS 324
           IS+H  E G ++PGT  G   +   GK       +  P+    D  ++    ++V+MP  
Sbjct: 278 ISVHLHEPG-FFPGT--GSLKEASVGKNV-----VNIPVQHGMDDTFLNQIVQRVIMPCI 329

Query: 325 REFQPDLVIISSGFDAADGDTIGQCHVS-PSCYGHMTHMLKSLARGNLCVVLEGGYNLDA 383
           R   P++++I  G D   GD   +  ++      ++ ++++     N+ ++  GGYN   
Sbjct: 330 RSHNPEVLVIQCGGDGLMGDKYKEWQLTIKGLVNNIMYIVRGFPATNVVMLGGGGYNERL 389

Query: 384 IAR 386
           ++R
Sbjct: 390 MSR 392

>Kwal_23.3724 s23 (406773..408194) [1422 bp, 473 aa] {ON} YPR068C
           (HOS1) - Similar to Hda1p, Rpd3p, Hos2p, and Hos3p
           [contig 254] FULL
          Length = 473

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 53/209 (25%), Positives = 97/209 (46%), Gaps = 14/209 (6%)

Query: 181 GAIEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNILKNYPESVRK 239
           GA          R +  ++V    G HH+    A GFC  +++A+  + + +     + K
Sbjct: 198 GATIKLARYASSRQQRTISVNWDGGRHHAFKSKASGFCYVNDIAILIQKLRR---RGIHK 254

Query: 240 VLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCN 299
           +  LD+D+HHG+G ++AF +  NV  IS+H +E G ++PGT  G       G+       
Sbjct: 255 ISYLDFDLHHGDGVERAFQHSANVQTISIHMYEEG-FFPGT--GTLKDASSGRNI----- 306

Query: 300 ITWPIGAVGDAEYM-WAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVS-PSCYG 357
           +  P+    D  ++     +VV+P      P++VII  G D   GD   +  ++      
Sbjct: 307 VNIPVLHGMDDTFLNEVVNRVVIPCLHNHNPEVVIIQCGGDGLIGDKYKEWQLTLKGLTD 366

Query: 358 HMTHMLKSLARGNLCVVLEGGYNLDAIAR 386
            +  +++     N+ ++  GGYN   ++R
Sbjct: 367 TIMKVVEDFPSSNIVLLGGGGYNEKLMSR 395

>CAGL0D01430g Chr4 (158990..160327) [1338 bp, 445 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068c HOS1
          Length = 445

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 95/202 (47%), Gaps = 12/202 (5%)

Query: 177 LSCGGAIEACKAVVEGRVKNAMAVVRPPGHHSEPESAGGFCLFSNVAVATKNILKNYPES 236
           +S G  +   + ++EG  +          HHS    A GFC  +++A+    + +     
Sbjct: 174 VSTGATLSLAQYILEGSERTIAINWDGGRHHSMKTKASGFCYINDIALLIMTLRRG---G 230

Query: 237 VRKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGF 296
           V ++  +D+D+HHG+G +KAF     V  ISLH +E G ++P +  G  +    GK    
Sbjct: 231 VDRISYVDFDLHHGDGVEKAFKYSKQVQTISLHMYETG-FFPCS--GSLEDNSSGKS--- 284

Query: 297 NCNITWPIGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCY 356
             NI   +  + D+      +++++P   + QP++++I  G D   GD   +  +S    
Sbjct: 285 IVNIPL-LHGLDDSTLQDIAKRIIVPSISKHQPNVIVIQCGGDGLKGDKYSEWQLSIK-- 341

Query: 357 GHMTHMLKSLARGNLCVVLEGG 378
           G  + +   + + N  +VL GG
Sbjct: 342 GLTSTITSLIEQFNCHIVLLGG 363

>KAFR0H00890 Chr8 (167453..168877) [1425 bp, 474 aa] {ON} Anc_3.362
           YPR068C
          Length = 474

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 101/216 (46%), Gaps = 19/216 (8%)

Query: 176 KLSCGGAIEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNILKNYP 234
           +++ G  +   K +V       + +    G HH+  + A GFC  +++ +  + + KN  
Sbjct: 188 QVTTGATLSLSKFLVPNSKDRTICINWDGGRHHASKKKASGFCYINDIVLLIQRMRKN-- 245

Query: 235 ESVRKVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGE 294
              +K+  LD+D+HHG+G +KAF    ++  ISLH FE G ++PG        TG    +
Sbjct: 246 -GFKKITYLDFDLHHGDGVEKAFQFSKSIQTISLHLFETG-FFPG--------TGGLSNK 295

Query: 295 GFNCNITWPIGAVGDAEYMWAF-EQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSP 353
           G    I  P+      +Y++   +Q+++P       + +++  G D   GD   +  ++ 
Sbjct: 296 GSRDLIDIPLSHGLTDDYLFELVKQIIIPAIDLHAAEAIVLQCGGDGLSGDKFNEWQLTI 355

Query: 354 SCYGHMTHMLKSLARGNLCVVL---EGGYNLDAIAR 386
              G    ++  + + + C ++    GGYN   ++R
Sbjct: 356 K--GLTQCIIDVIGKFSDCQIVLLGGGGYNELLVSR 389

>YPR068C Chr16 complement(682941..684353) [1413 bp, 470 aa] {ON}
           HOS1Class I histone deacetylase (HDAC) family member
           that deacetylates Smc3p on lysine residues at anaphase
           onset; has sequence similarity to Hda1p, Rpd3p, Hos2p,
           and Hos3p; interacts with the Tup1p-Ssn6p corepressor
           complex
          Length = 470

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 91/183 (49%), Gaps = 13/183 (7%)

