Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0B069402.284ON1443144355180.0
SAKL0E07722g2.284ON79131511591e-140
TDEL0G021502.284ON66133311441e-139
KLLA0E08405g2.284ON77731611501e-139
Kwal_27.115422.284ON79132711341e-136
Ecym_33232.284ON74833011231e-135
TPHA0C033802.284ON69734711141e-135
KLTH0G10318g2.284ON79034711221e-135
KAFR0J013702.284ON78032311201e-134
KAFR0H033302.284ON36934110801e-134
Suva_9.1042.284ON80533611211e-134
NDAI0B035602.284ON75631711131e-134
NCAS0B062602.284ON72332511091e-134
ADL217W2.284ON75031711051e-133
NCAS0G038102.284ON66131310951e-132
ZYRO0A01848g2.284ON70434110981e-132
NDAI0G006402.284ON62133210831e-131
Smik_9.842.284ON80832210971e-131
YIL095W (PRK1)2.284ON81032110931e-130
Skud_14.3092.284ON63940710781e-130
YNL020C (ARK1)2.284ON63833610771e-130
Skud_9.782.284ON80932210821e-129
TBLA0B059302.284ON71734310741e-129
CAGL0G02607g2.284ON68831710701e-128
Smik_14.3112.284ON63734610651e-128
Kpol_1003.352.284ON71331510711e-128
Suva_14.3272.284ON63235110631e-128
Kpol_1039.332.284ON70133410681e-128
CAGL0J03432g2.284ON62232710451e-126
KNAG0H020202.284ON59234010261e-123
KNAG0A054302.284ON7883249931e-116
TPHA0D015402.284ON7073159841e-116
KNAG0H012203.273ON9133207697e-85
KAFR0A010403.273ON9123437625e-84
CAGL0H10208g3.273ON10273187606e-83
KAFR0C004303.273ON9493227541e-82
KLTH0C07260g3.273ON9013147483e-82
Kwal_27.109453.273ON9353147494e-82
SAKL0D03234g3.273ON8583137445e-82
Kpol_251.43.273ON8383367355e-81
ZYRO0E06864g3.273ON11153177451e-80
NCAS0A105903.273ON10953167432e-80
Kpol_1052.223.273ON11013117371e-79
Smik_2.1913.273ON11083447362e-79
Suva_4.2973.273ON11073177343e-79
TDEL0D035203.273ON10493177314e-79
Ecym_26503.273ON8943117235e-79
KNAG0J008203.273ON10913167325e-79
NDAI0A057003.273ON11573257337e-79
TPHA0A040303.273ON10543617298e-79
YBR059C (AKL1)3.273ON11083447291e-78
Skud_2.1793.273ON10903177263e-78
TBLA0E025903.273ON10613147244e-78
KLLA0F18612g3.273ON8142937072e-77
CAGL0K11990g3.273ON9913227134e-77
TBLA0I019303.273ON13613147236e-77
TPHA0M011203.273ON7883456937e-76
AGR027C3.273ON9613076876e-74
KLTH0H03080g6.262ON3463322382e-20
SAKL0A03344g6.262ON3643552374e-20
Kpol_1037.206.31ON7042952436e-20
Kwal_33.131121.24ON5052762399e-20
Skud_16.426.262ON3643342322e-19
TDEL0G043806.31ON7222952392e-19
YPL236C (ENV7)6.262ON3643372312e-19
Smik_6.4416.262ON3643342303e-19
KAFR0A050906.31ON6682422355e-19
TDEL0A067506.262ON3723462286e-19
ZYRO0C07480g6.31ON7743012357e-19
TBLA0D022308.141ON11543582367e-19
KNAG0E008506.31ON7112772331e-18
Kpol_2002.241.24ON4873302301e-18
KNAG0F001701.24ON5433292311e-18
Kwal_56.242746.262ON3463272241e-18
TBLA0B004906.31ON7873252322e-18
Skud_13.1546.31ON7052772302e-18
Suva_16.706.262ON3643362233e-18
Suva_13.1636.31ON7052772293e-18
YMR001C (CDC5)6.31ON7052772293e-18
Smik_13.1596.31ON7052772284e-18
TPHA0J004206.31ON7072952284e-18
TBLA0A047207.86ON12622342295e-18
KAFR0G026906.31ON7132772275e-18
CAGL0J11638g6.31ON7462782251e-17
ZYRO0E07876g6.262ON3693452181e-17
TPHA0E038501.24ON4823102211e-17
Kwal_27.11544singletonOFF1771752052e-17
KLLA0E21693g5.406ON10163232232e-17
SAKL0H06754g8.668ON8842052223e-17
NCAS0D021006.31ON7262772213e-17
KAFR0G012001.24ON5072322183e-17
ZYRO0F18062g1.24ON4713292165e-17
NDAI0C026806.31ON7502792195e-17
NCAS0G012106.262ON3673452127e-17
Ecym_10301.24ON4402862147e-17
Ecym_21536.262ON3633092101e-16
Kwal_47.183075.591ON6212782151e-16
ACL006W6.31ON7082772151e-16
ZYRO0D05500g7.86ON12621792152e-16
AFR724C1.24ON4402862102e-16
SAKL0C00946g1.24ON5642792122e-16
NCAS0C041208.140ON9152632133e-16
SAKL0E01584g6.31ON6953002123e-16
KLLA0C06138g6.31ON7082772114e-16
KLTH0F00946g1.24ON5121962094e-16
TDEL0C067801.24ON4682412085e-16
Kwal_55.215455.406ON8652662107e-16
NDAI0F045201.24ON4892782077e-16
Ecym_30356.31ON7402772098e-16
TBLA0A074601.24ON5162732061e-15
Kpol_1072.198.668ON8961972081e-15
Suva_16.1608.668ON9181972081e-15
TBLA0A035705.406ON9752702081e-15
NCAS0A002801.24ON5352832052e-15
Suva_15.2975.406ON10742982072e-15
TPHA0F024306.31ON7982942062e-15
YGL179C (TOS3)8.140ON5602162042e-15
Kpol_1023.266.31ON7392752052e-15
CAGL0F00913g7.86ON12061692062e-15
TPHA0G016308.668ON8712372053e-15
KLTH0F16676g5.406ON8782662053e-15
TBLA0H016605.406ON9962972044e-15
TPHA0H016305.406ON10363092044e-15
TDEL0H036407.86ON12371842044e-15
KAFR0C030208.140ON5183352014e-15
Kwal_26.87518.668ON8482012034e-15
CAGL0M02299g8.668ON8932982035e-15
TBLA0B082503.92ON13472022036e-15
CAGL0L11550g5.406ON10723022027e-15
KNAG0D048107.86ON14401772028e-15
KNAG0F029006.31ON6492592008e-15
ZYRO0F07194g8.668ON9381972018e-15
TDEL0A045805.591ON6942841991e-14
Smik_7.938.140ON5632151981e-14
CAGL0K02167g8.140ON11622712001e-14
ZYRO0D06776g8.279ON12042132001e-14
AFL101C6.222ON3672701941e-14
KAFR0K007007.86ON13812282001e-14
NCAS0B044906.222ON3493071931e-14
NCAS0C016708.668ON8961981991e-14
TBLA0A020506.222ON4342481952e-14
Ecym_73922.479ON14343471992e-14
KAFR0H025108.668ON8792011982e-14
KNAG0B043205.406ON10272791982e-14
Kpol_1031.105.406ON11272771982e-14
Kwal_26.71547.86ON12131661982e-14
Skud_8.1635.406ON10762681973e-14
KLTH0D02486g7.86ON12232311973e-14
KLLA0F07623g7.86ON12292341973e-14
Suva_6.1691.271ON14842921973e-14
YPL150W8.668ON9011971963e-14
KAFR0D049505.406ON10082921963e-14
ABL034W2.479ON14253231964e-14
KLLA0F11319g8.668ON8431981954e-14
KLTH0D11044g8.668ON8492011954e-14
Kpol_1072.298.654ON8932661954e-14
Skud_7.928.140ON5632131935e-14
Skud_16.1328.668ON9241971945e-14
TBLA0B038608.668ON9882281946e-14
Smik_8.1805.406ON10732681946e-14
Suva_7.838.140ON5692051926e-14
Ecym_24058.668ON8552011937e-14
Smik_6.3478.668ON9171971937e-14
CAGL0G04609g3.92ON9652041937e-14
KAFR0D012207.86ON10552181938e-14
KLLA0F13552g2.479ON12672611938e-14
Smik_10.1471.271ON14782921939e-14
Suva_11.1232.479ON15262501939e-14
ACR133C8.668ON8512291929e-14
SAKL0G01848g5.406ON8852851929e-14
KLTH0C10912g6.31ON6972771911e-13
CAGL0L03520g1.271ON14473001921e-13
CAGL0H01639g1.24ON5212881891e-13
KAFR0C014403.92ON10953521911e-13
NDAI0E023908.668ON8831971902e-13
SAKL0A04246g6.222ON4002861862e-13
KNAG0C024401.182ON4011921862e-13
YHR102W (KIC1)5.406ON10802681902e-13
Kwal_56.224766.31ON6972931892e-13
KAFR0B028008.279ON10952121902e-13
Smik_4.7673.92ON7583321892e-13
Ecym_26407.86ON13251771902e-13
Kpol_1065.36.222ON3762771842e-13
ACR281C7.86ON12592281892e-13
Kwal_56.240916.222ON3812731842e-13
TBLA0C046008.279ON13152151892e-13
Skud_10.1191.271ON14812921893e-13
NDAI0C017005.406ON10202701883e-13
TDEL0F040608.279ON11262131883e-13
YDR490C (PKH1)3.92ON7662051873e-13
YJL095W (BCK1)1.271ON14782921883e-13
CAGL0K08514g2.479ON14892591883e-13
CAGL0B01925g8.279ON9442141865e-13
KLTH0G05214g5.591ON6532851855e-13
NCAS0H019405.406ON10152731865e-13
TBLA0B039908.652ON7132271855e-13
CAGL0M11396g8.279ON11922151865e-13
TPHA0J008208.279ON12182241865e-13
CAGL0H06259g7.86ON13361631866e-13
YAL017W (PSK1)7.86ON13561631866e-13
NDAI0H024707.86ON14111671866e-13
ACL104C5.406ON9473491856e-13
CAGL0E05720g6.222ON3582821806e-13
KLTH0C09548g3.92ON9931971857e-13
CAGL0H00979g6.262ON3991511817e-13
TPHA0H004208.140ON10382571857e-13
KLTH0G13288g8.279ON11422151857e-13
Suva_16.976.222ON3681901807e-13
NDAI0F016006.222ON4122851817e-13
TPHA0I009201.271ON14342601857e-13
Kpol_1044.37.86ON9321781848e-13
ZYRO0A06446g5.406ON9433341848e-13
NCAS0B037408.279ON10491901849e-13
SAKL0H16632g8.279ON10622131849e-13
NCAS0I004707.86ON10822341849e-13
Ecym_21946.222ON3662751799e-13
Skud_3.1656.371ON7162771839e-13
SAKL0B09856g7.86ON12742311849e-13
Kpol_463.81.271ON14473101841e-12
SAKL0G06402g5.591ON7842921831e-12
YKL101W (HSL1)2.479ON15182781841e-12
Ecym_55055.406ON10033041831e-12
Kpol_1072.318.652ON5262551811e-12
ZYRO0G19052g8.140ON11313341831e-12
NDAI0J012508.279ON11761911831e-12
YPL209C (IPL1)6.222ON3672761781e-12
NDAI0D027502.479ON15152041831e-12
Kwal_56.237178.279ON8582151821e-12
ZYRO0C06776g5.591ON8902781821e-12
TDEL0D053203.92ON10572621822e-12
CAGL0K05709g1.52ON11032011822e-12
NCAS0B050908.279ON12102151822e-12
NDAI0F013406.262ON4061531782e-12
Skud_1.447.86ON13561631822e-12
Smik_1.507.86ON13571631822e-12
TBLA0A071501.52ON13912981822e-12
Smik_11.1392.479ON15342781822e-12
Kpol_1018.545.591ON8342941812e-12
TPHA0E028206.222ON3842841772e-12
Kwal_56.226933.92ON9841971812e-12
KAFR0D041001.52ON11172791812e-12
Ecym_42918.279ON11452211812e-12
Kwal_26.77882.479ON12672621812e-12
NCAS0A057702.479ON14612341812e-12
Kpol_1032.103.162ON7912911802e-12
Kpol_431.92.479ON15522321812e-12
KNAG0K023703.60ON8832171802e-12
AGR058W8.279ON10712281803e-12
Skud_15.1127.86ON11012361803e-12
YOL045W (PSK2)7.86ON11011821803e-12
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= TBLA0B06940
         (4332 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...  2130   0.0  
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...   451   e-140
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...   445   e-139
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...   447   e-139
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...   441   e-136
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...   437   e-135
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...   433   e-135
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...   436   e-135
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...   436   e-134
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...   420   e-134
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...   436   e-134
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...   433   e-134
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...   431   e-134
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...   430   e-133
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...   426   e-132
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...   427   e-132
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284    421   e-131
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...   427   e-131
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...   425   e-130
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...   419   e-130
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...   419   e-130
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...   421   e-129
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...   418   e-129
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...   416   e-128
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...   414   e-128
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....   417   e-128
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...   414   e-128
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...   416   e-128
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...   407   e-126
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...   399   e-123
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...   387   e-116
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...   383   e-116
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...   300   7e-85
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...   298   5e-84
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...   297   6e-83
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...   295   1e-82
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...   292   3e-82
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...   293   4e-82
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...   291   5e-82
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...   287   5e-81
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...   291   1e-80
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...   290   2e-80
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...   288   1e-79
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...   288   2e-79
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...   287   3e-79
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....   286   4e-79
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...   283   5e-79
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...   286   5e-79
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...   286   7e-79
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....   285   8e-79
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...   285   1e-78
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...   284   3e-78
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...   283   4e-78
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...   276   2e-77
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...   279   4e-77
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...   283   6e-77
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...   271   7e-76
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...   269   6e-74
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    96   2e-20
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    96   4e-20
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....    98   6e-20
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...    97   9e-20
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    94   2e-19
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...    97   2e-19
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    94   2e-19
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    93   3e-19
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}             95   5e-19
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    92   6e-19
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...    95   7e-19
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....    96   7e-19
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...    94   1e-18
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    93   1e-18
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...    94   1e-18
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    91   1e-18
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...    94   2e-18
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...    93   2e-18
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    91   3e-18
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...    93   3e-18
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...    93   3e-18
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...    92   4e-18
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...    92   4e-18
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...    93   5e-18
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...    92   5e-18
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...    91   1e-17
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    89   1e-17
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    90   1e-17
Kwal_27.11544 s27 (842997..843530) [534 bp, 177 aa] {OFF} [conti...    84   2e-17
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...    91   2e-17
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...    90   3e-17
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31      90   3e-17
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    89   3e-17
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    88   5e-17
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...    89   5e-17
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    86   7e-17
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...    87   7e-17
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    86   1e-16
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...    87   1e-16
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...    87   1e-16
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...    87   2e-16
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    86   2e-16
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    86   2e-16
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...    87   3e-16
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...    86   3e-16
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...    86   4e-16
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...    85   4e-16
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    85   5e-16
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...    86   7e-16
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    84   7e-16
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...    85   8e-16
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    84   1e-15
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....    85   1e-15
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...    85   1e-15
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...    85   1e-15
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        84   2e-15
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...    84   2e-15
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    84   2e-15
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...    83   2e-15
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....    84   2e-15
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    84   2e-15
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...    84   3e-15
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...    84   3e-15
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...    83   4e-15
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....    83   4e-15
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...    83   4e-15
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    82   4e-15
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    83   4e-15
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...    83   5e-15
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    83   6e-15
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...    82   7e-15
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....    82   8e-15
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}               82   8e-15
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...    82   8e-15
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...    81   1e-14
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...    81   1e-14
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...    82   1e-14
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...    82   1e-14
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...    79   1e-14
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    82   1e-14
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141     79   1e-14
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...    81   1e-14
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}               80   2e-14
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...    81   2e-14
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...    81   2e-14
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...    81   2e-14
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...    81   2e-14
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    81   2e-14
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...    80   3e-14
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    80   3e-14
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...    80   3e-14
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...    80   3e-14
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...    80   3e-14
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....    80   3e-14
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...    80   4e-14
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...    80   4e-14
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...    80   4e-14
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...    80   4e-14
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...    79   5e-14
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...    79   5e-14
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...    79   6e-14
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...    79   6e-14
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...    79   6e-14
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...    79   7e-14
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...    79   7e-14
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...    79   7e-14
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....    79   8e-14
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...    79   8e-14
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...    79   9e-14
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    79   9e-14
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...    79   9e-14
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...    79   9e-14
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...    78   1e-13
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...    79   1e-13
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    77   1e-13
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...    78   1e-13
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...    78   2e-13
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...    76   2e-13
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...    76   2e-13
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...    78   2e-13
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...    77   2e-13
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....    78   2e-13
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...    77   2e-13
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...    78   2e-13
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...    75   2e-13
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...    77   2e-13
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...    75   2e-13
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...    77   2e-13
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...    77   3e-13
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...    77   3e-13
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....    77   3e-13
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...    77   3e-13
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...    77   3e-13
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...    77   3e-13
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...    76   5e-13
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...    76   5e-13
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....    76   5e-13
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    76   5e-13
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...    76   5e-13
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...    76   5e-13
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...    76   6e-13
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...    76   6e-13
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...    76   6e-13
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...    76   6e-13
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...    74   6e-13
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...    76   7e-13
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    74   7e-13
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...    76   7e-13
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...    76   7e-13
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...    74   7e-13
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...    74   7e-13
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....    76   7e-13
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    75   8e-13
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...    75   8e-13
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...    75   9e-13
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...    75   9e-13
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       75   9e-13
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...    74   9e-13
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...    75   9e-13
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...    75   9e-13
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...    75   1e-12
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...    75   1e-12
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...    75   1e-12
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...    75   1e-12
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    74   1e-12
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...    75   1e-12
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...    75   1e-12
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...    73   1e-12
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....    75   1e-12
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...    75   1e-12
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...    75   1e-12
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...    75   2e-12
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...    75   2e-12
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}              75   2e-12
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    73   2e-12
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...    75   2e-12
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...    75   2e-12
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...    75   2e-12
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...    75   2e-12
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...    74   2e-12
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...    73   2e-12
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...    74   2e-12
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...    74   2e-12
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...    74   2e-12
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...    74   2e-12
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...    74   2e-12
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    74   2e-12
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...    74   2e-12
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    74   2e-12
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...    74   3e-12
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...    74   3e-12
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...    74   3e-12
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...    74   3e-12
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...    74   3e-12
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...    72   3e-12
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...    74   3e-12
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    73   3e-12
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...    73   3e-12
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...    72   3e-12
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...    74   4e-12
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}              74   4e-12
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...    74   4e-12
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    72   4e-12
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141     73   4e-12
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...    73   4e-12
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...    73   4e-12
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...    73   5e-12
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...    73   5e-12
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...    73   5e-12
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...    73   5e-12
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....    73   5e-12
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...    71   5e-12
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...    71   5e-12
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...    72   5e-12
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    73   5e-12
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...    73   6e-12
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...    73   6e-12
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    72   6e-12
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...    73   6e-12
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...    73   6e-12
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...    73   6e-12
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...    73   6e-12
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...    73   7e-12
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    73   7e-12
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...    72   7e-12
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...    71   7e-12
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    72   7e-12
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...    72   8e-12
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...    72   8e-12
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...    72   8e-12
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...    72   8e-12
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...    72   9e-12
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    72   9e-12
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...    72   9e-12
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...    72   9e-12
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...    72   9e-12
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...    72   9e-12
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...    72   9e-12
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...    72   9e-12
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141     72   1e-11
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...    72   1e-11
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...    70   1e-11
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...    72   1e-11
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...    72   1e-11
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52     72   1e-11
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...    72   1e-11
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...    72   1e-11
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...    72   1e-11
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...    71   1e-11
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...    71   1e-11
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...    72   1e-11
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...    72   1e-11
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...    71   2e-11
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    70   2e-11
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...    71   2e-11
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...    71   2e-11
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...    70   2e-11
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...    71   2e-11
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...    71   2e-11
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...    71   2e-11
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...    71   2e-11
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...    71   2e-11
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...    71   2e-11
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...    70   2e-11
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182       70   2e-11
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...    71   2e-11
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...    71   2e-11
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    70   2e-11
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...    70   2e-11
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...    71   2e-11
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...    71   2e-11
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...    71   2e-11
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...    71   2e-11
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....    71   3e-11
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...    71   3e-11
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    70   3e-11
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...    69   3e-11
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...    70   3e-11
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...    70   3e-11
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    69   3e-11
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...    70   3e-11
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....    70   3e-11
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....    70   3e-11
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...    70   3e-11
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...    70   3e-11
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...    69   4e-11
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...    70   4e-11
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...    69   4e-11
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    70   4e-11
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    69   4e-11
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...    70   4e-11
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...    70   4e-11
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...    70   4e-11
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    70   4e-11
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...    70   4e-11
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....    70   4e-11
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...    70   4e-11
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...    70   5e-11
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...    69   5e-11
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    70   5e-11
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...    69   5e-11
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...    70   5e-11
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....    70   5e-11
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...    68   5e-11
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...    68   6e-11
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    69   6e-11
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    69   6e-11
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...    69   6e-11
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...    69   6e-11
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...    69   6e-11
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...    69   6e-11
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    69   7e-11
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    68   7e-11
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...    69   7e-11
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...    69   7e-11
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...    69   7e-11
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...    69   8e-11
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    69   8e-11
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...    69   8e-11
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    69   8e-11
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    68   9e-11
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...    68   9e-11
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...    69   9e-11
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....    69   1e-10
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              69   1e-10
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...    69   1e-10
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...    69   1e-10
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...    67   1e-10
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...    69   1e-10
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...    69   1e-10
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    69   1e-10
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...    69   1e-10
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...    69   1e-10
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...    69   1e-10
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...    69   1e-10
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...    69   1e-10
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    68   1e-10
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...    69   1e-10
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...    68   1e-10
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...    69   1e-10
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...    69   1e-10
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...    69   1e-10
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    69   1e-10
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...    68   1e-10
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...    67   1e-10
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...    68   1e-10
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...    68   1e-10
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...    67   1e-10
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...    67   1e-10
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...    68   1e-10
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...    68   2e-10
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    68   2e-10
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...    68   2e-10
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    68   2e-10
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    67   2e-10
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...    68   2e-10
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...    68   2e-10
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    67   2e-10
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...    68   2e-10
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...    67   2e-10
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...    67   2e-10
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...    67   2e-10
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...    68   2e-10
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...    68   2e-10
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...    68   2e-10
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...    68   2e-10
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...    68   2e-10
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...    68   2e-10
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...    67   2e-10
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    67   2e-10
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    68   2e-10
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     67   2e-10
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    67   2e-10
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...    67   2e-10
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    66   2e-10
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...    67   2e-10
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496     67   2e-10
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    67   2e-10
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    67   2e-10
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...    67   2e-10
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...    67   2e-10
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...    67   3e-10
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....    67   3e-10
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...    66   3e-10
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....    67   3e-10
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...    67   3e-10
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...    66   3e-10
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...    67   3e-10
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...    67   3e-10
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    67   3e-10
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...    67   3e-10
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...    67   3e-10
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...    66   3e-10
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...    67   3e-10
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...    67   3e-10
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...    67   3e-10
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...    67   4e-10
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    66   4e-10
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    66   4e-10
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...    67   4e-10
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...    66   4e-10
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...    67   4e-10
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...    67   4e-10
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    67   4e-10
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...    67   4e-10
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...    67   4e-10
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...    67   4e-10
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...    65   4e-10
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    66   4e-10
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...    66   4e-10
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    66   4e-10
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...    67   4e-10
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...    67   4e-10
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    65   4e-10
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...    67   5e-10
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     66   5e-10
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...    66   5e-10
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    65   5e-10
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    65   5e-10
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...    66   5e-10
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...    66   5e-10
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    65   5e-10
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...    66   5e-10
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    66   6e-10
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    65   6e-10
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...    65   6e-10
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...    66   6e-10
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...    66   6e-10
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...    66   6e-10
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     66   6e-10
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...    66   6e-10
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    65   6e-10
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...    66   6e-10
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...    65   6e-10
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...    66   6e-10
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...    66   6e-10
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...    66   6e-10
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    65   6e-10
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    66   7e-10
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...    66   7e-10
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    66   7e-10
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    66   7e-10
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    65   7e-10
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...    66   7e-10
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...    66   7e-10
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...    66   7e-10
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...    65   7e-10
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...    66   7e-10
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...    65   8e-10
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    66   9e-10
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    66   9e-10
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...    65   9e-10
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...    65   9e-10
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...    65   9e-10
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    65   9e-10
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    65   9e-10
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...    65   9e-10
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...    65   9e-10
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...    65   9e-10
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...    65   9e-10
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...    65   9e-10
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    65   9e-10
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...    65   9e-10
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...    65   9e-10
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...    65   1e-09
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              65   1e-09
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...    65   1e-09
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...    65   1e-09
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...    65   1e-09
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    65   1e-09
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    65   1e-09
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...    65   1e-09
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    65   1e-09
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...    65   1e-09
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    64   1e-09
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    64   1e-09
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384     65   1e-09
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...    64   1e-09
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...    65   1e-09
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...    65   1e-09
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    65   1e-09
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...    65   1e-09
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...    64   1e-09
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...    65   1e-09
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....    65   1e-09
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...    65   1e-09
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...    65   1e-09
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    65   1e-09
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...    65   2e-09
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...    65   2e-09
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...    65   2e-09
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...    65   2e-09
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...    65   2e-09
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...    65   2e-09
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...    64   2e-09
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....    65   2e-09
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...    65   2e-09
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...    65   2e-09
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...    65   2e-09
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...    65   2e-09
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    65   2e-09
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    64   2e-09
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    64   2e-09
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...    65   2e-09
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    65   2e-09
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    65   2e-09
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...    65   2e-09
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...    65   2e-09
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    64   2e-09
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...    65   2e-09
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    64   2e-09
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...    64   2e-09
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    64   2e-09
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    64   2e-09
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...    64   2e-09
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...    64   2e-09
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...    64   2e-09
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...    64   2e-09
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...    64   2e-09
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...    64   2e-09
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...    64   2e-09
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...    64   2e-09
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    64   2e-09
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    64   2e-09
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....    64   3e-09
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    64   3e-09
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    64   3e-09
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...    64   3e-09
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    64   3e-09
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...    64   3e-09
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    64   3e-09
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...    64   3e-09
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...    63   3e-09
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...    64   3e-09
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...    64   3e-09
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...    64   3e-09
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...    64   3e-09
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    63   3e-09
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...    64   3e-09
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    64   3e-09
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192     62   3e-09
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...    63   3e-09
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...    64   3e-09
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...    64   4e-09
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...    64   4e-09
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}               64   4e-09
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    64   4e-09
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...    64   4e-09
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    63   4e-09
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...    64   4e-09
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    64   4e-09
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    64   4e-09
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    63   5e-09
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    62   5e-09
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    62   5e-09
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    62   5e-09
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...    63   5e-09
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}               63   5e-09
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    63   5e-09
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    63   5e-09
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    62   5e-09
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...    63   6e-09
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    62   6e-09
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...    63   6e-09
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    63   6e-09
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    63   6e-09
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    62   6e-09
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    62   6e-09
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    62   6e-09
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...    63   6e-09
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    62   6e-09
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...    62   6e-09
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...    63   6e-09
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...    63   6e-09
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654     63   6e-09
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...    63   6e-09
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    62   7e-09
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...    63   7e-09
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...    62   7e-09
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    62   7e-09
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...    63   7e-09
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}               62   7e-09
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...    63   7e-09
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...    63   7e-09
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...    63   8e-09
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    63   8e-09
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    62   8e-09
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...    62   8e-09
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...    62   8e-09
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...    62   8e-09
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...    62   8e-09
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...    62   8e-09
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...    62   8e-09
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...    62   9e-09
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    62   9e-09
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...    62   9e-09
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    62   9e-09
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...    62   9e-09
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...    62   9e-09
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    62   9e-09
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    62   9e-09
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...    62   1e-08
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...    61   1e-08
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...    62   1e-08
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    61   1e-08
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...    62   1e-08
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    61   1e-08
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    61   1e-08
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192     61   1e-08
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...    62   1e-08
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...    62   1e-08
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...    62   1e-08
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    61   1e-08
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...    62   1e-08
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    61   1e-08
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    62   1e-08
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...    62   1e-08
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...    62   1e-08
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....    62   1e-08
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...    62   1e-08
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    61   1e-08
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    61   2e-08
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    61   2e-08
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...    61   2e-08
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...    61   2e-08
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    62   2e-08
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....    62   2e-08
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654     61   2e-08
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...    61   2e-08
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...    61   2e-08
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...    61   2e-08
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...    60   2e-08
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...    61   2e-08
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    60   2e-08
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               61   2e-08
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...    60   2e-08
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    60   2e-08
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...    60   2e-08
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...    60   2e-08
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...    61   2e-08
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...    60   3e-08
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    61   3e-08
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...    61   3e-08
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...    61   3e-08
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    61   3e-08
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...    60   3e-08
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...    60   3e-08
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    61   3e-08
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341      61   3e-08
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...    60   3e-08
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    60   3e-08
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...    60   3e-08
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...    60   3e-08
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...    60   3e-08
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    60   3e-08
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    60   3e-08
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...    60   4e-08
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    60   4e-08
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...    60   4e-08
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...    60   4e-08
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...    59   4e-08
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...    59   4e-08
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....    60   4e-08
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    60   4e-08
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    60   4e-08
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...    60   4e-08
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...    60   4e-08
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...    60   4e-08
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...    60   4e-08
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...    60   4e-08
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    60   4e-08
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....    60   4e-08
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...    59   4e-08
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...    60   5e-08
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...    60   5e-08
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...    59   5e-08
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...    59   5e-08
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    58   5e-08
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    58   5e-08
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...    60   5e-08
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...    59   5e-08
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...    60   6e-08
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    59   6e-08
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...    60   6e-08
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    59   6e-08
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...    60   6e-08
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...    59   6e-08
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    59   6e-08
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    59   6e-08
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...    60   6e-08
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...    59   7e-08
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...    59   7e-08
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    59   7e-08
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...    59   7e-08
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...    59   7e-08
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...    59   7e-08
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    59   7e-08
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...    59   8e-08
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    59   8e-08
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...    59   8e-08
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    59   8e-08
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...    59   8e-08
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...    58   8e-08
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...    59   8e-08
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...    59   8e-08
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    59   9e-08
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    59   9e-08
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...    59   9e-08
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    58   9e-08
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    58   9e-08
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    57   9e-08
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...    59   1e-07
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...    59   1e-07
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...    59   1e-07
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...    58   1e-07
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...    59   1e-07
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...    59   1e-07
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...    58   1e-07
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    56   1e-07
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...    59   1e-07
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    58   1e-07
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...    58   1e-07
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...    59   1e-07
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    58   1e-07
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    58   1e-07
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...    58   1e-07
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...    57   1e-07
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...    58   1e-07
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    57   1e-07
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...    59   1e-07
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    58   1e-07
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    58   1e-07
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    58   1e-07
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    58   2e-07
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....    58   2e-07
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    57   2e-07
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    57   2e-07
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    57   2e-07
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    57   2e-07
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              57   2e-07
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...    58   2e-07
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...    58   2e-07
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...    58   2e-07
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...    58   2e-07
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}              58   2e-07
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    58   2e-07
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...    57   2e-07
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...    58   2e-07
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    56   2e-07
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...    57   2e-07
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    57   2e-07
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    57   2e-07
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...    57   2e-07
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...    57   2e-07
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...    57   2e-07
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...    57   2e-07
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    58   3e-07
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...    57   3e-07
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...    57   3e-07
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...    57   3e-07
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...    57   3e-07
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    57   3e-07
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    56   3e-07
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...    57   3e-07
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    56   3e-07
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...    57   3e-07
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...    57   3e-07
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    57   3e-07
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    57   3e-07
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     57   3e-07
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    57   3e-07
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    57   4e-07
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...    57   4e-07
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    57   4e-07
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...    57   4e-07
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}               56   4e-07
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    56   4e-07
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...    57   4e-07
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...    57   4e-07
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...    57   4e-07
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    57   4e-07
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    55   4e-07
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...    56   4e-07
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...    56   4e-07
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214     56   4e-07
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    57   5e-07
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    56   5e-07
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    55   5e-07
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    56   5e-07
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...    56   5e-07
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    56   5e-07
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    56   5e-07
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...    56   5e-07
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...    56   6e-07
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...    56   6e-07
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    56   6e-07
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...    56   6e-07
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    56   6e-07
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    56   6e-07
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    55   7e-07
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    56   7e-07
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    56   7e-07
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    56   7e-07
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    55   7e-07
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    56   7e-07
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    55   7e-07
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    56   7e-07
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    56   7e-07
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...    56   7e-07
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...    56   7e-07
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...    56   7e-07
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    56   8e-07
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    56   8e-07
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    55   8e-07
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    55   8e-07
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    55   8e-07
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    56   9e-07
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...    55   9e-07
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    55   9e-07
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    54   9e-07
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...    55   1e-06
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...    55   1e-06
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    55   1e-06
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...    55   1e-06
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    55   1e-06
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...    55   1e-06
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    55   1e-06
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...    55   1e-06
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    55   1e-06
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...    55   1e-06
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    55   1e-06
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...    55   1e-06
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    55   1e-06
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...    55   1e-06
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    55   1e-06
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    55   1e-06
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    54   1e-06
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    55   1e-06
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    54   1e-06
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}               55   1e-06
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...    55   1e-06
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    54   1e-06
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    55   1e-06
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    55   1e-06
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...    55   1e-06
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...    55   1e-06
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...    55   1e-06
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...    55   1e-06
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    55   2e-06
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    55   2e-06
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    55   2e-06
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    55   2e-06
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    54   2e-06
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    54   2e-06
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    54   2e-06
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    54   2e-06
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    54   2e-06
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    54   2e-06
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    55   2e-06
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    54   2e-06
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...    54   2e-06
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...    55   2e-06
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...    54   2e-06
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...    54   2e-06
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...    54   2e-06
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    55   2e-06
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    55   2e-06
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...    54   2e-06
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}               54   2e-06
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    54   2e-06
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...    54   2e-06
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...    54   2e-06
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    54   2e-06
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    53   2e-06
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    54   2e-06
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    54   2e-06
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    54   2e-06
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    54   2e-06
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    54   2e-06
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    54   2e-06
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    54   2e-06
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     54   2e-06
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...    54   2e-06
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    54   3e-06
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...    54   3e-06
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              54   3e-06
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...    54   3e-06
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...    54   3e-06
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    54   3e-06
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    54   3e-06
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...    54   3e-06
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    54   3e-06
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    54   3e-06
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...    54   3e-06
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    54   3e-06
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    54   3e-06
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    54   3e-06
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    54   3e-06
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    54   3e-06
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    53   3e-06
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...    54   3e-06
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    54   3e-06
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    54   3e-06
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    53   3e-06
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...    54   3e-06
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    53   3e-06
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    53   3e-06
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...    54   3e-06
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    54   3e-06
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...    54   3e-06
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...    54   3e-06
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    54   3e-06
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    53   3e-06
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...    53   3e-06
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...    54   3e-06
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    54   3e-06
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    54   4e-06
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...    54   4e-06
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...    53   4e-06
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...    53   4e-06
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     54   4e-06
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    53   4e-06
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    54   4e-06
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    53   4e-06
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    54   4e-06
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    53   4e-06
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....    54   4e-06
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    54   4e-06
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    54   4e-06
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    53   4e-06
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...    53   4e-06
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...    53   4e-06
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     53   5e-06
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    53   5e-06
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    53   5e-06
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    53   5e-06
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    53   5e-06
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    53   5e-06
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...    53   5e-06
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...    53   5e-06
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...    53   5e-06
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    53   5e-06
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    53   5e-06
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    52   5e-06
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...    53   5e-06
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    53   5e-06
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...    52   5e-06
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    52   5e-06
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    53   5e-06
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}               52   5e-06
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    53   5e-06
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    53   5e-06
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    53   5e-06
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    53   5e-06
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...    53   6e-06
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...    53   6e-06
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     53   6e-06
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...    53   6e-06
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    53   6e-06
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    52   6e-06
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    53   7e-06
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    53   7e-06
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    53   7e-06
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    53   7e-06
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...    52   7e-06
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...    53   7e-06
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...    52   7e-06
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...    52   7e-06
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    52   7e-06
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...    52   8e-06
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...    52   8e-06
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    53   8e-06
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...    52   8e-06
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...    52   8e-06
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               52   8e-06
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    52   8e-06
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    52   9e-06
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    52   9e-06
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    52   9e-06
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...    52   9e-06
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             52   9e-06
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    52   9e-06
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    52   9e-06
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    52   9e-06
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    51   9e-06
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    52   1e-05
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    51   1e-05
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    52   1e-05
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    52   1e-05
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...    52   1e-05
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...    52   1e-05
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...    52   1e-05
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    52   1e-05
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...    52   1e-05
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...    52   1e-05
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...    52   1e-05
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    51   1e-05
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    52   1e-05
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    52   1e-05
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...    52   1e-05
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...    52   1e-05
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...    52   1e-05
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...    52   1e-05
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    51   1e-05
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    52   1e-05
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...    52   1e-05
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    52   1e-05
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    51   1e-05
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...    52   1e-05
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    51   1e-05
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    52   1e-05
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    52   1e-05
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    52   1e-05
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...    52   1e-05
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...    52   1e-05
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    51   1e-05
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    52   1e-05
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    52   1e-05
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...    52   1e-05
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    51   1e-05
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    51   1e-05
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    51   1e-05
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    52   1e-05
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    52   1e-05
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...    52   2e-05
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...    52   2e-05
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...    52   2e-05
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...    52   2e-05
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    52   2e-05
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    52   2e-05
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...    52   2e-05
TDEL0G03220 Chr7 complement(600259..601350) [1092 bp, 363 aa] {O...    51   2e-05
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    51   2e-05
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    51   2e-05
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    52   2e-05
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...    51   2e-05
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...    51   2e-05
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    50   2e-05
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    51   2e-05
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    51   2e-05
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    51   2e-05
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    51   2e-05
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...    51   2e-05
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...    51   2e-05
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    51   2e-05
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....    51   2e-05
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    51   2e-05
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...    51   2e-05
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    51   2e-05
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    51   2e-05
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...    51   2e-05
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    51   2e-05
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...    51   2e-05
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...    51   2e-05
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    50   2e-05
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...    50   2e-05
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    51   2e-05
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    51   2e-05
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    51   2e-05
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    51   2e-05
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    51   2e-05
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    51   3e-05
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    51   3e-05
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    51   3e-05
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    51   3e-05
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    51   3e-05
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...    51   3e-05
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...    51   3e-05
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    51   3e-05
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    50   3e-05
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    50   3e-05
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...    50   3e-05
ZYRO0A08448g Chr1 complement(677122..678225) [1104 bp, 367 aa] {...    50   3e-05
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...    50   3e-05
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...    50   3e-05
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    50   3e-05
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...    50   3e-05
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    51   3e-05
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              50   3e-05
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    50   3e-05
TPHA0C01810 Chr3 complement(413495..414790) [1296 bp, 431 aa] {O...    50   3e-05
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    50   3e-05
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...    50   3e-05
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    50   4e-05
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    50   4e-05
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    50   4e-05
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    50   4e-05
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    50   4e-05
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...    50   4e-05
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     50   4e-05
CAGL0L06820g Chr12 (769035..770135) [1101 bp, 366 aa] {ON} highl...    50   4e-05
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...    50   4e-05
Smik_13.338 Chr13 (528578..529690) [1113 bp, 370 aa] {ON} YMR139...    50   4e-05
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...    50   4e-05
KAFR0F02710 Chr6 (528336..529493) [1158 bp, 385 aa] {ON} Anc_2.3...    50   4e-05
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    50   4e-05
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...    50   4e-05
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    50   4e-05
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    50   4e-05
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}              50   5e-05
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...    50   5e-05
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    50   5e-05
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    50   5e-05
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    50   5e-05
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...    49   5e-05
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...    50   5e-05
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    50   5e-05
SAKL0E04950g Chr5 (401903..402994) [1092 bp, 363 aa] {ON} highly...    49   5e-05
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    50   5e-05
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    49   5e-05
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...    49   5e-05
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...    50   5e-05
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    50   6e-05
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...    50   6e-05
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...    49   6e-05
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    50   6e-05
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...    50   6e-05
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...    50   6e-05
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...    50   6e-05
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    50   6e-05
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...    50   6e-05
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...    49   7e-05
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    49   7e-05
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    49   7e-05
Kwal_47.17868 s47 (587449..588546) [1098 bp, 365 aa] {ON} YMR139...    49   7e-05
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    49   7e-05
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    49   7e-05
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    49   7e-05
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    49   7e-05
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     49   7e-05
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    49   7e-05
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    49   7e-05
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    50   7e-05
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...    49   7e-05
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...    49   7e-05
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     49   7e-05
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)    49   7e-05
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    49   8e-05
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446     49   8e-05
TBLA0B08810 Chr2 (2094401..2095375) [975 bp, 324 aa] {ON} Anc_2....    49   8e-05
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    49   8e-05
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    49   8e-05
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}              49   8e-05
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    49   8e-05
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    49   8e-05
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    49   8e-05
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    49   8e-05
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    49   9e-05
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    49   9e-05
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    49   9e-05
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...    49   9e-05
KLTH0E09658g Chr5 (869857..870957) [1101 bp, 366 aa] {ON} highly...    49   9e-05
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...    49   9e-05
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...    49   9e-05
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...    48   9e-05
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    49   9e-05
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    49   9e-05
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    49   9e-05
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    49   1e-04
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    48   1e-04
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    49   1e-04
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    49   1e-04
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...    49   1e-04
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    49   1e-04
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    49   1e-04
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...    49   1e-04
Skud_16.391 Chr16 (704392..705723) [1332 bp, 443 aa] {ON} YPR106...    49   1e-04
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    49   1e-04
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    49   1e-04
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...    49   1e-04
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    49   1e-04
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    48   1e-04
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    49   1e-04
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    49   1e-04
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...    48   1e-04
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    49   1e-04
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    49   1e-04
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    49   1e-04
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    49   1e-04
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    49   1e-04
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    48   1e-04
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...    49   1e-04
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...    49   1e-04
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    49   1e-04
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    48   1e-04
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    48   1e-04
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    49   1e-04
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...    48   2e-04
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...    48   2e-04
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    48   2e-04
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    48   2e-04
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...    48   2e-04
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...    48   2e-04
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...    48   2e-04
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    48   2e-04
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    48   2e-04
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    48   2e-04
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    48   2e-04
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    49   2e-04
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    48   2e-04
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    48   2e-04
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    48   2e-04
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    48   2e-04
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...    48   2e-04
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    47   2e-04
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    48   2e-04
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    48   2e-04
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    48   2e-04
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...    48   2e-04
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    48   2e-04
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    48   2e-04
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    48   2e-04
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...    48   2e-04
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...    48   2e-04
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    48   2e-04
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    48   2e-04
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    48   2e-04
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    48   2e-04
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    47   2e-04
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    48   2e-04
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    48   2e-04
Suva_13.319 Chr13 (525309..526421) [1113 bp, 370 aa] {ON} YMR139...    47   2e-04
YMR139W Chr13 (546125..547237) [1113 bp, 370 aa] {ON}  RIM11Prot...    47   2e-04
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    48   2e-04
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    48   2e-04
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    48   2e-04
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...    47   2e-04
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...    47   2e-04
KNAG0A05920 Chr1 complement(883522..884742) [1221 bp, 406 aa] {O...    47   2e-04
Skud_10.153 Chr10 (288733..290742) [2010 bp, 669 aa] {ON} YJL057...    48   2e-04
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...    48   2e-04
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...    48   2e-04
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               47   2e-04
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               48   2e-04
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    47   2e-04
TBLA0D05210 Chr4 (1279846..1282323) [2478 bp, 825 aa] {ON} Anc_1...    48   2e-04
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    47   2e-04
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    48   3e-04
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    47   3e-04
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    48   3e-04
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...    47   3e-04
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...    47   3e-04
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...    47   3e-04