Query: 206 HHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQKAFYNDDNVLY 265
           HH+  + A GFC  ++V +  + + K     + K+  +D+D+HHG+G +KAF     +  
Sbjct: 210 HHAFKQRASGFCYINDVVLLIQRLRK---AKLNKITYVDFDLHHGDGVEKAFQYSKQIQT 266

Query: 266 ISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNITWPIGAVGDAEYMWAF-EQVVMPMS 324
           IS+H +E G ++PGT  G    + + K       +  P+    D  Y+     ++V P+ 
Sbjct: 267 ISVHLYEPG-FFPGT--GSLSDSRKDKNV-----VNIPLKHGCDDNYLELIASKIVNPLI 318

Query: 325 REFQPDLVIISSGFDAADGDTIGQCHVSPSCYGH-MTHMLKSLARGNLCVVLEGGYNLDA 383
              +P+ +II  G D   GD   +  ++       + +++KS  R ++ ++  GGYN   
Sbjct: 319 ERHEPEALIIECGGDGLLGDRFNEWQLTIRGLSRIIINIMKSYPRAHIFLLGGGGYNDLL 378

Query: 384 IAR 386
           ++R
Sbjct: 379 MSR 381

>KLLA0B09394g Chr2 (822629..823954) [1326 bp, 441 aa] {ON} similar
           to uniprot|Q12214 Saccharomyces cerevisiae YPR068C HOS1
           Putative class I histone deacetylase (HDAC) with
           sequence similarity to Hda1p, Rpd3p, Hos2p, and Hos3p;
           deletion results in increased histone acetylation at
           rDNA repeats; interacts with the Tup1p-Ssn6p complex
          Length = 441

 Score = 70.9 bits (172), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 88/183 (48%), Gaps = 13/183 (7%)

Query: 206 HHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQKAFYNDDNVLY 265
           HH+    A GFC  +++ +  +++ +   +  ++V  +D+D+H+G+G  KAF   +NV  
Sbjct: 193 HHALKHYASGFCYVNDIVLLIQSLRR---KGWKRVTYIDFDLHYGDGVAKAFRFSENVQT 249

Query: 266 ISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNITWPIGAVGDAEYMWAF-EQVVMPMS 324
           IS+H +E G ++PGT  G  ++T   K       +  P+    D +Y+      V+ P+ 
Sbjct: 250 ISVHLYEPG-FFPGT--GSLEETRNSKQ-----MVNLPVLHGMDDKYLLELISSVITPLI 301

Query: 325 REFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSLARGNLCVVL-EGGYNLDA 383
             F  + ++I  G D   GD   +  +S     H    +  + R     +L  GGYN   
Sbjct: 302 ETFNAECIVIQCGSDGLSGDKYNEWQLSIRGLTHAIISIMDMFRDKQVFLLGGGGYNELL 361

Query: 384 IAR 386
           ++R
Sbjct: 362 VSR 364

>Smik_16.309 Chr16 complement(559713..561125) [1413 bp, 470 aa] {ON}
           YPR068C (REAL)
          Length = 470

 Score = 70.5 bits (171), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 92/183 (50%), Gaps = 13/183 (7%)

Query: 206 HHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQKAFYNDDNVLY 265
           HH+  + A GFC  ++V +  + + K     + K+  LD+D+HHG+G +KAF     +  
Sbjct: 210 HHAFKQRASGFCYINDVVLLIQRLRK---IKLNKITYLDFDLHHGDGVEKAFQYSKQIQT 266

Query: 266 ISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNITWPIGAVGDAEYM-WAFEQVVMPMS 324
           IS+H +E G ++PGT  G  D +  GK       +  P+    D  Y+     +++ P+ 
Sbjct: 267 ISVHIYEPG-FFPGT--GSLDDSRGGKNV-----VNIPLKHGCDDSYLNLIASKIINPLI 318

Query: 325 REFQPDLVIISSGFDAADGDTIGQCHVSPSCYGH-MTHMLKSLARGNLCVVLEGGYNLDA 383
            +  P+++II  G D   GD   +  ++       + + +K  ++ ++ ++  GGYN   
Sbjct: 319 DKHDPEVLIIECGGDGLLGDRFNEWQLTVRGLSETIINFIKRYSQAHIFLLGGGGYNDLL 378

Query: 384 IAR 386
           ++R
Sbjct: 379 MSR 381

>ADL339W Chr4 (110772..112085) [1314 bp, 437 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR068C (HOS1)
          Length = 437

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 60/223 (26%), Positives = 103/223 (46%), Gaps = 19/223 (8%)

Query: 180 GGAIEACKAVVEGRVKNAMAVVRPPG-HHSEPESAGGFCLFSNVAVATKNILKNYPESVR 238
            GA  A    +     +A+AV    G HH+    A GFC  +++A+  + + +   +   
Sbjct: 166 AGATLALAKELSRHRGSALAVNWDGGRHHALKARASGFCYVNDIALLIQTLRR---QGFL 222

Query: 239 KVLILDWDIHHGNGTQKAFYNDDNVLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNC 298
           +V  +D+D+HHG+G + AF    NV   SLH FE G ++PG        TG  K    N 
Sbjct: 223 RVSYVDFDLHHGDGVENAFRYSKNVQTCSLHLFEPG-FFPG--------TGACKNCTDNS 273

Query: 299 NITWP-IGAVGDAEYMWAFEQVVMPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYG 357
            +  P +  V D+      + +V P  +   P+++II  G D   GD  G+  +  S +G
Sbjct: 274 VLNVPLLHGVDDSTLDHVVDHIVTPAVQRHDPEVLIIQCGGDGLSGDKYGEWQL--SIHG 331

Query: 358 HMTHMLKSLAR---GNLCVVLEGGYNLDAIARSALSVSKILIG 397
              ++LK +       + ++  GGYN    +R    ++ +L+ 
Sbjct: 332 LTRNILKLVQAHKFKKIALLGGGGYNGRLQSRFYAYLTSMLLA 374

>KNAG0H00630 Chr8 (105506..106876) [1371 bp, 456 aa] {ON} Anc_3.362
           YPR068C
          Length = 456

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/188 (26%), Positives = 93/188 (49%), Gaps = 24/188 (12%)

Query: 206 HHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQKAFYNDDNVLY 265
           HH+    A GFC  +++ +  + + K   +   KV  LD+D+HHG+G ++AF     V  
Sbjct: 206 HHASKGKASGFCYVNDIVLLIQKLRK---QGTGKVTYLDFDLHHGDGVERAFKFTKKVQT 262

Query: 266 ISLHRFELGKYYP--GTIQGQYDQTGEGKGEGFNCNITWPIG-AVGDAEYMWAFEQVVMP 322
           ISLH +E G ++P  G+++G           GF+  +  P+   + D+      +QVV P
Sbjct: 263 ISLHLYEPG-FFPCTGSLEGS---------SGFD-TVNLPLQHGLTDSFLQGLVDQVVNP 311

Query: 323 MSREFQPDLVIISSGFDAADGDTIGQCHVS----PSCYGHMTHMLKSLARGNLCVVLEGG 378
           + +   P++++I  G D   GDT  +  +S      C   +  ++    + ++ ++  GG
Sbjct: 312 LIQRHGPEVIVIQCGGDGLLGDTFHEWQLSIRGLTKC---ILDVMSHSTQAHVILLGGGG 368

Query: 379 YNLDAIAR 386
           YN   ++R
Sbjct: 369 YNPTLMSR 376

>SAKL0H08338g Chr8 (716414..718486) [2073 bp, 690 aa] {ON} similar
           to uniprot|Q02959 Saccharomyces cerevisiae YPL116W HOS3
           Trichostatin A-insensitive homodimeric histone
           deacetylase (HDAC)
          Length = 690

 Score = 67.8 bits (164), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 83/325 (25%), Positives = 138/325 (42%), Gaps = 71/325 (21%)

Query: 132 ILEVHSIEHFKYLEKTSNDNREQLL-KETE-----NGDSVYFNNDSFQSAKLSCGGAIEA 185
           +L+VH  +  K L +    + E+L  K+ E     N   +Y +  +  + + S G     
Sbjct: 109 VLKVHGTDWPKELLQLCKQSSEKLAHKQVEVPDDWNVGDIYLSQQTIAALEGSIGALETG 168

Query: 186 CKAVVEGRVK-----NAMAVVRPPGHHSEPESAGGFCLFSNVAVATKNILKNYPESVRKV 240
             ++ +G  +      A   VRPPGHHS   +  GFCL +N  +A +     +  +V   
Sbjct: 169 IDSIFQGSSQEDIANRAFVAVRPPGHHSHTATPSGFCLLNNAHIAIEYAADTF--NVTHA 226

Query: 241 LILDWDIHHGNGTQ-----KAFYNDD-------------------NVLYISLHRF----- 271
           ++LD+D+HHG+GTQ     +A +N D                    V Y S+H       
Sbjct: 227 VVLDFDLHHGDGTQDICWKRAGFNPDEQDDDPAYDEFGKKFAEFPKVGYFSMHDINSFPT 286

Query: 272 ELG-------KYYPGTIQGQYD-----------QTGEGKGEGFNCNITWPIGAVGDAEYM 313
           ELG       K     I   +D           +T E   + +       + A  D E+ 
Sbjct: 287 ELGYATKENIKNASTCIMNAHDLNIWNVHLSHYETEEDFVKLYQSKYR-SLFAKAD-EFF 344

Query: 314 WAFEQVVMPMSREFQPDLVIISSGFDAADGDTIG-QCHV--SPSCYGHM-THMLKSLAR- 368
              ++ +    ++F+  LV+IS+GFDA++ +    Q H    P+C+ +M T     LA+ 
Sbjct: 345 KNAKKEMASQGKKFK-GLVVISAGFDASEYEQPSMQRHGVNVPTCFYNMFTKDALKLAQM 403

Query: 369 ---GNLCVVLEGGYNLDAIARSALS 390
              G +  V+EGGY+  AI+    S
Sbjct: 404 HTSGKVLSVMEGGYSDGAISSGVFS 428

>ADL265W Chr4 (237911..239995) [2085 bp, 694 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL116W (HOS3)
          Length = 694

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 69/247 (27%), Positives = 93/247 (37%), Gaps = 55/247 (22%)

Query: 197 AMAVVRPPGHHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQ-- 254
           A   +RPPGHHS   +  GFCL +N  +A +     Y   V    ILD+D+HHG+GTQ  
Sbjct: 184 AFVALRPPGHHSHTSTPSGFCLLNNAHIAVEYAASRY--GVTHAAILDFDLHHGDGTQDI 241

Query: 255 ----KAFYNDD-------------------NVLYISLHRF-----ELGKYYPGTIQG--- 283
                 F  DD                    V Y SLH       E G  +  +I+    
Sbjct: 242 CWKRAGFKPDDEEDNAAEYDDFGKRFAEFPKVGYFSLHDINSFPTEQGYAHKTSIKDASV 301

Query: 284 -----------QYDQTGEGKGEGFNCNITWPIGAV-GDAEYMWAFEQVVMPMSREFQPDL 331
                          T     E FN        A+   A+      Q  M    +    L
Sbjct: 302 CIMDSHDVNIWNIHLTAYETEEEFNKLYQTKYRAIFAKADEFLRVSQKRMASEGKNYKGL 361