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...    47   3e-04
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    47   3e-04
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    47   3e-04
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    47   3e-04
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    48   3e-04
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    47   3e-04
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...    47   3e-04
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...    47   3e-04
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    47   3e-04
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    47   3e-04
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...    47   3e-04
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...    47   3e-04
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    47   3e-04
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    47   3e-04
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    47   3e-04
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    47   3e-04
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...    47   3e-04
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    47   3e-04
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    47   3e-04
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    47   3e-04
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    47   3e-04
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              47   3e-04
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    47   3e-04
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    47   3e-04
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    47   3e-04
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...    47   3e-04
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...    47   4e-04
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...    47   4e-04
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    47   4e-04
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    47   4e-04
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    47   4e-04
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    47   4e-04
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    47   4e-04
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    47   4e-04
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...    46   4e-04
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...    47   4e-04
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...    47   4e-04
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    47   4e-04
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    47   4e-04
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      47   4e-04
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    47   4e-04
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    47   4e-04
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    47   4e-04
Smik_16.346 Chr16 (617471..618802) [1332 bp, 443 aa] {ON} YPR106...    47   4e-04
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    47   4e-04
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    47   4e-04
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    47   4e-04
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    47   4e-04
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    47   4e-04
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    47   4e-04
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    47   4e-04
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    47   4e-04
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    47   4e-04
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    47   4e-04
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    47   5e-04
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    46   5e-04
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    47   5e-04
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...    47   5e-04
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    47   5e-04
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    47   5e-04
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...    47   5e-04
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    47   5e-04
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    47   5e-04
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    47   5e-04
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    47   5e-04
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...    46   5e-04
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    46   5e-04
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    46   5e-04
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...    47   5e-04
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    46   5e-04
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...    47   5e-04
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    47   5e-04
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    47   5e-04
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    47   5e-04
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    47   5e-04
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    46   6e-04
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    46   6e-04
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    46   6e-04
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    46   6e-04
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     46   6e-04
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...    46   6e-04
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...    46   6e-04
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    46   6e-04
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    46   6e-04
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    46   6e-04
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    46   6e-04
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    46   6e-04
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    46   6e-04
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    46   6e-04
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}               46   7e-04
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    46   7e-04
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...    44   7e-04
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...    45   7e-04
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...    45   7e-04
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    46   7e-04
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       46   7e-04
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...    45   7e-04
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    46   7e-04
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    46   7e-04
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...    46   7e-04
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     46   7e-04
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    46   7e-04
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    46   7e-04
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    46   7e-04
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...    46   7e-04
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    46   8e-04
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    46   8e-04
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    46   8e-04
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    46   8e-04
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...    46   8e-04
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    45   8e-04
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    45   8e-04
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    45   8e-04
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    46   8e-04
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    46   9e-04
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    46   9e-04
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    46   9e-04
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...    45   0.001
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    46   0.001
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    46   0.001
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...    46   0.001
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    45   0.001
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    46   0.001
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...    46   0.001
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    46   0.001
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    46   0.001
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    45   0.001
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    46   0.001
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    45   0.001
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    46   0.001
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    45   0.001
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       46   0.001
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    45   0.001
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    45   0.001
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    45   0.001
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    46   0.001
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    46   0.001
TPHA0J00120 Chr10 complement(12222..17507) [5286 bp, 1761 aa] {O...    46   0.001
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    45   0.001
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    45   0.001
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    45   0.001
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    45   0.001
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    45   0.001
TPHA0I02660 Chr9 (582108..584219) [2112 bp, 703 aa] {ON} Anc_1.3...    45   0.001
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    45   0.001
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    45   0.001
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    45   0.001
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...    45   0.001
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...    45   0.001
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...    45   0.001
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     45   0.001
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    45   0.001
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    45   0.001
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...    45   0.001
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    45   0.001
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    45   0.001
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    45   0.001
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...    45   0.001
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    45   0.001
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    45   0.001
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    45   0.001
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    45   0.001
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    45   0.001
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     45   0.002
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    45   0.002
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    45   0.002
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    45   0.002
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....    45   0.002
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...    44   0.002
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    45   0.002
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...    45   0.002
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    45   0.002
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    45   0.002
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    45   0.002
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    45   0.002
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    45   0.002
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    45   0.002
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    45   0.002
TPHA0J00160 Chr10 complement(28187..36367) [8181 bp, 2726 aa] {O...    45   0.002
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    45   0.002
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    45   0.002
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    44   0.002
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    45   0.002
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    45   0.002
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    45   0.002
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    45   0.002
TPHA0J02290 Chr10 (508389..510779) [2391 bp, 796 aa] {ON} Anc_6....    45   0.002
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    44   0.002
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...    45   0.002
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    44   0.002
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...    44   0.002
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    44   0.002
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    45   0.002
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...    44   0.002
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    45   0.002
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    45   0.002
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    44   0.002
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    44   0.002
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...    44   0.003
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    44   0.003
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    44   0.003
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    44   0.003
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    44   0.003
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....    44   0.003
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    44   0.003
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    44   0.003
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    44   0.003
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...    44   0.003
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    44   0.003
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    44   0.003
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    44   0.003
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    44   0.003
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    44   0.003
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    44   0.003
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    44   0.003
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...    44   0.003
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    44   0.003
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    44   0.003
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    44   0.003
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...    44   0.003
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    44   0.003
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    44   0.003
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    44   0.003
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    44   0.003
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    44   0.003
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    44   0.003
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    44   0.003
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    44   0.003
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    44   0.003
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    44   0.003
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...    44   0.004
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    44   0.004
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    44   0.004
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    44   0.004
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...    44   0.004
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    44   0.004
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    44   0.004
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    44   0.004
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    43   0.005
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    43   0.005
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    43   0.005
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    43   0.005
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    44   0.005
NDAI0E05010 Chr5 complement(1142545..1143690) [1146 bp, 381 aa] ...    43   0.005
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    44   0.005
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               44   0.005
Kwal_55.19744 s55 (104433..105695) [1263 bp, 420 aa] {ON} YKR092...    43   0.005
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    43   0.005
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    44   0.005
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    43   0.005
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    44   0.005
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    43   0.005
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    42   0.005
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    44   0.005
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    44   0.005
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    43   0.005
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...    43   0.006
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    43   0.006
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    43   0.006
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    43   0.006
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    43   0.006
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...    43   0.006
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    43   0.006
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    43   0.006
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    43   0.006
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    43   0.007
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    42   0.007
NCAS0H02190 Chr8 complement(425884..428973) [3090 bp, 1029 aa] {...    43   0.007
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    43   0.007
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...    43   0.007
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    43   0.007
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    43   0.007
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    43   0.007
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    43   0.008
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    43   0.008
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    43   0.008
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    42   0.008
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    42   0.008
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    43   0.008
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    43   0.008
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               43   0.008
NCAS0A03230 Chr1 (639202..640410) [1209 bp, 402 aa] {ON} Anc_5.6...    42   0.008
NDAI0E03210 Chr5 complement(686073..687317) [1245 bp, 414 aa] {O...    42   0.008
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    42   0.009
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...    42   0.009
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    43   0.009
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    42   0.010
TDEL0B02610 Chr2 complement(470263..471282) [1020 bp, 339 aa] {O...    42   0.010
TBLA0F01730 Chr6 complement(431961..433004) [1044 bp, 347 aa] {O...    42   0.010
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    42   0.010
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             42   0.010
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    42   0.010
TBLA0H00500 Chr8 complement(96289..98253) [1965 bp, 654 aa] {ON}       42   0.010
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    42   0.010
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    42   0.010
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    42   0.010
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    42   0.010
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    42   0.010
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     42   0.011
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    42   0.011
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    42   0.011
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    42   0.011
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    42   0.011
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    42   0.012
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    42   0.012
KAFR0B04630 Chr2 (964764..966302) [1539 bp, 512 aa] {ON} Anc_1.3...    42   0.012
Ecym_2302 Chr2 (587299..588951) [1653 bp, 550 aa] {ON} similar t...    42   0.013
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    42   0.013
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    42   0.014
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    42   0.014
Ecym_6315 Chr6 (598035..600404) [2370 bp, 789 aa] {ON} similar t...    42   0.014
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    42   0.015
TBLA0B03810 Chr2 complement(875384..878065) [2682 bp, 893 aa] {O...    42   0.015
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...    42   0.015
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    42   0.016
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...    42   0.016
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    42   0.017
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    42   0.018
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    41   0.018
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               41   0.018
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      42   0.018
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    42   0.018
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    42   0.018
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    42   0.018
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    42   0.019
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      42   0.019
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...    41   0.020
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...    41   0.022
KLLA0F16467g Chr6 (1519800..1520822) [1023 bp, 340 aa] {ON} high...    41   0.022
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    41   0.022
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    41   0.023
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    41   0.023
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    41   0.025
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...    41   0.025
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...    41   0.025
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    41   0.025
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    41   0.027
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    41   0.027
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    41   0.028
TPHA0H01410 Chr8 complement(316871..317854) [984 bp, 327 aa] {ON...    40   0.028
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    41   0.029
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    41   0.029
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    41   0.029
TPHA0H01300 Chr8 (293254..294282) [1029 bp, 342 aa] {ON} Anc_5.6...    40   0.029
ZYRO0B16038g Chr2 (1300484..1301515) [1032 bp, 343 aa] {ON} high...    40   0.030
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    40   0.030
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...    41   0.030
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    40   0.031
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    40   0.031
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    40   0.032
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    41   0.032
KLTH0H04686g Chr8 complement(419384..421726) [2343 bp, 780 aa] {...    41   0.032
TDEL0G01540 Chr7 complement(303940..306300) [2361 bp, 786 aa] {O...    41   0.032
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    41   0.032
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    41   0.033
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    41   0.034
NCAS0G02790 Chr7 (508184..511636) [3453 bp, 1150 aa] {ON}   null...    41   0.034
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    41   0.035
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    41   0.036
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    41   0.036
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...    40   0.036
SAKL0H25696g Chr8 complement(2250743..2252278) [1536 bp, 511 aa]...    40   0.037
TPHA0F00740 Chr6 (169745..171448) [1704 bp, 567 aa] {ON} Anc_4.1...    40   0.038
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    40   0.038
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    40   0.038
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...    40   0.039
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    40   0.039
TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.1...    40   0.041
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    40   0.042
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    40   0.042
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    40   0.045
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    40   0.045
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    40   0.046
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    40   0.047
TBLA0B04530 Chr2 (1042985..1050010) [7026 bp, 2341 aa] {ON} Anc_...    40   0.049
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...    40   0.049
KAFR0K01310 Chr11 (270172..271191) [1020 bp, 339 aa] {ON} Anc_5....    40   0.051
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    40   0.054
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    40   0.054
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    40   0.054
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    40   0.054
Kwal_47.18098 s47 (685497..686621) [1125 bp, 374 aa] {ON} YIL035...    40   0.055
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    40   0.055
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    40   0.055
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...    40   0.056
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    40   0.067
Suva_6.133 Chr6 (221952..223955) [2004 bp, 667 aa] {ON} YJL057C ...    40   0.070
TBLA0F00120 Chr6 (10892..12925) [2034 bp, 677 aa] {ON}                 40   0.070
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      40   0.071
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    40   0.072
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    40   0.072
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    40   0.073
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    40   0.077
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    40   0.077
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....    39   0.080
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    39   0.084
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    39   0.085
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    39   0.087
CAGL0G02035g Chr7 (179911..180930) [1020 bp, 339 aa] {ON} highly...    39   0.089
TBLA0A09370 Chr1 complement(2310412..2311443) [1032 bp, 343 aa] ...    39   0.090
YJL057C Chr10 complement(328118..330121) [2004 bp, 667 aa] {ON} ...    39   0.091
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    39   0.092
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    39   0.093
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    39   0.094
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    39   0.094
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    39   0.094
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    39   0.095
TDEL0H02380 Chr8 complement(399810..400931) [1122 bp, 373 aa] {O...    39   0.095
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    39   0.095
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    39   0.095
KLTH0A03542g Chr1 (306667..307803) [1137 bp, 378 aa] {ON} highly...    39   0.095
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    39   0.096
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    39   0.096
Ecym_1206 Chr1 complement(415880..419236) [3357 bp, 1118 aa] {ON...    39   0.10 
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    39   0.10 
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...    39   0.11 
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...    39   0.12 
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    39   0.12 
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    39   0.12 
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    39   0.12 
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    39   0.13 
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    39   0.13 
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    39   0.13 
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    39   0.13 
SAKL0B07062g Chr2 complement(611326..614658) [3333 bp, 1110 aa] ...    39   0.13 
TBLA0A05000 Chr1 (1228803..1232168) [3366 bp, 1121 aa] {ON} Anc_...    39   0.13 
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    39   0.14 
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...    39   0.15 
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...    39   0.15 
Kpol_489.20 s489 complement(59150..60178) [1029 bp, 342 aa] {ON}...    38   0.16 
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    39   0.16 
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    38   0.16 
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    39   0.16 
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    39   0.16 
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    39   0.16 
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    38   0.16 
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...    39   0.17 
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    39   0.17 
TBLA0E02460 Chr5 (620609..621745) [1137 bp, 378 aa] {ON} Anc_7.2...    38   0.17 
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...    39   0.17 
TPHA0F03580 Chr6 complement(776340..777491) [1152 bp, 383 aa] {O...    38   0.17 
Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...    39   0.17 
TPHA0J00100 Chr10 complement(3..4550) [4548 bp, 1516 aa] {ON}          39   0.18 
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    38   0.19 
KNAG0D02790 Chr4 (507235..508848) [1614 bp, 537 aa] {ON} Anc_5.3...    38   0.19 
Kwal_34.16278 s34 (273327..275120) [1794 bp, 597 aa] {ON} YOL019...    38   0.20 
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    38   0.21 
SAKL0F07854g Chr6 (600324..601442) [1119 bp, 372 aa] {ON} highly...    38   0.22 
TPHA0B02780 Chr2 complement(633307..634449) [1143 bp, 380 aa] {O...    38   0.22 
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    38   0.22 
KNAG0B05490 Chr2 (1072736..1073935) [1200 bp, 399 aa] {ON} Anc_4...    38   0.22 
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    38   0.23 
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    38   0.24 
YDR420W Chr4 (1306267..1311675) [5409 bp, 1802 aa] {ON}  HKR1Muc...    38   0.24 
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    38   0.24 
Skud_7.306 Chr7 (532427..534097) [1671 bp, 557 aa] {ON} YGR023W ...    38   0.26 
Suva_8.111 Chr8 (204414..205433) [1020 bp, 339 aa] {ON} YOR061W ...    37   0.27 
Smik_15.241 Chr15 (407598..408617) [1020 bp, 339 aa] {ON} YOR061...    37   0.27 
YOR061W Chr15 (441534..442553) [1020 bp, 339 aa] {ON}  CKA2Alpha...    37   0.27 
Kwal_55.21709 s55 (948619..949641) [1023 bp, 340 aa] {ON} YOR061...    37   0.27 
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    38   0.28 
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    38   0.28 
KLLA0E19207g Chr5 (1709335..1711638) [2304 bp, 767 aa] {ON} simi...    38   0.28 
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    38   0.28 
SAKL0A05038g Chr1 complement(458190..460628) [2439 bp, 812 aa] {...    38   0.28 
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    37   0.28 
TBLA0B05130 Chr2 complement(1207884..1210484) [2601 bp, 866 aa] ...    38   0.29 
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    37   0.29 
TBLA0G03030 Chr7 complement(800682..803291) [2610 bp, 869 aa] {O...    38   0.29 
Skud_11.329 Chr11 complement(594184..595389) [1206 bp, 401 aa] {...    37   0.30 
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    37   0.32 
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    37   0.35 
NCAS0C05490 Chr3 (1114733..1115755) [1023 bp, 340 aa] {ON} Anc_5...    37   0.36 
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    37   0.36 
NCAS0H02660 Chr8 (524484..526844) [2361 bp, 786 aa] {ON} Anc_5.548     37   0.37 
TBLA0H03770 Chr8 (917128..919593) [2466 bp, 821 aa] {ON} Anc_8.5...    37   0.37 
KAFR0E02880 Chr5 (580120..582642) [2523 bp, 840 aa] {ON} Anc_8.4...    37   0.37 
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    37   0.37 
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    37   0.38 
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    37   0.38 
Suva_11.328 Chr11 complement(597257..598465) [1209 bp, 402 aa] {...    37   0.39 
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    37   0.39 
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    37   0.39 
ZYRO0B13992g Chr2 complement(1137166..1140828) [3663 bp, 1220 aa...    37   0.40 
TBLA0D00480 Chr4 (118608..122372) [3765 bp, 1254 aa] {ON}              37   0.40 
ZYRO0A12100g Chr1 (967785..969401) [1617 bp, 538 aa] {ON} some s...    37   0.44 
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    37   0.46 
ADR204W Chr4 (1062593..1063612) [1020 bp, 339 aa] {ON} Syntenic ...    37   0.47 
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    37   0.47 
Suva_14.399 Chr14 (684887..685388,685433..685442,685510..685523,...    37   0.48 
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    37   0.48 
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    37   0.48 
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    37   0.48 
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               37   0.48 
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    37   0.48 
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    37   0.48 
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    37   0.48 
ZYRO0F03190g Chr6 complement(270262..271371) [1110 bp, 369 aa] {...    37   0.49 
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    37   0.50 
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    37   0.51 
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    37   0.52 
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    37   0.54 
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                 37   0.55 
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...    37   0.56 
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...    37   0.58 
Kpol_1058.6 s1058 complement(30414..32117) [1704 bp, 567 aa] {ON...    37   0.59 
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      37   0.59 
TBLA0J01560 Chr10 (349382..351526) [2145 bp, 714 aa] {ON} Anc_7....    37   0.62 
TBLA0E01430 Chr5 (324567..326765) [2199 bp, 732 aa] {ON} Anc_4.2...    37   0.63 
ZYRO0G08316g Chr7 (677123..679465) [2343 bp, 780 aa] {ON} simila...    37   0.63 
KAFR0C02170 Chr3 (431896..434289) [2394 bp, 797 aa] {ON} Anc_6.1...    37   0.64 
TDEL0C03760 Chr3 complement(661391..663895) [2505 bp, 834 aa] {O...    37   0.64 
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    36   0.65 
SAKL0E05126g Chr5 (418230..419336) [1107 bp, 368 aa] {ON} some s...    36   0.65 
Kpol_1023.100 s1023 (235260..238010) [2751 bp, 916 aa] {ON} (235...    37   0.65 
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    36   0.66 
Kpol_1063.4 s1063 complement(10790..11932) [1143 bp, 380 aa] {ON...    36   0.66 
ZYRO0F09636g Chr6 complement(782721..785711) [2991 bp, 996 aa] {...    37   0.66 
YHL023C Chr8 complement(59123..62563) [3441 bp, 1146 aa] {ON}  N...    37   0.67 
Skud_12.361 Chr12 complement(641047..645075) [4029 bp, 1342 aa] ...    37   0.69 
TBLA0H01490 Chr8 complement(331583..333241) [1659 bp, 552 aa] {O...    36   0.76 
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...    36   0.78 
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...    36   0.79 
Skud_15.228 Chr15 (403382..404401) [1020 bp, 339 aa] {ON} YOR061...    36   0.82 
Ecym_4056 Chr4 complement(119406..120428) [1023 bp, 340 aa] {ON}...    36   0.82 
TBLA0A01840 Chr1 (447415..449661) [2247 bp, 748 aa] {ON} Anc_6.1...    36   0.82 
TBLA0A01780 Chr1 complement(432827..435262) [2436 bp, 811 aa] {O...    36   0.84 
Ecym_2753 Chr2 (1461692..1464364) [2673 bp, 890 aa] {ON} similar...    36   0.85 
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    36   0.88 
CAGL0J08998g Chr10 (884779..888624) [3846 bp, 1281 aa] {ON} high...    36   0.89 
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    36   0.90 
TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]...    36   0.92 
KAFR0D04250 Chr4 (837888..839207) [1320 bp, 439 aa] {ON} Anc_3.4...    36   0.93 
NDAI0A05410 Chr1 (1223331..1224791) [1461 bp, 486 aa] {ON} Anc_3...    36   0.96 
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...    36   0.97 
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...    36   0.97 
Smik_6.386 Chr6 complement(619724..621238) [1515 bp, 504 aa] {ON...    36   0.98 
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    36   0.99 
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    36   1.0  
KAFR0A04720 Chr1 (934307..936226) [1920 bp, 639 aa] {ON}               36   1.0  
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    36   1.0  
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    36   1.1  
CAGL0M08316g Chr13 (829069..831963) [2895 bp, 964 aa] {ON} weakl...    36   1.1  
Kpol_2002.42 s2002 (83936..86884) [2949 bp, 982 aa] {ON} (83936....    36   1.1  
Smik_11.355 Chr11 complement(602725..603867) [1143 bp, 380 aa] {...    35   1.1  
CAGL0J11891g Chr10 complement(1161474..1165100) [3627 bp, 1208 a...    36   1.2  
KAFR0A04300 Chr1 (853102..857460) [4359 bp, 1452 aa] {ON} Anc_8....    36   1.2  
NCAS0A13480 Chr1 complement(2653843..2655189) [1347 bp, 448 aa] ...    35   1.2  
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    35   1.3  
NCAS0A08770 Chr1 complement(1733181..1734890) [1710 bp, 569 aa] ...    35   1.3  
TBLA0A02040 Chr1 complement(493305..495056) [1752 bp, 583 aa] {O...    35   1.3  
NDAI0K01770 Chr11 (395335..396270) [936 bp, 311 aa] {ON} Anc_2.5...    35   1.4  
NCAS0G02690 Chr7 complement(481420..483315) [1896 bp, 631 aa] {O...    35   1.4  
KAFR0G02990 Chr7 (619397..619729) [333 bp, 110 aa] {ON} Anc_7.19...    33   1.4  
AGL162C Chr7 complement(392348..394431,394501..394531) [2115 bp,...    35   1.4  
KLTH0F17490g Chr6 (1413752..1414774) [1023 bp, 340 aa] {ON} high...    35   1.4  
KNAG0L01860 Chr12 (336795..337817) [1023 bp, 340 aa] {ON} Anc_5....    35   1.4  
KAFR0K00300 Chr11 (68609..70951) [2343 bp, 780 aa] {ON} Anc_6.22...    35   1.4  
Kwal_27.9753 s27 (49417..49707) [291 bp, 96 aa] {OFF} [contig 43...    33   1.4  
YGL083W Chr7 (353058..355472) [2415 bp, 804 aa] {ON}  SCY1Putati...    35   1.4  
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    35   1.5  
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    35   1.6  
Kpol_1003.10 s1003 (29703..31067) [1365 bp, 454 aa] {ON} (29703....    35   1.6  
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    35   1.7  
TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1....    35   1.8  
Smik_10.183 Chr10 complement(319743..321746) [2004 bp, 667 aa] {...    35   1.8  
ZYRO0G18590g Chr7 complement(1533974..1536202) [2229 bp, 742 aa]...    35   1.9  
Smik_7.269 Chr7 (446854..449094) [2241 bp, 746 aa] {ON} YGL021W ...    35   1.9  
NDAI0I01190 Chr9 complement(285713..288214) [2502 bp, 833 aa] {O...    35   1.9  
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    35   1.9  
YMR317W Chr13 (907364..910786) [3423 bp, 1140 aa] {ON} Putative ...    35   2.0  
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    35   2.0  
NCAS0B04250 Chr2 (767630..771466) [3837 bp, 1278 aa] {ON}              35   2.0  
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    35   2.0  
Kwal_26.7484 s26 (384745..386046) [1302 bp, 434 aa] {ON} YKR092C...    35   2.1  
Ecym_2618 Chr2 (1196140..1197453) [1314 bp, 437 aa] {ON} similar...    35   2.1  
KLTH0D02970g Chr4 complement(284533..285945) [1413 bp, 470 aa] {...    35   2.2  
NDAI0A04810 Chr1 complement(1098246..1099673) [1428 bp, 475 aa] ...    35   2.2  
SAKL0H24508g Chr8 (2123140..2124606) [1467 bp, 488 aa] {ON} unip...    35   2.2  
Suva_16.127 Chr16 (213135..214661) [1527 bp, 508 aa] {ON} YPL181...    35   2.2  
Kpol_1076.11 s1076 complement(24646..26226) [1581 bp, 526 aa] {O...    35   2.2  
Kwal_23.4259 s23 (642645..642956) [312 bp, 103 aa] {OFF} [contig...    32   2.2  
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...    35   2.3  
Ecym_8380 Chr8 (772519..774573) [2055 bp, 684 aa] {ON} similar t...    35   2.4  
SAKL0C05236g Chr3 (498347..501385) [3039 bp, 1012 aa] {ON} simil...    35   2.6  
Smik_5.259 Chr5 complement(399447..402572) [3126 bp, 1041 aa] {O...    35   2.6  
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    34   2.6  
KLLA0E13047g Chr5 (1157346..1158452) [1107 bp, 368 aa] {ON} some...    34   2.6  
TBLA0B07260 Chr2 (1720345..1723632) [3288 bp, 1095 aa] {ON} Anc_...    35   2.6  
SAKL0G00990g Chr7 complement(89700..90824) [1125 bp, 374 aa] {ON...    34   2.6  
CAGL0M09086g Chr13 complement(904879..909219) [4341 bp, 1446 aa]...    35   2.7  
Kwal_26.7237 s26 complement(276089..277318) [1230 bp, 409 aa] {O...    34   2.7  
Kwal_56.24276 s56 complement(932973..933221) [249 bp, 82 aa] {OF...    32   2.7  
YFR019W Chr6 (184502..191338) [6837 bp, 2278 aa] {ON}  FAB11-pho...    35   2.8  
TBLA0B08070 Chr2 (1932439..1934019) [1581 bp, 526 aa] {ON} Anc_8...    34   3.0  
KNAG0I03000 Chr9 (596789..598840) [2052 bp, 683 aa] {ON} Anc_4.4...    34   3.1  
Kpol_489.8 s489 (26766..28883) [2118 bp, 705 aa] {ON} (26766..28...    34   3.2  
YGL178W Chr7 (167352..167354,167995..170571) [2580 bp, 859 aa] {...    34   3.3  
TPHA0E02510 Chr5 complement(529459..532203) [2745 bp, 914 aa] {O...    34   3.3  
Suva_2.37 Chr2 (68616..69662) [1047 bp, 348 aa] {ON} YBL081W (REAL)    34   3.3  
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    34   3.3  
NCAS0J00870 Chr10 complement(144990..146057) [1068 bp, 355 aa] {...    34   3.3  
KLTH0F19888g Chr6 (1614006..1618226) [4221 bp, 1406 aa] {ON} som...    34   3.5  
TBLA0B00950 Chr2 (211991..216382) [4392 bp, 1463 aa] {ON} Anc_2....    34   3.5  
KLLA0F22671g Chr6 complement(2115530..2116930) [1401 bp, 466 aa]...    34   3.7  
NCAS0B03290 Chr2 (574702..576111) [1410 bp, 469 aa] {ON} Anc_8.3...    34   3.7  
TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {...    34   3.9  
KLTH0B09042g Chr2 (736520..738112) [1593 bp, 530 aa] {ON} simila...    34   3.9  
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...    34   4.0  
TBLA0I02770 Chr9 (650889..652730) [1842 bp, 613 aa] {ON} Anc_4.2...    34   4.0  
CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {...    34   4.1  
Kpol_1043.26 s1043 complement(51825..53873) [2049 bp, 682 aa] {O...    34   4.1  
Kpol_1036.44 s1036 complement(116994..119153) [2160 bp, 719 aa] ...    34   4.2  
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    34   4.2  
NDAI0K01030 Chr11 (239418..241712) [2295 bp, 764 aa] {ON} Anc_8....    34   4.2  
Kwal_33.15232 s33 complement(1023551..1026544) [2994 bp, 997 aa]...    34   4.4  
NDAI0C00180 Chr3 complement(26262..30002) [3741 bp, 1246 aa] {ON...    34   4.5  
TDEL0A07820 Chr1 (1358014..1362825) [4812 bp, 1603 aa] {ON}            34   4.6  
TBLA0A05390 Chr1 (1319338..1324395) [5058 bp, 1685 aa] {ON} Anc_...    34   4.6  
ZYRO0G05104g Chr7 complement(410797..412200) [1404 bp, 467 aa] {...    33   4.9  
Kpol_1066.5 s1066 complement(6994..8487) [1494 bp, 497 aa] {ON} ...    33   5.0  
Ecym_8392 Chr8 (803292..804806) [1515 bp, 504 aa] {ON} similar t...    33   5.0  
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    33   5.1  
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    33   5.1  
Suva_8.23 Chr8 (50391..50746,50801..50952,51088..51682,51842..52...    33   5.3  
KLLA0D17314g Chr4 complement(1471344..1473182) [1839 bp, 612 aa]...    33   5.3  
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    33   5.3  
NDAI0G01890 Chr7 complement(422805..424826) [2022 bp, 673 aa] {O...    33   5.4  
TPHA0C01620 Chr3 complement(375387..376322) [936 bp, 311 aa] {ON...    33   5.4  
Kpol_1002.61 s1002 complement(167383..169851) [2469 bp, 822 aa] ...    33   5.6  
KNAG0F02100 Chr6 complement(399443..401944) [2502 bp, 833 aa] {O...    33   5.6  
SAKL0G00440g Chr7 (41016..43526) [2511 bp, 836 aa] {ON} similar ...    33   5.6  
Smik_10.287 Chr10 (449576..450592) [1017 bp, 338 aa] {ON} YJR008...    33   5.7  
NDAI0H01120 Chr8 (250370..253183) [2814 bp, 937 aa] {ON} Anc_7.3...    33   5.7  
Suva_2.33 Chr2 (60529..63477) [2949 bp, 982 aa] {ON} YBL085W (REAL)    33   5.7  
NDAI0E04090 Chr5 (916105..919155) [3051 bp, 1016 aa] {ON} Anc_7....    33   5.8  
Suva_5.235 Chr5 complement(366285..369416) [3132 bp, 1043 aa] {O...    33   5.8  
NCAS0F02620 Chr6 complement(530092..534018) [3927 bp, 1308 aa] {...    33   5.9  
Kwal_14.2537 s14 complement(804704..805417) [714 bp, 237 aa] {ON...    33   5.9  
TBLA0D00520 Chr4 (137592..142034) [4443 bp, 1480 aa] {ON} Anc_7....    33   6.0  
NDAI0D02980 Chr4 complement(704549..709024) [4476 bp, 1491 aa] {...    33   6.0  
NCAS0B05440 Chr2 (1017388..1022040) [4653 bp, 1550 aa] {ON}            33   6.0  
Kwal_56.24188 s56 (896466..897854) [1389 bp, 462 aa] {ON} YMR173...    33   6.4  
NDAI0B02430 Chr2 (608926..610590) [1665 bp, 554 aa] {ON} Anc_8.132     33   6.8  
TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {O...    33   6.9  
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...    33   6.9  
TPHA0A00500 Chr1 (80226..82211) [1986 bp, 661 aa] {ON} Anc_3.55 ...    33   7.1  
NCAS0A15260 Chr1 (3001144..3003150) [2007 bp, 668 aa] {ON} Anc_7...    33   7.1  
SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weak...    33   7.1  
Suva_7.258 Chr7 (445704..447911) [2208 bp, 735 aa] {ON} YGL021W ...    33   7.2  
Skud_7.266 Chr7 (458004..460217) [2214 bp, 737 aa] {ON} YGL021W ...    33   7.2  
YGL021W Chr7 (454785..457067) [2283 bp, 760 aa] {ON}  ALK1Protei...    33   7.3  
SAKL0E15158g Chr5 (1263977..1266277) [2301 bp, 766 aa] {ON} weak...    33   7.3  
CAGL0H03245g Chr8 (303335..305686) [2352 bp, 783 aa] {ON} simila...    33   7.3  
KLLA0A06776g Chr1 (612115..614517) [2403 bp, 800 aa] {ON} simila...    33   7.3  
Skud_7.199 Chr7 (356300..358714) [2415 bp, 804 aa] {ON} YGL083W ...    33   7.3  
NCAS0A06820 Chr1 (1350166..1352661) [2496 bp, 831 aa] {ON} Anc_5...    33   7.4  
Kwal_27.10946 s27 complement(565797..566156) [360 bp, 119 aa] {O...    31   7.4  
Kwal_33.15455 s33 complement(1114891..1117635) [2745 bp, 914 aa]...    33   7.5  
Smik_11.58 Chr11 (112932..115715) [2784 bp, 927 aa] {ON} YKL171W...    33   7.5  
Skud_11.54 Chr11 (113775..116570) [2796 bp, 931 aa] {ON} YKL171W...    33   7.5  
Smik_4.696 Chr4 (1232828..1235677) [2850 bp, 949 aa] {ON} YDR421...    33   7.5  
Suva_2.598 Chr2 (1064757..1067654) [2898 bp, 965 aa] {ON} YDR421...    33   7.5  
TBLA0F01300 Chr6 (326311..329268) [2958 bp, 985 aa] {ON} Anc_1.3...    33   7.5  
Kwal_26.7814 s26 (521381..524359) [2979 bp, 992 aa] {ON} YGR189C...    33   7.5  
Smik_14.272 Chr14 (500166..503666) [3501 bp, 1166 aa] {ON} YNL05...    33   7.7  
CAGL0K12496g Chr11 (1219220..1220302) [1083 bp, 360 aa] {ON} sim...    33   7.7  
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    33   7.8  
ZYRO0D12496g Chr4 (1047901..1055058) [7158 bp, 2385 aa] {ON} som...    33   8.1  
Ecym_4026 Chr4 (62470..63261) [792 bp, 263 aa] {ON} similar to A...    32   8.5  
TPHA0E03670 Chr5 complement(777361..778851) [1491 bp, 496 aa] {O...    33   8.7  
TBLA0B00220 Chr2 complement(37191..38792) [1602 bp, 533 aa] {ON}...    33   8.8  
TPHA0J00650 Chr10 (143996..145729) [1734 bp, 577 aa] {ON} Anc_4....    33   9.0  
Skud_4.701 Chr4 (1240474..1242354) [1881 bp, 626 aa] {ON} YDR425...    33   9.2  
YNL176C Chr14 complement(305070..306980) [1911 bp, 636 aa] {ON} ...    33   9.2  
TPHA0L02180 Chr12 (453556..455538) [1983 bp, 660 aa] {ON} Anc_5....    33   9.3  
KAFR0B06140 Chr2 complement(1264753..1265670) [918 bp, 305 aa] {...    32   9.4  
TBLA0E02090 Chr5 (508537..510786) [2250 bp, 749 aa] {ON} Anc_5.6...    33   9.5  
Ecym_8100 Chr8 complement(214001..216547) [2547 bp, 848 aa] {ON}...    33   9.7  
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    33   9.8  
YDR421W Chr4 (1312040..1314892) [2853 bp, 950 aa] {ON}  ARO80Zin...    33   9.8  
Skud_4.695 Chr4 (1233000..1235864) [2865 bp, 954 aa] {ON} YDR421...    33   9.8  
NDAI0K02660 Chr11 (589384..592542) [3159 bp, 1052 aa] {ON} Anc_2...    33   10.0 
Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa] {O...    33   10.0 

>TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_2.284
            YNL020C
          Length = 1443

 Score = 2130 bits (5518), Expect = 0.0
 Identities = 1132/1443 (78%), Positives = 1132/1443 (78%)
 Frame = +1

Query: 1    MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 180
            MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV
Sbjct: 1    MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 60

Query: 181  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 360
            IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI
Sbjct: 61   IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 120

Query: 361  DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 540
            DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF
Sbjct: 121  DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 180

Query: 541  GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 720
            GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK
Sbjct: 181  GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 240

Query: 721  LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 900
            LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK
Sbjct: 241  LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 300

Query: 901  LQGVPCPIENFMLTRIKLQNSRNNSNKSTSLNDTTNNSFNNELALDQCXXXXXXXXXXXX 1080
            LQGVPCPIENFMLTRIKLQNSRNNSNKSTSLNDTTNNSFNNELALDQC            
Sbjct: 301  LQGVPCPIENFMLTRIKLQNSRNNSNKSTSLNDTTNNSFNNELALDQCNSLSPTNSSTRR 360

Query: 1081 XXXXXDTKRKSLMEADTPYLKPPISNPRSGHCVSPSLKLNVDTSKFXXXXXXXXXXXXXX 1260
                 DTKRKSLMEADTPYLKPPISNPRSGHCVSPSLKLNVDTSKF              
Sbjct: 361  NSTFSDTKRKSLMEADTPYLKPPISNPRSGHCVSPSLKLNVDTSKFIASASVSPNNINSS 420

Query: 1261 XXXXXXXXXXXXXXXXXXXXXXXITLNSLPFSTSPLSLAPVPINGPNTKGQSPTNSYISP 1440
                                   ITLNSLPFSTSPLSLAPVPINGPNTKGQSPTNSYISP
Sbjct: 421  SPISNSYIPSISSIPNLNLSESPITLNSLPFSTSPLSLAPVPINGPNTKGQSPTNSYISP 480

Query: 1441 TLTPIXXXXXXXXXXXXXXXXXXXXXXXXXXIPEIKVSPLYNSASMPNTNLTKPMPFSLP 1620
            TLTPI                          IPEIKVSPLYNSASMPNTNLTKPMPFSLP
Sbjct: 481  TLTPIPGTLTKNTLPLPLPNSPTLNLSLPQPIPEIKVSPLYNSASMPNTNLTKPMPFSLP 540

Query: 1621 PNIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXTVADTPYLANIGSASPTTSISNRLQFFT 1800
            PNID                            TVADTPYLANIGSASPTTSISNRLQFFT
Sbjct: 541  PNIDLSSKNLNLPELPSLNSTLSSPSHSPQLSTVADTPYLANIGSASPTTSISNRLQFFT 600

Query: 1801 TSRHGSISSKIAHHNNNTINTSHXXXXXXXXXXXXXXXXTYMXXXXXXXXXXXXXXXXXX 1980
            TSRHGSISSKIAHHNNNTINTSH                TYM                  
Sbjct: 601  TSRHGSISSKIAHHNNNTINTSHLQPSPQMSPPLSPQLLTYMPLPLSPQISPQSIPPALP 660

Query: 1981 XXXXXDNXXXXXXXXXXXXXXXXXXXXXXXPNVSDSVTIGHSGNLGKIFKDSLFDDNSAI 2160
                 DN                       PNVSDSVTIGHSGNLGKIFKDSLFDDNSAI
Sbjct: 661  PKLPIDNTLTLQQQFHTYQQQKQAQKITKLPNVSDSVTIGHSGNLGKIFKDSLFDDNSAI 720

Query: 2161 DDSITVENTIQKDFTEXXXXXXXXXXXXXXXXTPHLKLILTHDSLNNDSTIDDTFAKKHD 2340
            DDSITVENTIQKDFTE                TPHLKLILTHDSLNNDSTIDDTFAKKHD
Sbjct: 721  DDSITVENTIQKDFTESCNSSNLINLDSNSASTPHLKLILTHDSLNNDSTIDDTFAKKHD 780

Query: 2341 NLRKLRSKDSNTSITSMFSEITNSSTKNVFVTTPRNDDAISKSQSSLNLIQFXXXXXXXX 2520
            NLRKLRSKDSNTSITSMFSEITNSSTKNVFVTTPRNDDAISKSQSSLNLIQF        
Sbjct: 781  NLRKLRSKDSNTSITSMFSEITNSSTKNVFVTTPRNDDAISKSQSSLNLIQFSSSEASAK 840

Query: 2521 XXXXXLNYKNQNTKIKVSTDSFSSTASPLSSRQNTGDSIKSAFXXXXXXXXXXXXXXXXX 2700
                 LNYKNQNTKIKVSTDSFSSTASPLSSRQNTGDSIKSAF                 
Sbjct: 841  VSSSKLNYKNQNTKIKVSTDSFSSTASPLSSRQNTGDSIKSAFSKLRRSLSSSNPSRIIS 900

Query: 2701 XXXXXXXXNKSSNFRNVSEPSTCDPQYTFSITMNPTTRISSVSRKSRYESDSSVYFSANS 2880
                    NKSSNFRNVSEPSTCDPQYTFSITMNPTTRISSVSRKSRYESDSSVYFSANS
Sbjct: 901  SDTSSTRKNKSSNFRNVSEPSTCDPQYTFSITMNPTTRISSVSRKSRYESDSSVYFSANS 960

Query: 2881 GSAFRRESVADSNIDKVESLGKNSSQYNNNSLQRMESVVENAPSETSFKLNSSLPKMSSV 3060
            GSAFRRESVADSNIDKVESLGKNSSQYNNNSLQRMESVVENAPSETSFKLNSSLPKMSSV
Sbjct: 961  GSAFRRESVADSNIDKVESLGKNSSQYNNNSLQRMESVVENAPSETSFKLNSSLPKMSSV 1020

Query: 3061 TDNSQTVKETIDNNFTQRIGSVVEYPLSRAESAVNSTSLSNELREVSAAVNILQRIDHEI 3240
            TDNSQTVKETIDNNFTQRIGSVVEYPLSRAESAVNSTSLSNELREVSAAVNILQRIDHEI
Sbjct: 1021 TDNSQTVKETIDNNFTQRIGSVVEYPLSRAESAVNSTSLSNELREVSAAVNILQRIDHEI 1080

Query: 3241 SQPVNETEFIEEDDSKEHTNPFTRDYSAKRDSFNTIXXXXXXXXXXXXTRKESVTANTSP 3420
            SQPVNETEFIEEDDSKEHTNPFTRDYSAKRDSFNTI            TRKESVTANTSP
Sbjct: 1081 SQPVNETEFIEEDDSKEHTNPFTRDYSAKRDSFNTINSQRLSSLSSNSTRKESVTANTSP 1140

Query: 3421 EREIAPDIFLQKTESLVKNSDSLQTTNSIQFESLLSGFYXXXXXXXXXXXXXXXXXXLRL 3600
            EREIAPDIFLQKTESLVKNSDSLQTTNSIQFESLLSGFY                  LRL
Sbjct: 1141 EREIAPDIFLQKTESLVKNSDSLQTTNSIQFESLLSGFYSRDSIINNSNSSKGDISSLRL 1200

Query: 3601 VSNPDAKDLIKKRVMELLKNSETDNGVTRTAHGYGKYTDKPNTSQNKAPQRTISMDFFEK 3780
            VSNPDAKDLIKKRVMELLKNSETDNGVTRTAHGYGKYTDKPNTSQNKAPQRTISMDFFEK
Sbjct: 1201 VSNPDAKDLIKKRVMELLKNSETDNGVTRTAHGYGKYTDKPNTSQNKAPQRTISMDFFEK 1260

Query: 3781 QAVFAKDSNSKHDIRRNNVSIISNTIGGAETNGYHSFNDYNYREPARHTSVKIHTLKESS 3960
            QAVFAKDSNSKHDIRRNNVSIISNTIGGAETNGYHSFNDYNYREPARHTSVKIHTLKESS
Sbjct: 1261 QAVFAKDSNSKHDIRRNNVSIISNTIGGAETNGYHSFNDYNYREPARHTSVKIHTLKESS 1320

Query: 3961 KKHGSFKSPPPLPPRISIDEKVKDQKLKEDTPXXXXXXXXXXXXVGRLRXXXXXXXXXXX 4140
            KKHGSFKSPPPLPPRISIDEKVKDQKLKEDTP            VGRLR           
Sbjct: 1321 KKHGSFKSPPPLPPRISIDEKVKDQKLKEDTPKKHTHRTTRKLLVGRLRKSSQSESSKKK 1380

Query: 4141 XXXXXXXXXXXXXXXXXXXXXXXXIPEPLIELDRCSLEXXXXXXXXXXLRHKSKILSHIG 4320
                                    IPEPLIELDRCSLE          LRHKSKILSHIG
Sbjct: 1381 HSESSKESSKESSKKKHSEQSHKKIPEPLIELDRCSLEKPIPPPKPKKLRHKSKILSHIG 1440

Query: 4321 VSK 4329
            VSK
Sbjct: 1441 VSK 1443

>SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 791

 Score =  451 bits (1159), Expect = e-140
 Identities = 212/315 (67%), Positives = 259/315 (82%)
 Frame = +1

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 180
           M+QP +  Y  G VL +G+H+  I KYL  GGFA +YS  +   S       ++ACLKRV
Sbjct: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEI---SPPDPNSSSIACLKRV 57