Query: 332 VIISSGFDAADGDTIGQ----CHVSPSCYGHMTHMLKSLA----RGNLCVVLEGGYNLDA 383
           +IIS+GFDA++ + +       HV  S Y   T     LA    +G L  +LEGGY+  A
Sbjct: 362 IIISAGFDASEHEQLSMQRHGVHVPTSFYCAFTKDALKLAQMHTQGKLLSLLEGGYSDAA 421

Query: 384 IARSALS 390
           +     S
Sbjct: 422 LVSGVFS 428

>Ecym_8290 Chr8 complement(589795..591924) [2130 bp, 709 aa] {ON}
           similar to Ashbya gossypii ADL265W
          Length = 709

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 65/134 (48%), Gaps = 13/134 (9%)

Query: 132 ILEVHSIEHFKYLEKTSNDNREQL-LKETE-----NGDSVYFNNDSFQSAKLSCGGAIEA 185
           +L+VH  +  K L +     +E++  K+ E     N   +Y   ++  + + S G     
Sbjct: 108 VLKVHGSDWPKELLRLCRGAKEKIGRKQVEVPDEWNVGDIYLCEETVYALRGSIGAVEYG 167

Query: 186 CKAVVEGRVK-----NAMAVVRPPGHHSEPESAGGFCLFSNVAVATKNILKNYPESVRKV 240
             ++ +G V       A   +RPPGHHS   +  GFCL +N  +A +     Y   V   
Sbjct: 168 VDSIFKGEVNKDTANRAFVAIRPPGHHSHAATPSGFCLLNNAHIAVEYAADTY--GVTHA 225

Query: 241 LILDWDIHHGNGTQ 254
           +ILD+D+HHG+GTQ
Sbjct: 226 VILDFDLHHGDGTQ 239

>Suva_16.194 Chr16 (339127..341226) [2100 bp, 699 aa] {ON} YPL116W
           (REAL)
          Length = 699

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 54/102 (52%), Gaps = 7/102 (6%)

Query: 158 ETENGDSVYFNNDSFQSAKLSCGGAIEACKAVVEG----RVKN-AMAVVRPPGHHSEPES 212
           +T N   +Y ++ + Q+ + + G       ++ +G     + N A   +RPPGHH    +
Sbjct: 142 DTWNSGDIYLSSKTIQALQGTIGAIETGVDSIFKGPSPEHISNRAFVAIRPPGHHCHYAT 201

Query: 213 AGGFCLFSNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQ 254
             GFCL +N  VA +     Y   V  V++LD+D+HHG+GTQ
Sbjct: 202 PSGFCLLNNAHVAIEYAFDTY--DVTHVVVLDFDLHHGDGTQ 241

>KAFR0H02790 Chr8 complement(531813..533966) [2154 bp, 717 aa] {ON}
           Anc_8.607 YPL116W
          Length = 717

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 49/102 (48%), Gaps = 7/102 (6%)

Query: 158 ETENGDSVYFNNDSFQSAKLSCGGAIEACKAVVEGR-----VKNAMAVVRPPGHHSEPES 212
           E+ N   +Y N+D+  + K S G       ++  G         A   +RPPGHH     
Sbjct: 141 ESWNAGDIYLNSDTIMALKGSIGAIETGVDSIFNGPSPEHICNRAFVAIRPPGHHCHVGM 200

Query: 213 AGGFCLFSNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQ 254
             GFCL +N  +  +     Y   V  V++LD+D+HHG+GTQ
Sbjct: 201 PSGFCLLNNANITIEYAANTY--GVTHVVVLDFDLHHGDGTQ 240

>NCAS0C01760 Chr3 (324446..326548) [2103 bp, 700 aa] {ON} Anc_8.607
           YPL116W
          Length = 700

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 66/134 (49%), Gaps = 13/134 (9%)

Query: 132 ILEVHSIEHFKYLEKTSNDNREQLLK------ETENGDSVYFNNDSFQSAKLSCGGAIEA 185
           + +VH  E  K + +   +  E+L K      E+ N   +Y ++ + Q+ + + G     
Sbjct: 108 VYKVHGKEWPKEVIQLCKEADEKLAKGEIEVPESWNAGDIYLSSKTIQALQGTIGALETG 167

Query: 186 CKAVVEG----RVKN-AMAVVRPPGHHSEPESAGGFCLFSNVAVATKNILKNYPESVRKV 240
             ++ +G     + N A   +RPPGHH    +  GFCL +N  VA +     Y   V  V
Sbjct: 168 VDSIFKGPSADHISNRAFVAIRPPGHHCHFATPSGFCLLNNAHVAIEYAADTY--GVTHV 225

Query: 241 LILDWDIHHGNGTQ 254
            +LD+D+HHG+GTQ
Sbjct: 226 AVLDFDLHHGDGTQ 239

>Smik_6.315 Chr6 complement(492590..494683) [2094 bp, 697 aa] {ON}
           YPL116W (REAL)
          Length = 697

 Score = 64.3 bits (155), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 55/102 (53%), Gaps = 7/102 (6%)

Query: 158 ETENGDSVYFNNDSFQSAKLSCGGAIEACKAVVEG----RVKN-AMAVVRPPGHHSEPES 212
           +T N   +Y ++ + ++ + + G       ++ EG     + N A   +RPPGHH    +
Sbjct: 142 DTWNSGDIYLSSKTIKALQGTIGAIETGVDSIFEGPSAEHISNRAFVAIRPPGHHCHYAT 201

Query: 213 AGGFCLFSNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQ 254
             GFCL +N  VA +     Y  +V  V++LD+D+HHG+GTQ
Sbjct: 202 PSGFCLLNNAHVAIEYAYDTY--NVTHVVVLDFDLHHGDGTQ 241

>KLLA0F00858g Chr6 complement(78519..80666) [2148 bp, 715 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 715

 Score = 64.3 bits (155), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 53/110 (48%), Gaps = 7/110 (6%)