Query: 181 IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 360
           +VPDK  LN+LRAEVDAMKLLK +K++VSYIDSHA +S L  G YEVFLLMEYC+RGG+I
Sbjct: 58  LVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLI 117

Query: 361 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 540
           DF+NTRL +RL+EFE+LKIMS V QGVAAMH LQPPLIHRDIKIENVLISE+G++K+CDF
Sbjct: 118 DFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDF 177

Query: 541 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 720
           GS C V+RPPK PQE  ++ HDI+ NTTAQYRSPEMID Y G P+DEKSDIWALGVFLYK
Sbjct: 178 GSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYK 237

Query: 721 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 900
           LCYYTTPFEK GE AIL+ KFQFP+YPQYSD ++N+I+ +L ++P++RPNICQ+L +VS+
Sbjct: 238 LCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSR 297

Query: 901 LQGVPCPIENFMLTR 945
           +QGVPCP++NF L R
Sbjct: 298 IQGVPCPVKNFYLER 312

 Score = 42.7 bits (99), Expect = 0.008
 Identities = 61/278 (21%), Positives = 118/278 (42%), Gaps = 16/278 (5%)
 Frame = +1

Query: 2977 QRMESVVENAPSETSFKLNS---SLPKMSSVTDNSQTVKETIDNNFTQRIGSVVEYPLSR 3147
            +R  S V N   + S  L S   S+ ++SS  D+     ETI+             PLSR
Sbjct: 432  RRSVSPVRNGRGDISKILKSNPTSVDRLSSYVDSETQTFETIE-------------PLSR 478

Query: 3148 AES------AVNSTSLSNELREVSAAVNILQRIDHEISQPV-NETEFIEEDDSKEHTNPF 3306
            + S      + +S S  + + E S   +  +RI  ++ + + NE        S+++T   
Sbjct: 479  SVSRSVSRGSASSASSQDSVEEQSTGGSFTRRIGDKLKRIISNEPRNTSPIRSRQNTGGS 538

Query: 3307 TRDYSAKRDSFNTIXXXXXXXXXXXXTRKESVTANTSPEREIAPDIFLQKTESLVKNSDS 3486
            TR       +F+T+            +++ SV  +          + +  ++S+ +  ++
Sbjct: 539  TRS------AFSTLRRGTSSNFSSDRSKRNSVDFSVRRLGSGGNKVRVSSSKSIEEKGNT 592

Query: 3487 LQTTN-----SIQFESLLSGFYXXXXXXXXXXXXXXXXXX-LRLVSNPDAKDLIKKRVME 3648
             +  N     S+   S+ S                      +++ +N ++++ I+KRV +
Sbjct: 593  NKFENKGHNRSVSTSSITSDLNKYEGKAGSVSRGYNQAHSPIKMSANRESRNSIQKRVHD 652

Query: 3649 LLKNSETDNGVTRTAHGYGKYTDKPNTSQNKAPQRTIS 3762
            LLKNS+ D+ V +TA  +G+++  P   Q+ A   TIS
Sbjct: 653  LLKNSQ-DSPVRKTAPDFGEFSSFP---QDHAADHTIS 686

>TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.284
           YNL020C
          Length = 661

 Score =  445 bits (1144), Expect = e-139
 Identities = 216/333 (64%), Positives = 256/333 (76%), Gaps = 6/333 (1%)
 Frame = +1

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRV------IDSSNARNELGTM 162
           MNQPEIP Y  G VL +G+H   +  YL  GGFAQVYS  +      IDS+        +
Sbjct: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSN--------V 52

Query: 163 ACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYC 342
           ACLKRVIVPDK  LNTLRAEVDAMKLL+ NK++VSYIDSHA +S    G YEVFLLMEYC
Sbjct: 53  ACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYC 112

Query: 343 SRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGD 522
           + GG+IDF+NTRL +RLQEFEIL IMS V QG+AAMH LQPPLIHRDIKIENVLIS  G 
Sbjct: 113 AGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQ 172

Query: 523 YKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWAL 702
           YK+CDFGS C V+RPP+ PQE A++ HD++ NTTAQYRSPEMID Y G+PIDEKSDIWAL
Sbjct: 173 YKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWAL 232

Query: 703 GVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQV 882
           GVFLYKLCYYTTPFEK GE AIL+ +FQFP+ P YSD ++ +I  ML ++P +RPN+CQV
Sbjct: 233 GVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQV 292

Query: 883 LEQVSKLQGVPCPIENFMLTRIKLQNSRNNSNK 981
           LE VS++QG+ CP+ NF L R   Q  ++  N+
Sbjct: 293 LEDVSRMQGIQCPVRNFYLLRAMEQQQQSTQNQ 325

>KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 777

 Score =  447 bits (1150), Expect = e-139
 Identities = 212/316 (67%), Positives = 259/316 (81%)
 Frame = +1

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 180
           MNQP+I KY  G +LP+G+HQV + KYLA GGFA VYSV +        +   +ACLKRV
Sbjct: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPD--NVACLKRV 58

Query: 181 IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 360
           +VPDK+ LNTLRAEVD+MK L+GNK+IVSYIDSHA +S +  G YEV+LLMEYCS GG+I
Sbjct: 59  VVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLI 118

Query: 361 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 540
           DF+NTRL +RLQEFEIL IMS V QGVAAMH LQPPLIHRDIKIENVL+S+N ++K+CDF
Sbjct: 119 DFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDF 178

Query: 541 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 720
           GS   V+R P+  +E  ++ +DIM NTTAQYR PEMID Y G PIDEKSDIWALGVFLYK
Sbjct: 179 GSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYK 238

Query: 721 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 900
            CYYTTPFEK GE+AIL  KF+FP+YP+YSD ++N+I++ML  DP+KRPNICQV+E+VS+
Sbjct: 239 TCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSR 298

Query: 901 LQGVPCPIENFMLTRI 948
           +QG+PCPI+NF L R+
Sbjct: 299 IQGIPCPIKNFYLLRM 314

>Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {ON}
           YIL095W (PRK1) - probable serine/threonine-protein
           kinase [contig 27] FULL
          Length = 791

 Score =  441 bits (1134), Expect = e-136
 Identities = 209/327 (63%), Positives = 260/327 (79%)
 Frame = +1

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 180
           MNQP    Y +G  L +G+HQ  I KYL  GGFA +YS  +  S    N +G +ACLKRV
Sbjct: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEI--SPADPNSIGNVACLKRV 58

Query: 181 IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 360
           +VPDK  LN LRAEVDAMKLL+GNK++VSYIDSHA +S  + G YEVFLLMEYCS GG+I
Sbjct: 59  LVPDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLI 118

Query: 361 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 540
           DF+NTRL +RL E E+LKIMSD+ QG+AAMH L PPLIHRDIKIENVLIS++  +K+CDF
Sbjct: 119 DFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDF 178

Query: 541 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 720
           GS C V+RPPK  QE +++ +DI+ NTTAQYRSPEMID Y G+PI+EKSDIWALGVFLYK
Sbjct: 179 GSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYK 238

Query: 721 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 900
           LCYYTTPFEK G+ AIL+ +FQFP+YPQYSD ++N+I++ML+++P +RPNICQVLE+VS+
Sbjct: 239 LCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSR 298

Query: 901 LQGVPCPIENFMLTRIKLQNSRNNSNK 981
           +Q VPCP+ NF L R   Q  + +  +
Sbjct: 299 IQNVPCPLRNFYLLRSMQQQQQQHQQQ 325

 Score = 40.0 bits (92), Expect = 0.055
 Identities = 19/43 (44%), Positives = 32/43 (74%)
 Frame = +1

Query: 3592 LRLVSNPDAKDLIKKRVMELLKNSETDNGVTRTAHGYGKYTDK 3720
            ++L  + DA+  I+KRV  LLK+S+ D+ V ++AHGYG+ ++K
Sbjct: 640  VKLSGSSDARSSIQKRVQNLLKSSQ-DSPVKKSAHGYGEVSEK 681

>Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar to
           Ashbya gossypii ADL217W
          Length = 748

 Score =  437 bits (1123), Expect = e-135
 Identities = 211/330 (63%), Positives = 255/330 (77%)
 Frame = +1

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 180
           MNQ     ++ G VL +G+H+V + KYL  GGFAQ+Y   VI   +   ++  +ACLKRV
Sbjct: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDS---KVKDVACLKRV 57

Query: 181 IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 360
            VPDK  LNTLRAEVDAMKLL+GNK+IVSYIDSHA +S L  G YEV LLMEYCSRGG+I
Sbjct: 58  HVPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLI 117

Query: 361 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 540
            F+NTRL  RL+EFE+L+IM+ V QG+ AMH LQPPLIHRDIKIENVLI+ENGD K+CDF
Sbjct: 118 SFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDF 177

Query: 541 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 720
           GS C V+RPPK   E +++ HDI+ NTTAQYR+PEMID Y G+ +DEKSDIWALGVFLYK
Sbjct: 178 GSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYK 237

Query: 721 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 900
           LCYYTTPFEK GE AIL   FQFPSYPQYS+ ++N+IT+ML ++PI RPN CQVLE+V +
Sbjct: 238 LCYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCR 297

Query: 901 LQGVPCPIENFMLTRIKLQNSRNNSNKSTS 990
           +QG PCP++NF L R   Q   +    S S
Sbjct: 298 IQGQPCPVKNFYLERSLKQQIPSQLRHSVS 327

>TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.284
            YNL020C
          Length = 697

 Score =  433 bits (1114), Expect = e-135
 Identities = 216/347 (62%), Positives = 264/347 (76%), Gaps = 4/347 (1%)
 Frame = +1

Query: 1    MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 180
            MNQPEIP Y  G +LP+G+HQ  I KYL  GGFAQVY V +  S    +    +ACLKRV
Sbjct: 1    MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEI--SPYDIHSGSNIACLKRV 58

Query: 181  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSE----LKQGEYEVFLLMEYCSR 348
            IVPDK+ LN  RAEV+AMKLL+ NKY+VSYIDSHA +S     +  G YEVFLLMEYCS 
Sbjct: 59   IVPDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSG 118

Query: 349  GGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYK 528
             G+IDF+NTRL +RL+EFEIL IMS V QGVAAMH LQPPL+HRDIKIENVLIS   ++K
Sbjct: 119  KGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFK 178

Query: 529  ICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGV 708
            +CDFGS C V+RPP    E  F+ HDI+ NTTAQYRSPEM+      PI+EKSDIWALGV
Sbjct: 179  LCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGV 238

Query: 709  FLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLE 888
            FLYK+CYYTTPFEKEGENAIL+ ++Q+P+YPQYSD+++N+I +ML  DP KRPNICQV+E
Sbjct: 239  FLYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVE 298

Query: 889  QVSKLQGVPCPIENFMLTRIKLQNSRNNSNKSTSLNDTTNNSFNNEL 1029
            +VS+LQGVPCP++NF L R         + + T++ D   N FN+++
Sbjct: 299  EVSRLQGVPCPLKNFYLER---------AIRQTAVQD---NHFNHQM 333

>KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} similar to
            uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
            Protein serine/threonine kinase regulates the
            organization and function of the actin cytoskeleton
            through the phosphorylation of the Pan1p- Sla1p-End3p
            protein complex
          Length = 790

 Score =  436 bits (1122), Expect = e-135
 Identities = 212/347 (61%), Positives = 264/347 (76%), Gaps = 7/347 (2%)
 Frame = +1

Query: 1    MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 180
            MNQ     Y+ G  L +G+H+  I KYL  GGFA +Y+  +  +    +    +ACLKRV
Sbjct: 1    MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPAD--LSSPAKIACLKRV 58

Query: 181  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 360
            +VPDK  LN LRAEVDAMKLL+GN+++VSYIDSHA +S +  G YEVFLLMEYCS GG+I
Sbjct: 59   LVPDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLI 118

Query: 361  DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 540
            DF+NTRL +RLQE E+LKI SD+ QG+AAMH LQPPLIHRDIKIENVLIS++  +K+CDF
Sbjct: 119  DFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDF 178

Query: 541  GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 720
            GS C V+RPPK PQE  ++ HDI+ NTTAQYR+PEMID Y GYPI+EKSDIWALGVFLYK
Sbjct: 179  GSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYK 238

Query: 721  LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 900
            LCYYTTPFEK GE AIL+ +FQFPSYPQYSD ++++I+ ML+++P +RPNICQVLE+VS+
Sbjct: 239  LCYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSR 298

Query: 901  LQGVPCPIENFMLTRIKLQNSRNNSNK-------STSLNDTTNNSFN 1020
            +QG PCP+ NF +TR   Q  ++   K       S    D+ NN  N
Sbjct: 299  IQGTPCPLRNFYVTRAMQQQQQHQQPKIKFDHSASQPKLDSANNIIN 345

 Score = 36.2 bits (82), Expect = 0.83
 Identities = 41/149 (27%), Positives = 64/149 (42%), Gaps = 18/149 (12%)
 Frame = +1

Query: 2560 KIKVSTDSFSSTASPLSSRQNTGDSIKSAFXXXXXXXXXXXXXXXXXXXXXXXXXNKSSN 2739
            K+KV T    S  SP+ SRQNTGDS++SAF                         + +S+
Sbjct: 518  KLKVFTGERRSI-SPIKSRQNTGDSVRSAFATLRRGFSGGSFKSELPNKRNSLDISSTSS 576

Query: 2740 FRN-----VSEPSTCD-----PQYTFSITMNPTTRISSVSR--------KSRYESDSSVY 2865
              N     VS   + +     P+++ S + +  + +S + +        K+ Y+S S V 
Sbjct: 577  HSNGFKFRVSSSESIEEENVYPRFSHSRSSSSASIVSDLDQLQQDDTGAKNYYKSHSPVK 636

Query: 2866 FSANSGSAFRRESVADSNIDKVESLGKNS 2952
             SA  GS   R S+      +V+ L KNS
Sbjct: 637  VSATQGS---RSSIQ----KRVQDLLKNS 658

 Score = 36.2 bits (82), Expect = 0.83
 Identities = 17/38 (44%), Positives = 28/38 (73%)
 Frame = +1

Query: 3592 LRLVSNPDAKDLIKKRVMELLKNSETDNGVTRTAHGYG 3705
            +++ +   ++  I+KRV +LLKNS+ D+ V +TAHGYG
Sbjct: 635  VKVSATQGSRSSIQKRVQDLLKNSQ-DSPVKKTAHGYG 671

>KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {ON}
           Anc_2.284 YNL020C
          Length = 780

 Score =  436 bits (1120), Expect = e-134
 Identities = 208/323 (64%), Positives = 251/323 (77%), Gaps = 1/323 (0%)
 Frame = +1

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 180
           MN P+I  +  G++L +G+H   + KYL  GG+AQVY V +  S    N    +ACLKRV
Sbjct: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINS--NIACLKRV 58

Query: 181 IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 360
           IVPDK  LNTLRAEVDAMKLLK N+++VSYIDSHA +S +  G YEVF+LME+C RGG+I
Sbjct: 59  IVPDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLI 118

Query: 361 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 540
           DF+N+RL HRL E EIL IMS   QG+AAMH LQP L+HRDIKIENVLIS+N +YK+CDF
Sbjct: 119 DFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDF 178

Query: 541 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 720
           GS C ++RPPK  QE  F++HDIM NTTAQYRSPEM+D   G PI+EKSDIWALGVFLYK
Sbjct: 179 GSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYK 238

Query: 721 LCYYTTPFEKE-GENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVS 897
           LCYYTTPFEK  GE AIL  +FQ+PSYP YSD ++N+I +ML+K+P  RPN+CQVLE+VS
Sbjct: 239 LCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVS 298

Query: 898 KLQGVPCPIENFMLTRIKLQNSR 966
           +LQG+PCPI NF L R    N R
Sbjct: 299 RLQGIPCPIRNFYLLRAMENNKR 321

 Score = 49.3 bits (116), Expect = 8e-05
 Identities = 28/75 (37%), Positives = 41/75 (54%), Gaps = 1/75 (1%)
 Frame = +1

Query: 3592 LRLVSNPDAKDLIKKRVMELLKNSETDNGVT-RTAHGYGKYTDKPNTSQNKAPQRTISMD 3768
            +R+  N + K+ I+KRV +LLKN+E +   T RTA GYGKYTD        +P ++    
Sbjct: 644  VRMSVNREMKNSIQKRVQDLLKNAEENTTATVRTASGYGKYTDYNKNKDEISPTKSRVAQ 703

Query: 3769 FFEKQAVFAKDSNSK 3813
            F +  A  A  S  +
Sbjct: 704  FNQSTAALASLSGKR 718

>KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {ON}
            Anc_2.284 YNL020C
          Length = 369

 Score =  420 bits (1080), Expect = e-134
 Identities = 203/341 (59%), Positives = 256/341 (75%), Gaps = 1/341 (0%)
 Frame = +1

Query: 1    MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 180
            MNQP+I  Y  G +LP+G+HQV I KY+  GGFAQ+Y+V +    +  +    +ACLKRV
Sbjct: 1    MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDS--NIACLKRV 58

Query: 181  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 360
            IVPDK  LNTLRAEVDAMKLL+ NK++VSYIDSHA +S    G YEVFLLMEYC RGG+I
Sbjct: 59   IVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLI 118

Query: 361  DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 540
            DF+NTRL +RL E E+L I S V QG+AAMH LQPPL+HRDIKIENVLIS++  YKICDF
Sbjct: 119  DFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDF 178

Query: 541  GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 720
            GS   ++RPP  PQE  ++ HD++ NTTAQYRSPEMID Y G PIDEKSDIWA+GVFLYK
Sbjct: 179  GSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYK 238

Query: 721  LCYYTTPFEKE-GENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVS 897
            LCYYTTPFEK  GE AIL+ ++++P++P YS+ ++++I  ML ++P +RPNI QV+E++S
Sbjct: 239  LCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEIS 298

Query: 898  KLQGVPCPIENFMLTRIKLQNSRNNSNKSTSLNDTTNNSFN 1020
            K+Q VPCPI NF L       ++   +K   L     N+ N
Sbjct: 299  KMQNVPCPIVNFYLV------TQQQKHKMVQLQPIPVNTLN 333

>Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W
            (REAL)
          Length = 805

 Score =  436 bits (1121), Expect = e-134
 Identities = 220/336 (65%), Positives = 260/336 (77%), Gaps = 2/336 (0%)
 Frame = +1

Query: 1    MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVI--DSSNARNELGTMACLK 174
            MN P+I  YE G +L +G+H   I KYL  GGFAQVYS  +   D  ++ N    +ACLK
Sbjct: 1    MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYSAEISPPDPYSSAN----IACLK 56

Query: 175  RVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGG 354
            RVIVPDK GLNTLRAEVDAMKLLK NK++VSYIDSHA +S +    YEVF+LMEYC RGG
Sbjct: 57   RVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGVAYEVFVLMEYCERGG 115

Query: 355  VIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKIC 534
            +IDF+NTRL +RLQE EIL IM    QG+AAMH LQPPLIHRDIKIENVLIS  G YK+C
Sbjct: 116  LIDFMNTRLKNRLQESEILDIMGQTVQGIAAMHALQPPLIHRDIKIENVLISHEGLYKVC 175

Query: 535  DFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFL 714
            DFGS   V+RPPK PQE  ++ HDI+ NTTAQYRSPEMID Y G PIDEKSDIWALGVFL
Sbjct: 176  DFGSVSGVIRPPKNPQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFL 235

Query: 715  YKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 894
            YK+CYYTTPFEK GE AIL+ ++Q+PS+PQYSD ++N+I +ML + P +RPNICQVLE+V
Sbjct: 236  YKICYYTTPFEKTGEAAILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEV 295

Query: 895  SKLQGVPCPIENFMLTRIKLQNSRNNSNKSTSLNDT 1002
            S+LQ  PCPI NF L R   QN++  S +STS+  T
Sbjct: 296  SRLQNRPCPIRNFYLLRAMNQNAQFGS-ESTSMTYT 330

 Score = 41.6 bits (96), Expect = 0.019
 Identities = 55/263 (20%), Positives = 102/263 (38%)
 Frame = +1

Query: 2545 KNQNTKIKVSTDSFSSTASPLSSRQNTGDSIKSAFXXXXXXXXXXXXXXXXXXXXXXXXX 2724
            ++ ++K+K      S   SP+ SRQNTGDSI+SAF                         
Sbjct: 509  RSLSSKLKRVITGESRNGSPIKSRQNTGDSIRSAF-----------GMLRHGFTGSSINN 557

Query: 2725 NKSSNFRNVSEPSTCDPQYTFSITMNPTTRISSVSRKSRYESDSSVYFSANSGSAFRRES 2904
            ++S++F N +  ++ + + T S + NP++   +   K + E D              R S
Sbjct: 558  SRSTSFDN-NNANSVNRRLT-SSSSNPSSSNLNSDTKRKEELDKKRKLE-------HRRS 608

Query: 2905 VADSNIDKVESLGKNSSQYNNNSLQRMESVVENAPSETSFKLNSSLPKMSSVTDNSQTVK 3084
            +  S +   +   +N+S+  +    R  S V+   +  +     SL   +S  +  Q  K
Sbjct: 609  MPPSILSDFDQHERNNSRTGSRDYYRSHSPVKKTQTTPTTTTRPSLKSSNSDINIDQEKK 668

Query: 3085 ETIDNNFTQRIGSVVEYPLSRAESAVNSTSLSNELREVSAAVNILQRIDHEISQPVNETE 3264
            E+I           V   L+ +E +++  S S   +          R        V  T 
Sbjct: 669  ESIQRR--------VHNLLNNSEDSLSYKSASGYGKYTDTEAESTNR-----QSSVRITP 715

Query: 3265 FIEEDDSKEHTNPFTRDYSAKRD 3333
              EE  +  H++    D+++ +D
Sbjct: 716  ITEERFNNYHSSNTMNDHTSSKD 738

 Score = 37.4 bits (85), Expect = 0.37
 Identities = 45/153 (29%), Positives = 65/153 (42%), Gaps = 8/153 (5%)
 Frame = +1

Query: 3613 DAKDLIKKRVMELLKNSETDNGVTRTAHGYGKYTDKPNTSQNKAPQRTISMDFFEKQAVF 3792
            + K+ I++RV  LL NSE D+   ++A GYGKYTD    S N+     I+        + 
Sbjct: 666  EKKESIQRRVHNLLNNSE-DSLSYKSASGYGKYTDTEAESTNRQSSVRIT-------PIT 717