Query: 150 DNREQLLKETENGDSVYFNNDSFQSAKLSCGGAIEACKAV-----VEGRVKNAMAVVRPP 204
           DN E  +    N   +Y +  +  + + S G       ++     VE     A   +RPP
Sbjct: 131 DNEEVEVPPDWNVGDIYLSKHTIAALEGSIGALEIGVDSIFQGVSVEQTANRAFIAIRPP 190

Query: 205 GHHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQ 254
           GHHS   +  GFCL +N  +A +   + Y   V   +ILD+D+HHG+GTQ
Sbjct: 191 GHHSHASTPSGFCLLNNAHIAIEYAFEKY--DVTHAVILDFDLHHGDGTQ 238

 Score = 33.5 bits (75), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 35/68 (51%), Gaps = 8/68 (11%)

Query: 331 LVIISSGFDAADGDTIG-QCH---VSPSCYGHMTHMLKSLAR----GNLCVVLEGGYNLD 382
           LV+IS+GFDA++ +    Q H   V  S Y   T     LA+    G +  V+EGGY+  
Sbjct: 368 LVVISAGFDASEYEQQSMQRHNVNVPTSFYNLFTKDALKLAQMHSNGKIISVMEGGYSDG 427

Query: 383 AIARSALS 390
           AIA    S
Sbjct: 428 AIASGVFS 435

>KLTH0D09592g Chr4 complement(792708..794825) [2118 bp, 705 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 705

 Score = 64.3 bits (155), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 38/136 (27%), Positives = 66/136 (48%), Gaps = 13/136 (9%)

Query: 130 NEILEVHSIEHFKYLEKTSNDNREQL------LKETENGDSVYFNNDSFQSAKLSCGGAI 183
           + +L+VH  +  + L K   ++++ L      + E+ N   +Y +  +  + + S G   
Sbjct: 107 DHVLKVHGSDWPQELLKLCKNSQKALDQCQVEVPESWNVGDIYLSRQTISALEGSIGALE 166

Query: 184 EACKAV-----VEGRVKNAMAVVRPPGHHSEPESAGGFCLFSNVAVATKNILKNYPESVR 238
               ++     VE     A   +RPPGHHS   +  GFCL +N  +A +     Y   V 
Sbjct: 167 TGVDSIFHGPSVEQTSNRAFVALRPPGHHSHASTPSGFCLLNNAHIAIEYAADTY--GVT 224

Query: 239 KVLILDWDIHHGNGTQ 254
             ++LD+D+HHG+GTQ
Sbjct: 225 HAVVLDFDLHHGDGTQ 240

>NDAI0E02480 Chr5 (512966..515020) [2055 bp, 684 aa] {ON} Anc_8.607
           YPL116W
          Length = 684

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/99 (33%), Positives = 53/99 (53%), Gaps = 7/99 (7%)

Query: 161 NGDSVYFNNDSFQSAKLSCGGAIEACKAVVEG----RVKN-AMAVVRPPGHHSEPESAGG 215
           N   +Y ++ + Q+ + S G    A  ++ +G     + N A   +RPPGHH    +  G
Sbjct: 143 NSGDIYLSSKTVQALQGSIGALETAVDSIFKGPSPEHISNRAFVAIRPPGHHCHFATPSG 202

Query: 216 FCLFSNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQ 254
           FC+ +N  VA +    +Y   V  V +LD+D+HHG+GTQ
Sbjct: 203 FCVLNNAHVAIEYAADSY--DVTHVAVLDFDLHHGDGTQ 239

>TDEL0A05520 Chr1 complement(970572..972596) [2025 bp, 674 aa] {ON}
           Anc_8.607 YPL116W
          Length = 674

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 66/134 (49%), Gaps = 13/134 (9%)

Query: 132 ILEVHSIEHFKYLEKTSNDNREQLLK------ETENGDSVYFNNDSFQSAKLSCGGAIEA 185
           +L+VH  +    L +      E+L K      ++ N   +Y ++ + ++ + S G     
Sbjct: 108 VLKVHGRDWPPTLLRLCKHADEKLAKGEIEVPDSWNSGDIYLSSKTIEALQGSIGALETG 167

Query: 186 CKAVVEG----RVKN-AMAVVRPPGHHSEPESAGGFCLFSNVAVATKNILKNYPESVRKV 240
             ++ EG     V N A  V+RPPGHH    +  GFCL +N  V+ +     Y   +   
Sbjct: 168 VDSIFEGPSPEHVSNRAFVVIRPPGHHCRAGTPSGFCLLNNAHVSIEYAHDTY--GITHA 225

Query: 241 LILDWDIHHGNGTQ 254
           ++LD+D+HHG+GTQ
Sbjct: 226 VVLDFDLHHGDGTQ 239

>Ecym_3465 Chr3 (874618..875955) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL339W
          Length = 445

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 55/234 (23%), Positives = 99/234 (42%), Gaps = 28/234 (11%)

Query: 206 HHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQKAFYNDDNVLY 265
           HH+    A GFC  +++ +  + + KN      +V  +D+D+HHG+  + AF    NV  
Sbjct: 195 HHAFKSRASGFCYINDIVLLIQELRKN---GYSRVSYVDFDLHHGDAVESAFQYSRNVQT 251

Query: 266 ISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNITWPIG-----AVGDAEYMWAFEQVV 320
            SLH FE G ++PGT            G   NC  T  +       + D       + ++
Sbjct: 252 CSLHLFEAG-FFPGT------------GSFKNCRETNVVNIPLFHGLDDESLDEIVDNIL 298

Query: 321 MPMSREFQPDLVIISSGFDAADGDTIGQCHVSPSCYGHMTHMLKSL---ARGNLCVVLEG 377
           +P   +  P++++I  G D   GD   +  +  + +G   ++LK +   +   + ++  G
Sbjct: 299 IPCVNKHDPEVLVIQCGADGLSGDKYKEWQL--TIHGLTRNILKLVDIHSYKKVVLLGGG 356

Query: 378 GYNLDAIARSALSVSKILIGXXXXXXXXXXXXXXXXVIE--MIDKIIRLQSKYW 429
           GYN    +R    V+  L+                 +IE  +ID   +   K+W
Sbjct: 357 GYNPTLQSRFYTYVTVCLLKYHKGIPSLISDSEDEHIIEHHLIDFYRKEAYKFW 410

>TBLA0E04080 Chr5 complement(1026669..1028753) [2085 bp, 694 aa]
           {ON} Anc_8.607 YPL116W
          Length = 694

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 71/292 (24%), Positives = 115/292 (39%), Gaps = 60/292 (20%)

Query: 151 NREQLLKETENGDSVYFNNDSFQSAKLSCGGAIEACKAVVEGR-----VKNAMAVVRPPG 205
           N E  + +  N   +Y ++ + ++ + S         ++  G         A   +RPPG
Sbjct: 136 NNEIEVPDNWNAGDIYLSSKTIEALEGSIAAIETGIDSIFNGPSPEHICNRAFVAIRPPG 195

Query: 206 HHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQ----------- 254
           HH +  +  GFCL +N  ++ +    +Y   +   +ILD+D+HHG+GTQ           
Sbjct: 196 HHCKVATPSGFCLLNNAHISIEYAADHY--GITHAVILDFDLHHGDGTQDICWKRAGFRS 253

Query: 255 --------------KAFYNDDNVLYISLH---RFELGKYYPGTIQGQYDQTGEGKGEGFN 297
                         K F     V Y S+H    F     Y   +  +   T    G   N
Sbjct: 254 EDEPEGSEGYDDFGKKFAEFPKVGYFSMHDINSFPTETGYATKVNIRNASTCIMDGHDLN 313

Query: 298 C-NITW-PIGAVGDAEYMWA-------------FEQVVMPMSREFQP--DLVIISSGFDA 340
             NI   P     D + ++              F      M++E +P   LV+IS+GFDA
Sbjct: 314 IWNIHLSPWNTEEDFQKLYQSKYRTLFAKADDYFRNAKYQMAQEGKPFKGLVVISAGFDA 373

Query: 341 ADGD-TIGQCH---VSPSCYGHMTHMLKSLA----RGNLCVVLEGGYNLDAI 384
           ++ + T  Q H   V  + Y   T     LA    +G +  +LEGGY+  A+
Sbjct: 374 SEYEQTSMQRHNVNVPTNFYTMFTKDALKLAQIHCQGKVLSLLEGGYSDKAL 425

>Kwal_26.8505 s26 complement(815901..818027) [2127 bp, 708 aa] {ON}
           YPL116W (HOS3) - sequence similar to the histone
           deacetylase Hda1p [contig 61] FULL
          Length = 708

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 64/136 (47%), Gaps = 13/136 (9%)

Query: 130 NEILEVHSIEHFKYLEKTSNDNREQL------LKETENGDSVYFNNDSFQSAKLSCGGAI 183
           + +L+VH  +    L K    +++ L      + E+ N   +Y +  +  + + S G   
Sbjct: 109 DHVLKVHGADWPHELLKLCQQSQKALDRGEVEVPESWNVGDIYLSQQTIGALEGSIGALE 168

Query: 184 EACKAVVEGRVK-----NAMAVVRPPGHHSEPESAGGFCLFSNVAVATKNILKNYPESVR 238
               ++  G         A   +RPPGHHS   +  GFCL +N  +A +     Y  +V 
Sbjct: 169 TGIDSIFAGPTPEETSNRAFVALRPPGHHSHASTPSGFCLLNNAHIAIEYAADTY--NVT 226

Query: 239 KVLILDWDIHHGNGTQ 254
             ++LD+D+HHG+GTQ
Sbjct: 227 HAVVLDFDLHHGDGTQ 242

>Skud_16.164 Chr16 (301141..303234) [2094 bp, 697 aa] {ON} YPL116W
           (REAL)
          Length = 697

 Score = 62.0 bits (149), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 66/134 (49%), Gaps = 13/134 (9%)

Query: 132 ILEVHSIEHFKYLEKTSNDNREQLLK------ETENGDSVYFNNDSFQSAKLSCGGAIEA 185
           + +VH       L K   +   +LLK      +T N   +Y ++ + ++ + + G     
Sbjct: 110 VFKVHGSHWPAELIKLCQEADSKLLKGEIEVPDTWNSGDIYLSSKTIKALQGTIGAIETG 169

Query: 186 CKAVVEG----RVKN-AMAVVRPPGHHSEPESAGGFCLFSNVAVATKNILKNYPESVRKV 240
             ++ +G     + N A   +RPPGHH    +  GFCL +N  VA +     Y  +V  V
Sbjct: 170 VDSIFKGPSPEHISNRAFVAIRPPGHHCHYATPSGFCLLNNAHVAIEYAHDAY--NVTHV 227

Query: 241 LILDWDIHHGNGTQ 254
           ++LD+D+HHG+GTQ
Sbjct: 228 VVLDFDLHHGDGTQ 241

>YPL116W Chr16 (329606..331699) [2094 bp, 697 aa] {ON}
           HOS3Trichostatin A-insensitive homodimeric histone
           deacetylase (HDAC) with specificity in vitro for
           histones H3, H4, H2A, and H2B; similar to Hda1p, Rpd3p,
           Hos1p, and Hos2p; deletion results in increased histone
           acetylation at rDNA repeats
          Length = 697

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 55/102 (53%), Gaps = 7/102 (6%)