Query: 3793 AKDSNSKHDIRRNNVSIISNTIGGAETNGYHSFNDYNYREPAR------HTSVKIHTLKE 3954
             +  N+ H          SNT+     N + S  D     P R      H   KIH  + 
Sbjct: 718  EERFNNYHS---------SNTM-----NDHTSSKDKPKSRPPRPPPKPLHLRTKIHNTRC 763

Query: 3955 SSKKHGSFKSPPPLPPRISID--EKVKDQKLKE 4047
            SS    + +S  P   RIS +  E + D  + E
Sbjct: 764  SS----NLQSRKPPMERISSEATETIVDVNVDE 792

>NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {ON}
           Anc_2.284
          Length = 756

 Score =  433 bits (1113), Expect = e-134
 Identities = 204/317 (64%), Positives = 254/317 (80%), Gaps = 2/317 (0%)
 Frame = +1

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRV--IDSSNARNELGTMACLK 174
           MNQP IP Y  G +L +GTH+ +I+KYL  GGFAQ+Y+V +  +D+ +  N    +ACLK
Sbjct: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSN----VACLK 56

Query: 175 RVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGG 354
           RVIVP KSGLNTLRAEVDAMKLLK N+++VSYIDS+A +S    G YEV LLMEYC  GG
Sbjct: 57  RVIVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGG 116

Query: 355 VIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKIC 534
           +IDF+N+RL +RL E EIL I+S   QGVA MH LQP L+HRDIKIENVL S NG++K+C
Sbjct: 117 LIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLC 176

Query: 535 DFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFL 714
           DFGS C  +RPP+  QE +++ HDI+ NTTAQYR PEM+D Y G PIDEKSDIWALGVFL
Sbjct: 177 DFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFL 236

Query: 715 YKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 894
           YKLCYYTTPFEK GENAIL+ KFQ+P++P YSD ++N+I +ML+++P KRPNIC++LE++
Sbjct: 237 YKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEI 296

Query: 895 SKLQGVPCPIENFMLTR 945
           S +QGVPCPI+NF L R
Sbjct: 297 SSIQGVPCPIQNFYLIR 313

>NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa]
           {ON} Anc_2.284
          Length = 723

 Score =  431 bits (1109), Expect = e-134
 Identities = 211/325 (64%), Positives = 256/325 (78%), Gaps = 1/325 (0%)
 Frame = +1

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 180
           MNQP IP Y  G +L +G+H   I KYL  GGFAQ+Y+   I   N  N   T ACLKRV
Sbjct: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTE-ISPINPYNNSQT-ACLKRV 58

Query: 181 IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 360
           IVPDK+GLNTLRAEVDAMKLLK N+++VSYIDSHA RS +  G YEVFLLMEYC  GG+I
Sbjct: 59  IVPDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLI 118

Query: 361 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 540
           DF+NTRL +RL E EIL I+S   QGV+AMH LQP LIHRDIKIENVLIS  G++KICDF
Sbjct: 119 DFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDF 178

Query: 541 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 720
           GS CS +RPP+ PQE A++ HD++ NTTAQYR+PEM+D Y G PI+EKSDIWALGVFLYK
Sbjct: 179 GSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYK 238

Query: 721 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 900
           LCYYTTPFEK GE AIL+ ++Q+P++P Y+D ++N+I   L +DP KRPNICQ+LE++S+
Sbjct: 239 LCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISR 298

Query: 901 LQGVPCPIENFMLTR-IKLQNSRNN 972
           +QG+PCPI NF L+R I +Q S  N
Sbjct: 299 IQGIPCPINNFYLSRTINVQASLMN 323

 Score = 35.0 bits (79), Expect = 1.8
 Identities = 17/42 (40%), Positives = 25/42 (59%)
 Frame = +1

Query: 3592 LRLVSNPDAKDLIKKRVMELLKNSETDNGVTRTAHGYGKYTD 3717
            ++L S    ++ I+ RV  LL+  E +    +TA GYGKYTD
Sbjct: 586  VKLKSLSTQRESIQNRVKALLETFEEEPSTIKTASGYGKYTD 627

>ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL095W (PRK1) and
           YNL020C (ARK1)
          Length = 750

 Score =  430 bits (1105), Expect = e-133
 Identities = 204/317 (64%), Positives = 253/317 (79%)
 Frame = +1

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 180
           MNQ      + G +L +G+H+V I +YL  GGFAQ+YS  V+     +   G++ACLKRV
Sbjct: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQ---GSLACLKRV 57

Query: 181 IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 360
            VPDK  LNTLRAEVDAMK+LKG++++VSYIDSHA +S    G YEV+LLMEYC RGG+I
Sbjct: 58  HVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLI 117

Query: 361 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 540
           DF+N+RL  RL EFE+LKIMS V QG+ AMH L PPLIHRDIKIENVLIS +GD+K+CDF
Sbjct: 118 DFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDF 177

Query: 541 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 720
           GS   V+RPPK   E  ++ HDI+ NTTAQYR+PEMID Y   P+DEKSDIWALGVFLYK
Sbjct: 178 GSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYK 237

Query: 721 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 900
           +CY+TTPFEK GENAIL  KFQFPSYPQY+D ++N+I++ML++ P++RPNICQVLE+VS+
Sbjct: 238 VCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSR 297

Query: 901 LQGVPCPIENFMLTRIK 951
           +QGVPCP+ NF L R+K
Sbjct: 298 IQGVPCPLPNFYLERMK 314

>NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {ON} 
          Length = 661

 Score =  426 bits (1095), Expect = e-132
 Identities = 202/313 (64%), Positives = 243/313 (77%)
 Frame = +1

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 180
           MNQP+IP Y+ G +L +G+H+V + KYL  GGFAQ+Y+V++       N    +ACLKRV
Sbjct: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNT--NVACLKRV 58

Query: 181 IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 360
           IVPDK  LNTLRAEVD MKLL+ N ++VSYIDSHA +    +G YEVFLLMEYC  GG+I
Sbjct: 59  IVPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLI 118

Query: 361 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 540
           DF+NTRL  RL+E EIL IMS V QG+AAMH L PPL+HRDIKIENVL++  G+YK+CDF
Sbjct: 119 DFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDF 178

Query: 541 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 720
           GS C ++RPP   QE +++ HDIM NTTAQYR+PEMID Y G PIDEKSDIWALGVFLYK
Sbjct: 179 GSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYK 238

Query: 721 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 900
           LCYYTTPFEK GE AIL+  FQFP+YPQYSD ++ +IT ML + P +RPN  QVLE+VS 
Sbjct: 239 LCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSS 298

Query: 901 LQGVPCPIENFML 939
           +Q V CPI NF L
Sbjct: 299 MQNVQCPIPNFYL 311

>ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} similar to
            uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
            Protein serine/threonine kinase regulates the
            organization and function of the actin cytoskeleton
            through the phosphorylation of the Pan1p-Sla1p-End3p
            protein complex
          Length = 704

 Score =  427 bits (1098), Expect = e-132
 Identities = 209/341 (61%), Positives = 263/341 (77%), Gaps = 2/341 (0%)
 Frame = +1

Query: 1    MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVI--DSSNARNELGTMACLK 174
            MN PEIP Y  G VL +GTH   I KY+A GGFAQVYS  +   D+    N++    CLK
Sbjct: 1    MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKV----CLK 56

Query: 175  RVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGG 354
            RVI+P+K+GLN LRAEV+AMKLLKG+K++V YIDSHA RS L+ G YEVFLLME+C+ GG
Sbjct: 57   RVIIPEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGG 116

Query: 355  VIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKIC 534
            +IDF+NTRL +RL+E+EIL IMS V QG+AAMH LQPPLIHRDIKIENVLIS +G+YK+C
Sbjct: 117  LIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVC 176

Query: 535  DFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFL 714
            DFGS    +RPP+ PQE AF+ HDI+ NTTAQYRSPEMID Y    IDEKSDIWALG+FL
Sbjct: 177  DFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFL 236

Query: 715  YKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 894
            YKLCYYTTPFEK G+ AIL+ ++QF ++P YSD ++N+I+ ML++ P++RPNICQVLE+V
Sbjct: 237  YKLCYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEV 296

Query: 895  SKLQGVPCPIENFMLTRIKLQNSRNNSNKSTSLNDTTNNSF 1017
            S++QGV  P+ NF L R     + + S  +  ++    N+F
Sbjct: 297  SRMQGVSSPMRNFYLLRAMQHTNTSTSFITPPVSMVNTNTF 337

>NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284
          Length = 621

 Score =  421 bits (1083), Expect = e-131
 Identities = 206/332 (62%), Positives = 247/332 (74%)
 Frame = +1

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 180
           MNQP++  Y  G +L +G+HQ  I KYL  GGFAQVY+  +       N   ++ CLKRV
Sbjct: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINS--SIVCLKRV 58

Query: 181 IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 360
           IVPDK  LNTLRAEVDAMKLL+ N ++VSYIDSHA + +   G YEVFLLMEYC RGG+I
Sbjct: 59  IVPDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLI 118

Query: 361 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 540
           DF+NTRL +RL E EIL IMS V QGVAAMH LQPPL+HRDIKIENVL++  G YK+CDF
Sbjct: 119 DFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDF 178

Query: 541 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 720
           GS C ++RPP  PQE  ++ HDIM NTTAQYRSPEMI+   G PI+EKSDIWALGVFLYK
Sbjct: 179 GSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYK 238

Query: 721 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 900
           LCYYTTPFEK GENAIL+  FQFP++P YSD ++++I I LN  P +RPNI Q+LE+VSK
Sbjct: 239 LCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSK 298

Query: 901 LQGVPCPIENFMLTRIKLQNSRNNSNKSTSLN 996
           +Q VPCPI +F L R   Q       +   +N
Sbjct: 299 IQNVPCPIPDFYLQRKLAQAQAQTQAQDVVMN 330

>Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W
           (REAL)
          Length = 808

 Score =  427 bits (1097), Expect = e-131
 Identities = 208/322 (64%), Positives = 249/322 (77%)
 Frame = +1

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 180
           MN P+I  YE G +L +G+H   I KYL  GGFAQVY+  +       N    +ACLKRV
Sbjct: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTN--ANIACLKRV 58

Query: 181 IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 360
           IVPDK GLNTLRAEVDAMKLLK NK++VSYIDSHA +S +    YEVF+LME+C RGG+I
Sbjct: 59  IVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGVAYEVFVLMEFCERGGLI 117

Query: 361 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 540
           DF+NTRL +RL+E EIL+IMS   QG+AAMH LQPPLIHRDIKIENVLIS NG YK+CDF
Sbjct: 118 DFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDF 177

Query: 541 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 720
           GS   V+RPP+  QE  ++ HDI+ NTTAQYRSPEMID Y G PIDEKSDIWALG+FLYK
Sbjct: 178 GSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYK 237

Query: 721 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 900
           +CYYTTPFEK GE  IL+ ++Q+P +PQYSD ++N+I +ML + P KRPNICQVLE+VS+
Sbjct: 238 ICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSR 297

Query: 901 LQGVPCPIENFMLTRIKLQNSR 966
           LQ  PCPI NF L R   Q ++
Sbjct: 298 LQIKPCPIRNFYLLRAMSQTAQ 319

 Score = 38.5 bits (88), Expect = 0.16
 Identities = 20/45 (44%), Positives = 29/45 (64%)
 Frame = +1

Query: 3607 NPDAKDLIKKRVMELLKNSETDNGVTRTAHGYGKYTDKPNTSQNK 3741
            N + K+ I++RV  LLK+SE D    ++A GYGKYTD    + N+
Sbjct: 667  NQEKKESIQRRVHNLLKSSE-DPLTYKSASGYGKYTDTDTETSNR 710

 Score = 35.0 bits (79), Expect = 1.9
 Identities = 47/221 (21%), Positives = 85/221 (38%), Gaps = 25/221 (11%)
 Frame = +1

Query: 2545 KNQNTKIKVSTDSFSSTASPLSSRQNTGDSIKSAFXXXXXXXXXXXXXXXXXXXXXXXXX 2724
            ++ ++K+K      S  +SP+ SRQNTGDS +SA                          
Sbjct: 509  RSLSSKLKKVITGESRGSSPIKSRQNTGDSTRSAL--GMLRHGFTGSSMNNNRSASFDSN 566

Query: 2725 NKSSNFRNVSEPSTCDPQYTFSITMNPTTRISSVSRKSRYE----------SDSSVYFSA 2874
            N SSN  +V+         + S+    T R   + +K + E          SD   +   
Sbjct: 567  NGSSNNNSVNRRLGSSSTSSLSVFNPDTKRQEEIDKKQKLENRRSMPSSILSDFDQHERI 626

Query: 2875 NSGSAFRRESVADSNIDKVESLGK--------------NSSQYNNNSLQ-RMESVVENAP 3009
            NS +  R    + S + K+++  K              N +Q    S+Q R+ ++++++ 
Sbjct: 627  NSRTGSRDYYRSHSPVKKIQTTSKSAPKPITKPVIGDININQEKKESIQRRVHNLLKSSE 686

Query: 3010 SETSFKLNSSLPKMSSVTDNSQTVKETIDNNFTQRIGSVVE 3132
               ++K  S   K       + T  ET + + + RI  + E
Sbjct: 687  DPLTYKSASGYGKY------TDTDTETSNRHSSVRITPITE 721

>YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protein
           serine/threonine kinase; regulates the organization and
           function of the actin cytoskeleton and reduces endocytic
           ability of cell through the phosphorylation of the
           Pan1p-Sla1p-End3p protein complex
          Length = 810

 Score =  425 bits (1093), Expect = e-130
 Identities = 208/321 (64%), Positives = 248/321 (77%)
 Frame = +1

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 180
           MN P+I  YE G +L +G+H   I KYL  GGFAQVY+  +       N    +ACLKRV
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSN--ANIACLKRV 58

Query: 181 IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 360
           IVP K GLNTLRAEVDAMKLL+ NK++VSYIDSHA RS +    YEVF+LME+C RGG+I
Sbjct: 59  IVPHKQGLNTLRAEVDAMKLLRNNKHVVSYIDSHAARS-VNGIAYEVFVLMEFCERGGLI 117

Query: 361 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 540
           DF+NTRL +RLQE EIL+IMS   QG+ AMH LQPPLIHRDIKIENVLIS +G YK+CDF
Sbjct: 118 DFMNTRLQNRLQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHDGLYKVCDF 177

Query: 541 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 720
           GS   V+RPP+  QE  ++ HDI+ NTTAQYRSPEMID Y G PIDEKSDIWALGVFLYK
Sbjct: 178 GSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYK 237

Query: 721 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 900
           +CYYTTPFEK GE  IL+ ++Q+PS+PQYSD ++N+I +ML + P +RPNICQVLE+VS+
Sbjct: 238 ICYYTTPFEKSGEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSR 297

Query: 901 LQGVPCPIENFMLTRIKLQNS 963
           LQ  PCPI NF L R   QN+
Sbjct: 298 LQNKPCPIRNFYLLRAMNQNA 318

 Score = 36.6 bits (83), Expect = 0.64
 Identities = 19/45 (42%), Positives = 29/45 (64%)
 Frame = +1

Query: 3607 NPDAKDLIKKRVMELLKNSETDNGVTRTAHGYGKYTDKPNTSQNK 3741
            N + K+ I++RV  LLK+S+ D    ++A GYGKYTD    + N+
Sbjct: 669  NQEKKESIQRRVHNLLKSSD-DPVTYKSASGYGKYTDIGTETSNR 712

 Score = 35.0 bits (79), Expect = 1.9
 Identities = 17/35 (48%), Positives = 24/35 (68%)
 Frame = +1

Query: 2545 KNQNTKIKVSTDSFSSTASPLSSRQNTGDSIKSAF 2649
            ++ ++K+K      S   SP+ SRQNTGDSI+SAF
Sbjct: 511  RSLSSKLKKVITGESRGNSPIKSRQNTGDSIRSAF 545

>Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {ON}
            YNL020C (REAL)
          Length = 639

 Score =  419 bits (1078), Expect = e-130
 Identities = 218/407 (53%), Positives = 276/407 (67%), Gaps = 1/407 (0%)
 Frame = +1

Query: 1    MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 180
            MNQP+I  Y  G  L +G+HQV I KYL  GGFAQVYS  +  S    +    +ACLKRV
Sbjct: 1    MNQPQIGTYNVGTQLTVGSHQVEIVKYLTSGGFAQVYSALI--SPPDPHSHSNIACLKRV 58

Query: 181  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 360
            IVPDK  LNTLRAEVDAM+LL+ N+Y+VSYIDSHA ++ L  G YEVF+LMEYC RGG+I
Sbjct: 59   IVPDKPSLNTLRAEVDAMRLLRNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLI 118

Query: 361  DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 540
            DF+NTRL +RL EFEIL+IMS V QGVAAMH LQPPLIHRDIKIENVLIS N +YK+CDF
Sbjct: 119  DFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDF 178

Query: 541  GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 720
            GS C V+RPP+ PQE +++  DI  NTTAQYRSPEM+D + G PIDEKSDIWALG+FLYK
Sbjct: 179  GSVCGVIRPPRNPQELSYVQQDIFKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYK 238

Query: 721  LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 900
            LCYYTTPFEK GE AIL+  F+FP YP YS+ +R++I  +L ++P +RPN+ Q+L+++S 
Sbjct: 239  LCYYTTPFEKGGEPAILSGHFEFPPYPDYSEQLRDLIRDILVQNPCQRPNVYQLLKRISI 298

Query: 901  LQGVPCPIENFMLTRIKLQNSRNNSNKSTSLNDTTN-NSFNNELALDQCXXXXXXXXXXX 1077
            +Q VPCPI +  +   +  +S  N  +   L+ T N  S N+   +++            
Sbjct: 299  MQNVPCPISDIQVP--QAPDSHLNLTELHQLSATQNIRSLNSHSTIERPIPNAAFQSSMP 356

Query: 1078 XXXXXXDTKRKSLMEADTPYLKPPISNPRSGHCVSPSLKLNVDTSKF 1218
                     RK    +D   L     NP++    S S+   +D   F
Sbjct: 357  DAATQTLFSRKKSQTSDNTTLNYSAENPQTSLDKSESVSHVLDPLLF 403

>YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON}
            ARK1Serine/threonine protein kinase involved in
            regulation of the cortical actin cytoskeleton; involved
            in control of endocytosis
          Length = 638

 Score =  419 bits (1077), Expect = e-130
 Identities = 206/336 (61%), Positives = 255/336 (75%)
 Frame = +1

Query: 1    MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 180
            MNQP+I  Y  G  L +G+HQV I KYL  GGFAQVYS  +       N   ++ACLKRV
Sbjct: 1    MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNS--SVACLKRV 58

Query: 181  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 360
            IVPDK  LNTLRAEVDAM+LLK N+Y+VSYIDSHA ++ L  G YEVF+LMEYC RGG+I
Sbjct: 59   IVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLI 118

Query: 361  DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 540
            DF+NTRL +RL EFEIL+IMS V QGVAAMH LQPPLIHRDIKIENVLIS N +YK+CDF
Sbjct: 119  DFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDF 178

Query: 541  GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 720
            GS C ++RPP+  QE +++  DI+ NTTAQYRSPEMID + G PIDEKSDIWALG+FLYK
Sbjct: 179  GSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYK 238

Query: 721  LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 900
            LCYYTTPFEK G+ AIL+ KF+FP YP YS+ ++ +I  +L +DP  RPN+ Q+L+++S 
Sbjct: 239  LCYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISI 298

Query: 901  LQGVPCPIENFMLTRIKLQNSRNNSNKSTSLNDTTN 1008
            +Q VPCPI +  +  ++  +S  N  +   L+ T N
Sbjct: 299  MQNVPCPINDIQV--VQAPSSHLNLTELHQLSATQN 332

>Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W
           (REAL)
          Length = 809

 Score =  421 bits (1082), Expect = e-129
 Identities = 208/322 (64%), Positives = 248/322 (77%)
 Frame = +1

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 180
           MN P+I  Y+ G VL +G+H   I KYL  GGFAQVY+  +       N     ACLKRV
Sbjct: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSN--ANTACLKRV 58

Query: 181 IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 360
           IVPDK GLNTLRAEVDAMKLLK NK++VSYIDSHA +S +    YEVF+LME+C RGG+I
Sbjct: 59  IVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGIAYEVFVLMEFCERGGLI 117

Query: 361 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 540
           DF+NTRL  RL+E EIL+IMS   QG+AAMH LQPPLIHRDIKIENVLIS +G YK+CDF
Sbjct: 118 DFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDF 177

Query: 541 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 720
           GS   V+RPP+  QE  ++ HDI+ NTTAQYRSPEMID Y   PIDEKSDIWALGVFLYK
Sbjct: 178 GSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYK 237

Query: 721 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 900
           +CYYTTPFEK GE AIL+ ++Q+PS+PQYSD ++ +I +ML + P +RPNICQVLE+VS+
Sbjct: 238 ICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSR 297

Query: 901 LQGVPCPIENFMLTRIKLQNSR 966
           LQ  PCPI NF L R   QN++
Sbjct: 298 LQNEPCPIRNFYLLRAMGQNAQ 319

 Score = 42.4 bits (98), Expect = 0.011
 Identities = 42/185 (22%), Positives = 72/185 (38%), Gaps = 2/185 (1%)
 Frame = +1

Query: 2545 KNQNTKIKVSTDSFSSTASPLSSRQNTGDSIKSAFXXXXXXXXXXXXXXXXXXXXXXXXX 2724
            ++ ++K+K      S ++SP+ SRQNTGDSI+SAF                         
Sbjct: 511  RSLSSKLKKVITGESRSSSPIKSRQNTGDSIRSAFGMLRHGLTGSSVSNNRTISFDSNNG 570

Query: 2725 NKSSNF--RNVSEPSTCDPQYTFSITMNPTTRISSVSRKSRYESDSSVYFSANSGSAFRR 2898
            N + N   R ++  S+    + F      T R   + +K + E+               R
Sbjct: 571  NGNGNSVNRRLASSSSSSSNFNFD-----TKRQDDLDKKQKLEN---------------R 610