Query: 158 ETENGDSVYFNNDSFQSAKLSCGGAIEACKAVVEG----RVKN-AMAVVRPPGHHSEPES 212
           +T N   +Y ++ + ++ + + G       ++ +G     + N A   +RPPGHH    +
Sbjct: 142 DTWNSGDIYLSSKTIKALQGTIGAIETGVDSIFKGPSAEHISNRAFVAIRPPGHHCHYGT 201

Query: 213 AGGFCLFSNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQ 254
             GFCL +N  VA +     Y  +V  V++LD+D+HHG+GTQ
Sbjct: 202 PSGFCLLNNAHVAIEYAYDTY--NVTHVVVLDFDLHHGDGTQ 241

>TPHA0A01120 Chr1 (216522..218618) [2097 bp, 698 aa] {ON} Anc_8.607
           YPL116W
          Length = 698

 Score = 61.6 bits (148), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 57/109 (52%), Gaps = 7/109 (6%)

Query: 151 NREQLLKETENGDSVYFNNDSFQSAKLSCGGAIEACKAVVEG----RVKN-AMAVVRPPG 205
           N E  + ++ N   +Y ++++ ++ + S G       ++  G     + N A   +RPPG
Sbjct: 135 NGEIEVPDSWNSGDIYLSSETIKAIEGSIGALELGLDSIFHGPSAEHISNRAFVAIRPPG 194

Query: 206 HHSEPESAGGFCLFSNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQ 254
           HH    +  GFCL +N  +A +   + Y   V   +ILD+D+HHG+GTQ
Sbjct: 195 HHCHVSTPSGFCLLNNAQIAIEYAYEKY--GVSHAVILDFDLHHGDGTQ 241

 Score = 35.4 bits (80), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 42/79 (53%), Gaps = 9/79 (11%)

Query: 320 VMPMSREFQPDLVIISSGFDAADGD-TIGQCH---VSPSCYGHMTHMLKSLAR----GNL 371
           +  M++ F+  LV+IS+GFDA++ + T  Q H   V  S Y   T     LA+    G +
Sbjct: 357 MQEMNKPFK-GLVVISAGFDASEFEQTSMQRHSVNVPTSFYTTFTKDALKLAQLHCNGKV 415

Query: 372 CVVLEGGYNLDAIARSALS 390
             VLEGGY+  AIA    S
Sbjct: 416 LSVLEGGYSDKAIASGVFS 434

>ZYRO0F10780g Chr6 complement(879680..881686) [2007 bp, 668 aa] {ON}
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116W HOS3 Trichostatin A-insensitive homodimeric
           histone deacetylase (HDAC)
          Length = 668

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 51/99 (51%), Gaps = 7/99 (7%)

Query: 161 NGDSVYFNNDSFQSAKLSCGGAIEACKAVVEG----RVKN-AMAVVRPPGHHSEPESAGG 215
           N   +Y ++ + ++ + S G    A  ++ +G     + N A   +RPPGHH    +  G
Sbjct: 141 NAGDIYLSSKTVEALQGSIGALETAVDSIFDGPSPEHISNRAFVAIRPPGHHCHVATPSG 200

Query: 216 FCLFSNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQ 254
           FCL +N  VA +     +   V    ILD+D+HHG+GTQ
Sbjct: 201 FCLLNNAHVAIEYAKDRF--GVTHAAILDFDLHHGDGTQ 237

>Kpol_479.6 s479 complement(10892..12958) [2067 bp, 688 aa] {ON}
           complement(10892..12958) [2067 nt, 689 aa]
          Length = 688

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 51/99 (51%), Gaps = 7/99 (7%)

Query: 161 NGDSVYFNNDSFQSAKLSCGGAIEACKAVVEG----RVKN-AMAVVRPPGHHSEPESAGG 215
           N   +Y ++ + ++ + S G       ++  G     + N A   +RPPGHH   ++  G
Sbjct: 144 NAGDIYLSSRTIEALQGSIGALETGVDSIFSGPSPDHISNRAFVAIRPPGHHCHVDTPSG 203

Query: 216 FCLFSNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQ 254
           FCL +N  +A +     Y   +   +ILD+D+HHG+GTQ
Sbjct: 204 FCLLNNAHIAIEYASDTY--GITHAVILDFDLHHGDGTQ 240

>CAGL0J06974g Chr10 (667811..669847) [2037 bp, 678 aa] {ON} highly
           similar to uniprot|Q02959 Saccharomyces cerevisiae
           YPL116w HOS3
          Length = 678

 Score = 58.2 bits (139), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 64/134 (47%), Gaps = 13/134 (9%)

Query: 132 ILEVHSIEHFKYLEKTSNDNREQLLK-ETE-----NGDSVYFNNDSFQSAKLSCGGAIEA 185
           +L+VH  E  + L +    +  +L + E E     N   +Y  + + ++ + + G     
Sbjct: 106 VLKVHGSEWPRTLLQLCKQSDSKLARGEVEVPDNWNAGDIYLTSRTIEALQGTIGAVETG 165

Query: 186 CKAVVEG----RVKNAMAV-VRPPGHHSEPESAGGFCLFSNVAVATKNILKNYPESVRKV 240
             ++  G     + N + V +RPPGHH    +  GFCL +N  +  +     Y   V   
Sbjct: 166 VDSIFSGPSLEHISNRVFVAIRPPGHHCHYATPSGFCLLNNAHIGIEYAADKY--GVTHA 223

Query: 241 LILDWDIHHGNGTQ 254
           +ILD+D+HHG+GTQ
Sbjct: 224 VILDFDLHHGDGTQ 237

>KNAG0J01300 Chr10 (232784..234817) [2034 bp, 677 aa] {ON} Anc_8.607
           YPL116W
          Length = 677

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 51/106 (48%), Gaps = 8/106 (7%)