Query: 2899 ESVADSNIDKVESLGKNSSQYNNNSLQRMESVVENAPSETSFKLNSSLPKMSSVTDNSQT 3078
             S+  S +   +   +N+S+  +    R  S V+   +       ++L   SS  D  Q 
Sbjct: 611  RSMPPSILSDFDKHERNNSRTGSRDYYRSHSPVKKNQTTPKTASRTTLKSDSSDIDVKQV 670

Query: 3079 VKETI 3093
             KE+I
Sbjct: 671  NKESI 675

 Score = 35.0 bits (79), Expect = 1.9
 Identities = 33/132 (25%), Positives = 56/132 (42%), Gaps = 19/132 (14%)
 Frame = +1

Query: 3664 ETDNGVTRTAHGYGKYTD--KPNTSQNKAPQRTISMDFFEKQAVFAKDSNSKHDIRRNNV 3837
            E +N  T +   Y  ++   K  T+   A + T+  D  +   +  K  N K  I+R   
Sbjct: 625  ERNNSRTGSRDYYRSHSPVKKNQTTPKTASRTTLKSDSSD---IDVKQVN-KESIQRRVH 680

Query: 3838 SIISNT---IGGAETNGYHSFNDYNYREPARHTSVKI--------------HTLKESSKK 3966
            ++++N+   +     +GY  + D N     RH+SV+I               TLK  + +
Sbjct: 681  NLLNNSEDPLAHKSASGYGKYTDVNAEASNRHSSVRITPITEGKFNKYYNSGTLKGETSR 740

Query: 3967 HGSFKSPPPLPP 4002
            +   KS PP PP
Sbjct: 741  NDKHKSRPPRPP 752

 Score = 34.7 bits (78), Expect = 2.5
 Identities = 19/41 (46%), Positives = 26/41 (63%)
 Frame = +1

Query: 3619 KDLIKKRVMELLKNSETDNGVTRTAHGYGKYTDKPNTSQNK 3741
            K+ I++RV  LL NSE D    ++A GYGKYTD    + N+
Sbjct: 672  KESIQRRVHNLLNNSE-DPLAHKSASGYGKYTDVNAEASNR 711

>TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2.284
            YNL020C
          Length = 717

 Score =  418 bits (1074), Expect = e-129
 Identities = 207/343 (60%), Positives = 252/343 (73%), Gaps = 3/343 (0%)
 Frame = +1

Query: 1    MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTM--ACLK 174
            MNQP I  Y+ G  L +G HQV I KYL  GGFAQ+Y V+V    N  N +  M  ACLK
Sbjct: 1    MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQV----NPPNPINGMNLACLK 56

Query: 175  RVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGG 354
            RVIVP+KSGLNTLRAEV+AM+LLKG  ++V YIDS+A RS    G YEV  LME+C  GG
Sbjct: 57   RVIVPEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGG 116

Query: 355  VIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKIC 534
            +IDF+NTRL +RL+EFE+L IM+ V QG+ AMH L PPLIHRDIKIENVLIS NG+YK+C
Sbjct: 117  LIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVC 176

Query: 535  DFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFL 714
            DFGS   ++RPPK  +E  F+  DIM NTTAQYR PEM+D Y G PI+EKSDIWALGVFL
Sbjct: 177  DFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFL 236

Query: 715  YKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 894
            YK+CYYTTPFE  GE AIL+ ++Q+P YP YS  ++N+I +ML + P +RPN+CQVLE+V
Sbjct: 237  YKICYYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEV 296

Query: 895  SKLQGVPCPIENFMLTRIK-LQNSRNNSNKSTSLNDTTNNSFN 1020
            S +QG+PCP+ NF L R +  Q   NN+N S     T N   N
Sbjct: 297  SSMQGIPCPLPNFYLQRQQATQLMMNNTNGSIYPIPTQNTMMN 339

>CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095w PRK1
          Length = 688

 Score =  416 bits (1070), Expect = e-128
 Identities = 204/317 (64%), Positives = 239/317 (75%), Gaps = 2/317 (0%)
 Frame = +1

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSS--NARNELGTMACLK 174
           MNQPE+ +   G  L +GTH V I KYL  GGFAQ+Y+V ++     N  N    +ACLK
Sbjct: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSN----VACLK 56

Query: 175 RVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGG 354
           RV VPDK  LN LRAEVDAMKLL  NK++VSYIDSHA RS    G YEVFLLMEYC  GG
Sbjct: 57  RVKVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGG 116

Query: 355 VIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKIC 534
           +IDF+NTRL +RL E EIL IMS   QG+A MH L PPL+HRDIKIENVL+S+ G YK+C
Sbjct: 117 LIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVC 176

Query: 535 DFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFL 714
           DFGS   V+RPP+  QE  ++ HDIM NTTAQYR PEM+D Y G PIDEK+DIWALGVFL
Sbjct: 177 DFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFL 236

Query: 715 YKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 894
           YKLCYYTTPFEK GE AIL+ +FQFPS+P YSD ++N+I  ML + P  RPN+CQVLE+V
Sbjct: 237 YKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEV 296

Query: 895 SKLQGVPCPIENFMLTR 945
           S++Q VPCPI NF L R
Sbjct: 297 SRMQNVPCPIRNFYLLR 313

 Score = 37.0 bits (84), Expect = 0.47
 Identities = 21/55 (38%), Positives = 32/55 (58%)
 Frame = +1

Query: 3592 LRLVSNPDAKDLIKKRVMELLKNSETDNGVTRTAHGYGKYTDKPNTSQNKAPQRT 3756
            L L  N + +  I+ RV  LL N  + N V ++A GYGKYTD+ +++    P+ T
Sbjct: 541  LPLNPNSEKRKSIQLRVQHLLDNMSS-NEVKKSAQGYGKYTDELSSTGTNIPKVT 594

>Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {ON}
            YNL020C (REAL)
          Length = 637

 Score =  414 bits (1065), Expect = e-128
 Identities = 207/346 (59%), Positives = 261/346 (75%), Gaps = 1/346 (0%)
 Frame = +1

Query: 1    MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 180
            MNQP+I  Y  G  L +G+HQV I KYL  GGFAQVYSV +       N    +ACLKRV
Sbjct: 1    MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNT--NVACLKRV 58

Query: 181  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 360
            IVPDK  LNTLRAEVDAM+LLK N+Y+VSYIDSHA ++ L+ G YEVF+LMEYC RGG+I
Sbjct: 59   IVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLI 118

Query: 361  DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 540
            DF+NTRL +RL EFEIL+I+S V QGVAAMH LQPPLIHRDIKIENVLIS N +YK+CDF
Sbjct: 119  DFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDF 178

Query: 541  GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 720
            GS C ++R P+  QE +++  DI+ NTTAQYRSPEMID + G PIDEKSDIWALG+FLYK
Sbjct: 179  GSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYK 238

Query: 721  LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 900
            LCYYTTPFEK GE AIL+ KF+FP YP YS+ ++++I  +L ++P  RP++ Q+L+++S 
Sbjct: 239  LCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISI 298

Query: 901  LQGVPCPIENFMLTRIKLQNSRNNSNKSTSLNDTTN-NSFNNELAL 1035
            +Q VPCPI +  +  ++  +S  N  +   L+ T N  S N+ L +
Sbjct: 299  MQNVPCPIND--IQTVQAPSSHLNLTELHQLSATQNIQSLNSHLVM 342

>Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON}
           (89266..91407) [2142 nt, 714 aa]
          Length = 713

 Score =  417 bits (1071), Expect = e-128
 Identities = 200/315 (63%), Positives = 246/315 (78%)
 Frame = +1

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 180
           MNQP+IP Y +G  L +G H   I KYL  GG+AQVY  ++    +       + CLKR+
Sbjct: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGS--DIVCLKRL 58

Query: 181 IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 360
           IVPDK+ LNT RAEVDAMKLL+   ++VSYIDS+A +S L  G YEV LLME+C+ GG+I
Sbjct: 59  IVPDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLI 118

Query: 361 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 540
           DF+NTRL +RLQEFEIL IMS V QGVAAMH L+PPL+HRDIKIENVLIS +G+YK+CDF
Sbjct: 119 DFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDF 178

Query: 541 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 720
           GS C V+RPP + QE  F+ HDI+ NTTAQYR+PEMID     PIDEKSDIWALGVFLYK
Sbjct: 179 GSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYK 238

Query: 721 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 900
           LCYYTTPFEK GE AIL+ ++++ +YP YSD+++N+I +ML   P +RPNICQVLE+VS+
Sbjct: 239 LCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSR 298

Query: 901 LQGVPCPIENFMLTR 945
           LQG+PCPI+NF L R
Sbjct: 299 LQGIPCPIKNFYLER 313

 Score = 33.1 bits (74), Expect = 7.2
 Identities = 29/114 (25%), Positives = 55/114 (48%), Gaps = 5/114 (4%)
 Frame = +1

Query: 2743 RNVSEPSTCDPQYTFSITMNP--TTRISSVSRKSRYESDSSVYFSANSGSAFRRESVADS 2916
            +N+S+ S+    +  SI +N    T++  V     +E+DS +  S     +      +  
Sbjct: 508  QNLSQSSSTGSSHR-SIIVNDGDLTKLEKVQTSKEFEADSPIPVSKAKHHSLPSNFSSSI 566

Query: 2917 NIDKVESL--GKNSSQYNNNSLQ-RMESVVENAPSETSFKLNSSLPKMSSVTDN 3069
             I   E      +S+Q +NNS+Q RM+++++NA +    K+ S   K +  +DN
Sbjct: 567  KIGNGEGTLTTSDSNQSDNNSIQDRMKNLIDNADNIPINKIASDYGKYTKSSDN 620

>Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {ON}
            YNL020C (REAL)
          Length = 632

 Score =  414 bits (1063), Expect = e-128
 Identities = 206/351 (58%), Positives = 258/351 (73%), Gaps = 9/351 (2%)
 Frame = +1

Query: 1    MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 180
            MNQP+I  Y  G  L +G+HQV I KYL  GGFAQVYS  +       N    +ACLKRV
Sbjct: 1    MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNS--NVACLKRV 58

Query: 181  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 360
            IVPDK+ LNTLRAEVDAMKLL+ N+Y+VSYIDSHA ++ L  G YEVF+LMEYC RGG+I
Sbjct: 59   IVPDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLI 118

Query: 361  DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 540
            DF+NTRL +RL E EIL+IM  V QGVAAMH LQPPLIHRDIKIENVLIS   +YK+CDF
Sbjct: 119  DFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDF 178

Query: 541  GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 720
            GS C V+RPP+ PQE +++  D++ NTTAQYRSPEM+D + G PIDEKSDIWALG+FLYK
Sbjct: 179  GSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYK 238

Query: 721  LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 900
            LCYYTTPFEK GE AILN +F+F  YP YS+ +RN+I  +L ++P +RPN+ Q+L+Q++ 
Sbjct: 239  LCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITN 298

Query: 901  LQGVPCPIENFM--------LTRIKL-QNSRNNSNKSTSLNDTTNNSFNNE 1026
            +Q  P PI +          L  ++L QNS   + +S + +    NS +N+
Sbjct: 299  MQNAPYPIRDVQTVQRPSNHLNLMELHQNSATQNIQSLNSHSINENSMSNQ 349

>Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa]
           {ON} complement(102096..104201) [2106 nt, 702 aa]
          Length = 701

 Score =  416 bits (1068), Expect = e-128
 Identities = 206/334 (61%), Positives = 256/334 (76%), Gaps = 7/334 (2%)
 Frame = +1

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRV--IDSSNARNELGTMACLK 174
           MNQ ++P Y    V+ +G+H   I KYLA GG+AQVYS  V  +D S A N    +ACLK
Sbjct: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATN----IACLK 56

Query: 175 RVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGG 354
           RV+VPDK  LN LRAEVDA+K+L+  KY+VSYIDSHA +     G YEVF+LMEYCS G 
Sbjct: 57  RVVVPDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGS 116

Query: 355 VIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKIC 534
           +IDFLNTRL +RL+E EIL IM+ V  GVA MH LQP LIHRDIKIEN+LISENG+YK+C
Sbjct: 117 LIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVC 176

Query: 535 DFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFL 714
           DFGS C V+RPP++ +E  +I HDIM NTTAQYRSPEM+D   GY I+EKSDIWALGVFL
Sbjct: 177 DFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFL 236

Query: 715 YKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 894
           +KLCYYTTPFEKEGE AIL  +FQ+P+YP YSD ++N+I ++L+ DP KRPNICQ++E++
Sbjct: 237 FKLCYYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEEL 296

Query: 895 SKLQGVPCPIENFMLTRI-----KLQNSRNNSNK 981
           S+LQG+  P++NF L+R       +Q  +NNS K
Sbjct: 297 SRLQGIVPPMKNFYLSRALETSSLMQPLQNNSYK 330

 Score = 43.1 bits (100), Expect = 0.006
 Identities = 24/42 (57%), Positives = 29/42 (69%)
 Frame = +1

Query: 3592 LRLVSNPDAKDLIKKRVMELLKNSETDNGVTRTAHGYGKYTD 3717
            ++L +  +AKD IK+RV ELL  SE D    RTA GYGKYTD
Sbjct: 602  IKLKTTREAKDSIKRRVRELLLVSE-DEQYHRTASGYGKYTD 642

>CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} similar
           to uniprot|P53974 Saccharomyces cerevisiae YNL020c ARK1
           or uniprot|P40494 Saccharomyces cerevisiae YIL095w PRK1
          Length = 622

 Score =  407 bits (1045), Expect = e-126
 Identities = 204/327 (62%), Positives = 248/327 (75%), Gaps = 2/327 (0%)
 Frame = +1

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGT-MACLKR 177
           MN P IPKYE G  + +G+H V I KYL  GG+AQ+YS +++ +      LGT MA LKR
Sbjct: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQF---LGTNMAVLKR 57

Query: 178 VIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGV 357
           VIVPDKS LNTLRAEVDAMK LK +KYIVSYIDSHA +S+   G YEVFL+MEYCSRGG+
Sbjct: 58  VIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGL 117

Query: 358 IDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICD 537
           IDF+NTRL +RL E EIL I   + QGVAAMH LQPPLIHRDIKIENVLIS +  YK+CD
Sbjct: 118 IDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCD 177

Query: 538 FGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLY 717
           FGS    +RPPKTP+E A++ HDIM++TTAQYR+PEM+D   G+ +++KSDIWALGVFLY
Sbjct: 178 FGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLY 237

Query: 718 KLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVS 897
           KLCYYTTPFE+ GE  ILN   +FP YP YSD ++ +I  ML K+P+ RPNI Q+++ VS
Sbjct: 238 KLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVS 297

Query: 898 KLQGVPCPIENFML-TRIKLQNSRNNS 975
           KL  V CPI N  + T I +  S NN+
Sbjct: 298 KLLNVNCPIPNIHVPTDISIAVSNNNT 324

>KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {ON}
            Anc_2.284 YNL020C
          Length = 592

 Score =  399 bits (1026), Expect = e-123
 Identities = 197/340 (57%), Positives = 250/340 (73%), Gaps = 2/340 (0%)
 Frame = +1

Query: 1    MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRV--IDSSNARNELGTMACLK 174
            MNQP I  Y +G  L +G+HQV I KYL  GGFAQ+Y   +  ID  +  N    +ACLK
Sbjct: 1    MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTN----IACLK 56

Query: 175  RVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGG 354
            RVIVPDK  LN LRAEVDAMKLL+ N+ +VSYIDSHA +S  + G YEVFLLMEYC  GG
Sbjct: 57   RVIVPDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGG 116

Query: 355  VIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKIC 534
            +I+FLN+RL +RL+E E++ IM  V QGVAAMH LQPPL+HRDIKIENVL+S+N ++K+C
Sbjct: 117  LINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLC 176

Query: 535  DFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFL 714
            DFGS    +RPP  PQE A + +DIM NTTAQYRSPEMID   G+PIDEKSDIWALGVFL
Sbjct: 177  DFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFL 236

Query: 715  YKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 894
            YK+CYYTTPFEK GE  IL  +++FP++P YSD +R++I+ +L   P  RPNI  V++++
Sbjct: 237  YKICYYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKEL 296

Query: 895  SKLQGVPCPIENFMLTRIKLQNSRNNSNKSTSLNDTTNNS 1014
            S ++ + CPI NF L +  + ++ NN     S+ + TN S
Sbjct: 297  SDMKNISCPIINFYL-KPNMTDASNNIQHLHSIMNNTNTS 335

>KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {ON}
           Anc_2.284 YNL020C
          Length = 788

 Score =  387 bits (993), Expect = e-116
 Identities = 186/324 (57%), Positives = 242/324 (74%), Gaps = 3/324 (0%)
 Frame = +1

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 180
           MNQP IP Y  G V+ +G+HQ  I KYL  GGFAQ+YSV +       N    +ACLKRV
Sbjct: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNS--NIACLKRV 58

Query: 181 IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 360
           IVP+KSGLN LR EVDAMKLLK N+++VSYIDS+A +SE   G YEVFLLMEYC RG ++
Sbjct: 59  IVPNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLL 118

Query: 361 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 540
           DF+NT+L  RLQE E+L IM+ VCQG+AAMH L PPLIHRDIKIENVLIS +G +K+CDF
Sbjct: 119 DFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDF 178

Query: 541 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEK---SDIWALGVF 711
           GS C ++RPP+ PQE  ++ HD+M NTTAQYRSPEMID   G+PI+ K      W + + 
Sbjct: 179 GSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQ 238

Query: 712 LYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQ 891
           +  L +YT  F ++ E AILN ++Q+P+YP YSD ++N++ ++L+  P+KRPNICQ+LE+
Sbjct: 239 I-MLLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEE 295

Query: 892 VSKLQGVPCPIENFMLTRIKLQNS 963
           +SK+Q +PCPI+NF L R + Q +
Sbjct: 296 ISKIQNIPCPIDNFYLERSRHQGA 319

 Score = 49.7 bits (117), Expect = 6e-05
 Identities = 67/300 (22%), Positives = 120/300 (40%), Gaps = 3/300 (1%)
 Frame = +1

Query: 2833 KSRYESDS--SVYFSANSGSAFRRESVADSNIDKVESLGKNSSQYNNNSLQRMESVVENA 3006
            ++ Y S S  ++ + AN  +     +    NI    S G  +  Y ++  Q +E      
Sbjct: 413  ENHYLSSSVPAISYLANQHANDNIRNTTKLNIPAQNSTGSKNKTYVDSETQTLE------ 466

Query: 3007 PSETSFKLNSSLPKMSSV-TDNSQTVKETIDNNFTQRIGSVVEYPLSRAESAVNSTSLSN 3183
              E S +    LP +S+  TDN+        N+   R+G  +   ++   SA  S+S+  
Sbjct: 467  --EPSLQHTRILPHISTDRTDNT-------GNSIVSRLGVQLRNVITNDSSA--SSSIDT 515

Query: 3184 ELREVSAAVNILQRIDHEISQPVNETEFIEEDDSKEHTNPFTRDYSAKRDSFNTIXXXXX 3363
                 ++  + ++ + + +S   N  + +  ++++ H       YS    S N I     
Sbjct: 516  VQETGNSIKSAIESLKNSVSGMANNVKALSVENARNHLERLGSSYSI--GSNNNI----- 568

Query: 3364 XXXXXXXTRKESVTANTSPEREIAPDIFLQKTESLVKNSDSLQTTNSIQFESLLSGFYXX 3543
                           N++P   I P +    T + +K + S  T + +  E+ L      
Sbjct: 569  ------------AKPNSAP---IIPAVVTTHTSNSLKTAVSSPTHSELSDENEL----YD 609

Query: 3544 XXXXXXXXXXXXXXXXLRLVSNPDAKDLIKKRVMELLKNSETDNGVTRTAHGYGKYTDKP 3723
                            L+   +   K  I+KRV+ LLKN+E D+ V +TA GYGKYT +P
Sbjct: 610  TLHLPDPKTSFQSPSPLKYAVDRKMKASIEKRVLNLLKNAE-DSPVKKTAAGYGKYTKRP 668

>TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {ON}
           Anc_2.284 YNL020C
          Length = 707

 Score =  383 bits (984), Expect = e-116
 Identities = 185/315 (58%), Positives = 240/315 (76%)
 Frame = +1

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 180
           M+Q    KY+KG  L + +H+VIIE YL  GGFAQVY+ R+  +S  +N    + CLKRV
Sbjct: 1   MSQIFEDKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARI--TSEHKNLYPELTCLKRV 58

Query: 181 IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 360
           IVP+K  LN LRAEVDAMK+LK NKYIVSYIDSHA R +  +  Y V LLMEYCS  G++
Sbjct: 59  IVPNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLL 118

Query: 361 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 540
           DF+N RL  RL+E EILKIM+DV QGV  MH LQPPL+HRDIKIENVL+S +G++K+CDF
Sbjct: 119 DFMNLRLKERLKEEEILKIMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDF 178

Query: 541 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 720
           GS   VLR P + +E  ++ +DI+ NTTAQYRSPEM++   G+PI+EKSDIWALG+ LYK
Sbjct: 179 GSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYK 238

Query: 721 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 900
           LCYYTTPFE+ G  AI+  KF +P+YPQY+D ++NII ++L+ +PI+RPNICQ+LE++ +
Sbjct: 239 LCYYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFR 298

Query: 901 LQGVPCPIENFMLTR 945
           +Q    P+ NF + R
Sbjct: 299 IQHKSSPLPNFYVQR 313

 Score = 60.8 bits (146), Expect = 2e-08
 Identities = 61/226 (26%), Positives = 98/226 (43%), Gaps = 4/226 (1%)
 Frame = +1

Query: 2290 SLNNDSTIDDTFAKKHDNLRKLRSKDSNTSITSMFSEITNSSTKNVFVTTPRNDDAISKS 2469
            S+N++ST+++  + KH++    R    +   +     IT++   N+   TPR+ D+   S
Sbjct: 432  SINDNSTLNNMTSLKHEHSFNSREAYIHPDFSGSKHFITSNDALNLNCRTPRSRDSSINS 491

Query: 2470 QSSLNLIQFXXXXXXXXXXXXXLNYKNQNTKIKVSTDSFSSTASPLSSRQNTGDSIKSAF 2649
             SS++ I                  K+  TKIK++T     + SP+ SRQNTGDSI+SAF
Sbjct: 492  NSSVDSISRNSTGGSLI--------KSLGTKIKLTTTGGKRSQSPIKSRQNTGDSIRSAF 543