Query: 154 QLLKETENGDSVYFNNDSFQSAKLSCGGAIEACKAVVEGRVKNAMA-----VVRPPGHHS 208
           ++ KE   GD +Y ++ +  + + + G        +  G     ++     VVRPPGHH 
Sbjct: 136 EVPKEWNAGD-IYLSSATLTALRGTIGALETGVDTIFTGASPEHISNRVFVVVRPPGHHC 194

Query: 209 EPESAGGFCLFSNVAVATKNILKNYPESVRKVLILDWDIHHGNGTQ 254
                 GFCL +N  ++ +     Y   V    ILD+D+HHG+GTQ
Sbjct: 195 HVTGPSGFCLLNNAHISIEYAADTY--GVTHAAILDFDLHHGDGTQ 238

>TPHA0M01590 Chr13 complement(332934..334418) [1485 bp, 494 aa] {ON}
           Anc_3.362 YPR068C
          Length = 494

 Score = 56.2 bits (134), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 70/143 (48%), Gaps = 12/143 (8%)

Query: 206 HHSEPESAGGFCLFSNVAVATKNILKNYPESV---RKVLILDWDIHHGNGTQKAFYNDDN 262
           HH+    A GFC  +++ V+  N L+  P      RK+  +D D+HHG+G + AF    +
Sbjct: 206 HHAMKSRANGFCYINDI-VSLINELRKTPGQQGHKRKLTYIDLDLHHGDGVENAFNYSKD 264

Query: 263 VLYISLHRFELGKYYPGTIQGQYDQTGEGKGEGFNCNITWPIG-AVGDAEYMWAFEQVVM 321
           +  IS+H FE G +YP T   ++     GK +  N  I  P+   + ++        +++
Sbjct: 265 IQIISIHLFEPG-FYPCTGGLKF-----GKPKSNNI-INLPVKHGLSNSNMFELVTNIII 317

Query: 322 PMSREFQPDLVIISSGFDAADGD 344
           P+    Q D ++I  G D  + D
Sbjct: 318 PLIELHQSDDIVILCGGDGLNND 340

>Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON}
           (29882..31981) [2100 nt, 700 aa]
          Length = 699

 Score = 35.4 bits (80), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 53/99 (53%), Gaps = 6/99 (6%)

Query: 62  CYDVRMRYHAKIFTSYFEYIDPHPEDPRRIYRIYKILAENGLINDPTLSGVDNIGDLMLK 121
            YD +++Y   +   + + ++   E+    Y+  K   E+ L +    S +DNI DLM +
Sbjct: 379 VYD-KVQYDQSVHQRWLDNLETTEEEK---YQNKKTEYEDNLAD--IQSKIDNIHDLMDE 432

Query: 122 LPIREATMNEILEVHSIEHFKYLEKTSNDNREQLLKETE 160
           L ++ +   E++E   +++   + +T ND++ ++ KETE
Sbjct: 433 LKLKTSQKIEVMEYQLVKNILDMTQTHNDSKNKIFKETE 471

>TBLA0G01400 Chr7 complement(370536..371594) [1059 bp, 352 aa] {ON}
           Anc_4.133 YLR316C
          Length = 352

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 69/149 (46%), Gaps = 28/149 (18%)

Query: 84  HPEDPRRI-YRIYKILAENGLINDPT-LSGVDNIGDLMLKLPIREATMNEILEVHSIEHF 141
           +P D + I Y +   +AENG+  D + ++G+  + DL +K   R A M+           
Sbjct: 205 NPNDSKNIIYSMDTRVAENGIPTDHSIMNGIKKVADLEVK---RRALMS----------- 250

Query: 142 KYLEKTSNDNREQLLKETENGDS-VYFNNDSFQSAKLSCGGAIEACKAVVEGRVKNAMAV 200
               K+   N  Q+  + +N  + + FN D + + +     ++    A+V  R+K  +  
Sbjct: 251 ----KSDLSNEHQVNDDIKNHQTYLCFNFDIYTTHEPCSMCSM----ALVHSRIK-RLIF 301

Query: 201 VRPPGHHS--EPESAGGFCLFSNVAVATK 227
           ++P       +PES  GFC+ SN  + +K
Sbjct: 302 IKPMVKTGTLKPESGKGFCMHSNKLLNSK 330

>KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly
           similar to uniprot|P52960 Saccharomyces cerevisiae
           YOR363C PIP2 peroxisome induction pathway 2 (PIP2)
           transcriptional activator of peroxisome proliferation
           may form heterodimer with Oaf1 to activate
           oleate-inducible gene expression activator of peroxisome
           proliferation
          Length = 847

 Score = 33.1 bits (74), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 52/105 (49%), Gaps = 7/105 (6%)

Query: 92  YRIYKILAENGLINDPTLSGVDNIGDLMLKLPIREATMNEILEVHSIEHFKYLEKTSNDN 151
           Y + KIL   G   DP    ++++ +++   P     + E+L+ HS+      ++T+N  
Sbjct: 168 YAVKKILQSVGDSLDPHSDELESVAEILFLTP----QVREVLKQHSMNPEGITQETANAI 223

Query: 152 REQLLKETENGD--SVYFNND-SFQSAKLSCGGAIEACKAVVEGR 193
           R  LL++   GD  S++   D  F S+K+S    I+   AV+  R
Sbjct: 224 RRCLLEKGSRGDEKSLFEPVDLEFSSSKISQAELIDQIVAVLPPR 268

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 85,969,344
Number of extensions: 3943085
Number of successful extensions: 13701
Number of sequences better than 10.0: 115
Number of HSP's gapped: 13804
Number of HSP's successfully gapped: 139
Length of query: 795
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 677
Effective length of database: 39,950,811
Effective search space: 27046699047
Effective search space used: 27046699047
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 70 (31.6 bits)