Query: 2650 XXXXXXXXXXXXXXXXXXXXXXXXXNKSSNFRNVSEPSTCDPQYTFSITMNPTTRISSVS 2829
                                       S  F  + E S  D +Y F  T       +S+S
Sbjct: 544  ----NKVRQGINLRSSRISSNDSVVRNSEQFGGIPELSN-DNKYQFDTTSKNRHEYNSLS 598

Query: 2830 RK---SRYESDSSVYFSANSGSAFRRESVADSNI-DKVESLGKNSS 2955
            RK   S  + +S    ++N          A  +I D+V++L K+SS
Sbjct: 599  RKLSLSSQKQNSLNDSTSNDPIILITNLEAKKSIKDRVQALMKSSS 644

 Score = 45.4 bits (106), Expect = 0.001
 Identities = 23/44 (52%), Positives = 32/44 (72%)
 Frame = +1

Query: 3598 LVSNPDAKDLIKKRVMELLKNSETDNGVTRTAHGYGKYTDKPNT 3729
            L++N +AK  IK RV  L+K+S +DN V  +AHGYGKYTD  ++
Sbjct: 622  LITNLEAKKSIKDRVQALMKSS-SDNHVIISAHGYGKYTDNKSS 664

>KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.273
           YBR059C
          Length = 913

 Score =  300 bits (769), Expect = 7e-85
 Identities = 156/320 (48%), Positives = 220/320 (68%), Gaps = 17/320 (5%)
 Frame = +1

Query: 16  IPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARN-----------ELGTM 162
           + KY+ G+V+ +G+H+V I +Y+A GGFAQ+YSV+ ++ +N  +           ++G +
Sbjct: 15  VEKYQPGKVIVVGSHRVEILQYIAEGGFAQIYSVKFLEYANEFDREESPGSKDQLQVGDL 74

Query: 163 ACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQR------SELKQGEYEVF 324
           ACLKRVIV D++GLN LR EV+ MK L G   IV Y DS+A R      S+ ++ ++EV 
Sbjct: 75  ACLKRVIVQDQNGLNELRNEVNVMKKLVGAPNIVQYYDSNASRLRNGTDSQPQENKFEVL 134

Query: 325 LLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVL 504
           LLME C    ++D++N RL  +L E EIL++M DV   +A MHYL+ PLIHRDIKIENVL
Sbjct: 135 LLMELCPNKSLLDYMNLRLATKLSEQEILEVMYDVSLAIAQMHYLRKPLIHRDIKIENVL 194

Query: 505 ISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEK 684
           + +   +K+CDFGS  +      T ++ A++  +I ++TT QYRSPEMID Y   PIDEK
Sbjct: 195 VDQKNRFKLCDFGSTSTCFPMVVTHRDIAYLTQNIYVHTTPQYRSPEMIDLYRCLPIDEK 254

Query: 685 SDIWALGVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKR 864
           SDIWALG+FLYKL ++TTPFE+ G+ AIL+ KF+FP    YS  + N+I +ML+++P  R
Sbjct: 255 SDIWALGIFLYKLLFFTTPFERTGQFAILHSKFEFPQ-NNYSFKLINLIIVMLSENPNLR 313

Query: 865 PNICQVLEQVSKLQGVPCPI 924
           PNI QVL Q+ +L+ VP PI
Sbjct: 314 PNIYQVLHQICQLKQVPIPI 333

>KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {ON}
            Anc_3.273 YBR059C
          Length = 912

 Score =  298 bits (762), Expect = 5e-84
 Identities = 169/343 (49%), Positives = 214/343 (62%), Gaps = 30/343 (8%)
 Frame = +1

Query: 22   KYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVI----------DSSNARN-------- 147
            K+  G V+ +G H+V I KYLA GGFAQ+YSV  I          DS+   N        
Sbjct: 18   KFNPGAVVAVGRHKVEIIKYLAEGGFAQIYSVNFIEYLNEFSNEPDSTEDSNIDEFQQFK 77

Query: 148  -ELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVF 324
             E G +ACLKRV+VPD++GLN LR EV+ M+ LKG   IV Y DS+A R       +EV 
Sbjct: 78   LEPGNLACLKRVMVPDENGLNELRNEVNVMRKLKGTPNIVQYYDSNASRRHDGNPGFEVL 137

Query: 325  LLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVL 504
            LLME C    ++D++N RL  +L E EILKIM DV  G++ MHYLQ PLIHRDIKIENVL
Sbjct: 138  LLMELCPNNSLLDYMNQRLTTKLSEKEILKIMYDVTLGISQMHYLQKPLIHRDIKIENVL 197

Query: 505  ISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEK 684
            +  + ++K+CDFGS  +      + QE A +  +I ++TT QYRSPEMID Y   PIDEK
Sbjct: 198  VDSSNNFKLCDFGSTSACFPIVTSHQEIAVLTQNIYVHTTPQYRSPEMIDLYRNLPIDEK 257

Query: 685  SDIWALGVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKR 864
            SDIWALGVFLYKL +YTTPFE  G+ AIL+ K++ P    YS  + N+I IML ++P  R
Sbjct: 258  SDIWALGVFLYKLLFYTTPFEMTGQFAILHSKYEIPP-NNYSSRLINLIIIMLAENPNLR 316

Query: 865  PNICQVLEQVSKLQGVPCPI-----------ENFMLTRIKLQN 960
            PNI QV+ QV    G+  PI           EN+   + KLQN
Sbjct: 317  PNIYQVMHQVCITIGIEPPIKDKYEMGPYDFENYTHFQNKLQN 359

>CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa]
           {ON} similar to uniprot|P38080 Saccharomyces cerevisiae
           YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 1027

 Score =  297 bits (760), Expect = 6e-83
 Identities = 156/318 (49%), Positives = 208/318 (65%), Gaps = 8/318 (2%)
 Frame = +1

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGT------- 159
           +N P   KY  G+++ +G H+V I  YLA GGFAQ+Y V+ ++  N    LG+       
Sbjct: 12  LNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVG 71

Query: 160 -MACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLME 336
            +ACLKRVIV D+ GLN +R EV+ MK LK +  IV Y DS+A R    +  +EV LLME
Sbjct: 72  DIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLME 131

Query: 337 YCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISEN 516
            C    ++D++N RL  +L E EILKIM DV  G++ MHYL  PLIHRDIKIENVL+  N
Sbjct: 132 LCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDAN 191

Query: 517 GDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIW 696
            ++K+CD GS      P  + Q+ A +  +I ++TT QYR+PEMID Y   PI+EKSDIW
Sbjct: 192 NNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIW 251

Query: 697 ALGVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNIC 876
           ALG+FLYKL +YTTPFE  G+ AIL+ K+ FP   +YS  I N+I IML ++P  RPNI 
Sbjct: 252 ALGIFLYKLLFYTTPFEITGQMAILHSKYDFPP-NKYSSKIINLIIIMLAENPNLRPNIF 310

Query: 877 QVLEQVSKLQGVPCPIEN 930
           QV+  +  +  +P PIE+
Sbjct: 311 QVVYHICSIMNLPVPIED 328

>KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}
           Anc_3.273 YBR059C
          Length = 949

 Score =  295 bits (754), Expect = 1e-82
 Identities = 162/322 (50%), Positives = 211/322 (65%), Gaps = 15/322 (4%)
 Frame = +1

Query: 4   NQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDS---------------SN 138
           N   I K+EKG+ L +GTH+V I  YL  GGFAQ+Y V+ I+                SN
Sbjct: 24  NVGTIEKFEKGQNLAVGTHKVEIVDYLTEGGFAQIYVVKFIEVLNEFDNEDNGSNVRISN 83

Query: 139 ARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYE 318
              +LG +ACLKRV+V D+ GLN +R EV+ MK L+G   IV Y DS+A RS      YE
Sbjct: 84  YSLKLGDVACLKRVLVYDEVGLNEMRNEVNVMKKLRGCPNIVQYYDSNATRSHNGNPGYE 143

Query: 319 VFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIEN 498
           V LLME CS   +++++N RL  +L E E+LKIM DV  GVA MHYL+ PLIHRDIKIEN
Sbjct: 144 VLLLMELCSNNSLLNYMNQRLATQLSEKEVLKIMYDVTSGVAQMHYLKTPLIHRDIKIEN 203

Query: 499 VLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPID 678
           VL+  N ++K+CDFGSA +      T Q+ A +  ++ ++TT QYRSPEMID Y   PI+
Sbjct: 204 VLVDSNNNFKLCDFGSATTCPPVATTHQDIALLGQNVYVHTTPQYRSPEMIDLYRYLPIN 263

Query: 679 EKSDIWALGVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPI 858
           EKSDIWALGVFLYKL +YTTPFE  G+ A+L+ KF  P+  +YS  I N++ IML+++  
Sbjct: 264 EKSDIWALGVFLYKLLFYTTPFETTGQFAMLHSKFDIPA-NKYSSKIINLVIIMLSENLN 322

Query: 859 KRPNICQVLEQVSKLQGVPCPI 924
            RPNI QV+  + +L  V  PI
Sbjct: 323 LRPNIYQVMHYICQLIQVDTPI 344

>KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} similar
           to uniprot|P38080 Saccharomyces cerevisiae YBR059C AKL1
           Ser-Thr protein kinase
          Length = 901

 Score =  292 bits (748), Expect = 3e-82
 Identities = 155/314 (49%), Positives = 207/314 (65%), Gaps = 7/314 (2%)
 Frame = +1

Query: 10  PEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNE-------LGTMAC 168
           P + + + G  + +G H+V I KYLA GGFA +Y V+ ++ +N   +       +G  AC
Sbjct: 24  PVLERLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVKFVEYANELEQAPSITLKVGETAC 83

Query: 169 LKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSR 348
           LKRV+V D++GLN +R EV  MK L G   IV Y DSHA RS      +EV LLME C  
Sbjct: 84  LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRSRDGVPGFEVMLLMELCPN 143

Query: 349 GGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYK 528
             ++D++N RL  +L E EILKIM DV + +A MHYL  PLIHRD+KIENVL+  + ++K
Sbjct: 144 NSLLDYMNQRLTTKLSEQEILKIMFDVTRALAQMHYLPIPLIHRDVKIENVLVDGDNNFK 203

Query: 529 ICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGV 708
           +CDFGS  + L    T QE A + ++I I+TT QYRSPEMID Y   PIDEKSDIWALG+
Sbjct: 204 LCDFGSTSTCLPVANTHQEIAVLTNNIYIHTTPQYRSPEMIDLYRCLPIDEKSDIWALGI 263

Query: 709 FLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLE 888
           FLYKL +YTTPFE  G+ AIL+ K++FP    YS  + N+I IML ++P  RPNI Q+++
Sbjct: 264 FLYKLLFYTTPFELTGQFAILHSKYEFP-INNYSSKLINLIIIMLAENPNLRPNIYQIMD 322

Query: 889 QVSKLQGVPCPIEN 930
            +  +  V  PIE+
Sbjct: 323 NLCSIMKVENPIED 336

>Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059C
            (AKL1) - Serine-threonine protein kinase [contig 32] FULL
          Length = 935

 Score =  293 bits (749), Expect = 4e-82
 Identities = 155/314 (49%), Positives = 208/314 (66%), Gaps = 7/314 (2%)
 Frame = +1

Query: 10   PEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNA-------RNELGTMAC 168
            P + + + G  + +G H+V I KYLA GGFA +Y VR I+ +N        + E+G +AC
Sbjct: 66   PVLEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLAC 125

Query: 169  LKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSR 348
            LKRV+V D++GLN +R EV  MK L G   IV Y DSHA R+      +EV LLME C  
Sbjct: 126  LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPN 185

Query: 349  GGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYK 528
              ++D++N RL  +L E EILKIM DV + +A MHYL  PLIHRD+KIENVL+  N ++K
Sbjct: 186  NSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFK 245

Query: 529  ICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGV 708
            +CDFGS  +      T QE A + ++I ++TT QYRSPEMID Y   PI+EKSDIWALG+
Sbjct: 246  LCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGI 305

Query: 709  FLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLE 888
            FLYKL +YTTPFE  G+ AIL+ K++FP    YS  + N+I IML ++P  RPNI QV++
Sbjct: 306  FLYKLLFYTTPFELTGQFAILHSKYEFP-VNNYSSKLINLIIIMLAENPNLRPNIYQVMD 364

Query: 889  QVSKLQGVPCPIEN 930
             +  +  V  P+E+
Sbjct: 365  NLCSILKVKNPLED 378

>SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 858

 Score =  291 bits (744), Expect = 5e-82
 Identities = 155/313 (49%), Positives = 205/313 (65%), Gaps = 6/313 (1%)
 Frame = +1

Query: 10  PEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARN------ELGTMACL 171
           P + K   G ++ +G+H+V I KYLA GGFA +Y V+ ++ SN         + G +ACL
Sbjct: 27  PTLEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACL 86

Query: 172 KRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRG 351
           KRV+V D++GLN LR EV+ MK LK +  IV Y DS+A R       YEV LLME C   
Sbjct: 87  KRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNK 146

Query: 352 GVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKI 531
            ++D++N RL  +L E E+LKIM DV + VA MH+L  PLIHRDIKIENVL+    ++K+
Sbjct: 147 SLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKL 206

Query: 532 CDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVF 711
           CDFGS  S      T Q+ A + ++I ++TT QYR+PEMID Y   PIDEKSDIWALG+F
Sbjct: 207 CDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIF 266

Query: 712 LYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQ 891
           LYKL +YTTPFE  G+ AIL+ K+  P+   YS  + N+I IML ++P  RPNI QV+ Q
Sbjct: 267 LYKLLFYTTPFELTGQFAILHSKYDIPA-NNYSSKLINLIIIMLAENPNLRPNIYQVIYQ 325

Query: 892 VSKLQGVPCPIEN 930
           V  +  V  P E+
Sbjct: 326 VCAIMKVDVPFED 338

>Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)
            [2517 nt, 839 aa]
          Length = 838

 Score =  287 bits (735), Expect = 5e-81
 Identities = 157/336 (46%), Positives = 212/336 (63%), Gaps = 18/336 (5%)
 Frame = +1

Query: 16   IPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVID-----SSNARNEL--GTMACLK 174
            +  Y  G ++ +G H+V + KYLA GGFA++Y V+ ++       N +  L  G   CLK
Sbjct: 26   LDSYVPGTIVIVGIHKVEVVKYLAEGGFAKIYVVKFLEYLSTVDPNGKEVLQNGDQLCLK 85

Query: 175  RVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGG 354
            RV+V D +GLN +R EV+ M+ LKG   +V Y DS+A R       YEV LLME CS   
Sbjct: 86   RVLVQDDNGLNEMRNEVEVMRKLKGAPCVVQYYDSNASRRIDGAPGYEVLLLMELCSNNS 145

Query: 355  VIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKIC 534
            ++D++N RL  +L E EILKIM DV   VA MHYL  PLIHRDIKIENVL+    ++K+C
Sbjct: 146  LLDYMNQRLATKLSEDEILKIMFDVTLAVAQMHYLPSPLIHRDIKIENVLVDSKNNFKLC 205

Query: 535  DFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFL 714
            DFGS  + L    + Q+ A +  +I ++TT QYRSPEMID Y   P++EKSDIWALGVFL
Sbjct: 206  DFGSTSTCLPIVSSHQDIAILTQNIYVHTTPQYRSPEMIDLYRCLPVNEKSDIWALGVFL 265

Query: 715  YKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 894
            YKL +YTTPFE+ G+ AIL+ K++FP    YS  + N+I +ML ++P  RPNI QVL Q+
Sbjct: 266  YKLMFYTTPFERTGQFAILHSKYEFP-LNNYSSKLINLIIVMLAENPNLRPNIYQVLNQI 324

Query: 895  SKLQGVPCPI-----------ENFMLTRIKLQNSRN 969
              + G+  P+           E +   + KLQN +N
Sbjct: 325  CYISGIKNPMDDAYGLGAYSFEKYTEYQSKLQNYQN 360

>ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 1115

 Score =  291 bits (745), Expect = 1e-80
 Identities = 152/317 (47%), Positives = 208/317 (65%), Gaps = 7/317 (2%)
 Frame = +1

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVI-------DSSNARNELGT 159
           + +P +  Y  G V+ +G  QV I  ++A GGFAQ+YSV+ I       + S A  + G 
Sbjct: 14  VTKPVVDGYAPGTVVAVGNQQVEIISFIAEGGFAQIYSVKYIKFLGEFNNGSKAPLQPGD 73

Query: 160 MACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEY 339
           +ACLKRV+VPD++GL+ +R EV+ MK L+G K I+ Y DS+A R    Q  YEV LLME 
Sbjct: 74  IACLKRVLVPDENGLSEMRNEVEVMKQLRGAKAIIQYYDSNASRRTSGQVGYEVLLLMEL 133

Query: 340 CSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENG 519
           C    ++D++N RL  RL E EILK+M D    ++ MHYL  PLIHRDIKIENVL+    
Sbjct: 134 CPNNSLLDYMNQRLATRLTEKEILKVMYDTTLAISQMHYLPIPLIHRDIKIENVLVDAQN 193

Query: 520 DYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWA 699
           ++K+CDFGS  +      T Q+ A +  +I +NTT QYRSPEMID Y   PI+EKSDIWA
Sbjct: 194 NFKLCDFGSTSTCFPLVTTHQDIAILTQNIYVNTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 700 LGVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQ 879
           LG+FLYKL ++ TPFE  G+ +IL+ K++FP+  +YS  + N+I IML ++P  RPNI Q
Sbjct: 254 LGIFLYKLLFFITPFEMTGQFSILHSKYEFPA-NKYSSKLINLIIIMLAENPYVRPNIYQ 312

Query: 880 VLEQVSKLQGVPCPIEN 930
           V+  +  + G   PIE+
Sbjct: 313 VMHHICSVIGCEVPIED 329

>NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]
           {ON} Anc_3.273
          Length = 1095

 Score =  290 bits (743), Expect = 2e-80
 Identities = 153/316 (48%), Positives = 207/316 (65%), Gaps = 8/316 (2%)
 Frame = +1

Query: 7   QPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNA--------RNELGTM 162
           +P   +Y  G  + +G H+V I KY+A GGFAQ+Y+V+ I+  N         + ++G +
Sbjct: 16  KPNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDV 75

Query: 163 ACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYC 342
           ACLKRV+V D++GLN +R EV+ MK L+G   IV Y DS+A R       +EV LLME C
Sbjct: 76  ACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELC 135

Query: 343 SRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGD 522
               ++D++N RL  +L E EILKIM DV   V+ MHYL  PL+HRDIKIENVL+    +
Sbjct: 136 PNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNN 195

Query: 523 YKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWAL 702
           +K+CDFGS  +      T Q+ A +  +I ++TT QYRSPEMID Y   PIDEKSDIWAL
Sbjct: 196 FKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWAL 255

Query: 703 GVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQV 882
           G+FLYKL ++TTPFE  G+ AIL+ K++FP    YS  + N+I IML ++P  RPNI QV
Sbjct: 256 GIFLYKLLFFTTPFELTGQFAILHSKYEFPK-NNYSSKLINLIIIMLAENPNLRPNIYQV 314

Query: 883 LEQVSKLQGVPCPIEN 930
           L  +  + G+  PIE+
Sbjct: 315 LHNICSISGMKVPIED 330

>Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON}
           (72364..75669) [3306 nt, 1102 aa]
          Length = 1101

 Score =  288 bits (737), Expect = 1e-79
 Identities = 153/311 (49%), Positives = 200/311 (64%), Gaps = 9/311 (2%)
 Frame = +1

Query: 4   NQPE-IPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARN--------ELG 156
           N+P  + K+  G  + +G  +V I KYL  GGFAQ+Y V+ +++SN  +        ++G
Sbjct: 17  NKPSAVEKFANGSTVVVGNKKVEIVKYLTEGGFAQIYIVKFLENSNEFDSNNSNIPLKIG 76

Query: 157 TMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLME 336
            +ACLKRV+V D++GLN +R EV+ MKLLKG   IV Y DS+A R +     +EV LLME
Sbjct: 77  DLACLKRVLVQDENGLNEMRNEVEVMKLLKGAPNIVQYFDSNASRRKDGTNGFEVLLLME 136

Query: 337 YCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISEN 516
            C    ++DF+N RL  +L E EIL IM DV   VA MH L PPLIHRDIKIENVL+   
Sbjct: 137 LCPNKSLLDFMNQRLTTKLSEKEILTIMHDVTLAVAQMHTLSPPLIHRDIKIENVLVDSQ 196

Query: 517 GDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIW 696
             +K+ DFGS           Q+ A +  DI ++TT QYRSPEMID Y   PIDEKSDIW
Sbjct: 197 NGFKLADFGSTSKCFPAVSAHQDIAILSQDIFMHTTPQYRSPEMIDLYKCLPIDEKSDIW 256

Query: 697 ALGVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNIC 876
           ALG+FLYKL +Y TPFE  G+ AIL+ K+ FP    YS  + N+I IML+++P  RPNI 
Sbjct: 257 ALGIFLYKLLFYITPFEMTGQFAILHSKYDFPQ-TNYSSRLINLIIIMLSENPNLRPNIY 315

Query: 877 QVLEQVSKLQG 909
           QVL ++  + G
Sbjct: 316 QVLHEICSISG 326

>Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {ON}
            YBR059C (REAL)
          Length = 1108

 Score =  288 bits (736), Expect = 2e-79
 Identities = 154/344 (44%), Positives = 216/344 (62%), Gaps = 7/344 (2%)
 Frame = +1

Query: 1    MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARN-------ELGT 159
            M  P + ++  G ++ +GTH+V +  YLA GGFAQ+Y V+ ++  N  +       ++G 
Sbjct: 14   MGHPAVERFTPGHIVCVGTHKVEVINYLAEGGFAQIYMVKFVEYLNEFDNAASVPLKIGD 73

Query: 160  MACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEY 339
            +ACLKRV+V D++GLN +R EV+ MK LKG   +V Y DS+A R       +EV LLME 
Sbjct: 74   VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 340  CSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENG 519
            C    ++D++N RL  +L E EI+KIM DV   ++ MHYL  PLIHRDIKIENVL+  N 
Sbjct: 134  CPNKSLLDYMNQRLSTKLTESEIVKIMYDVVLSISQMHYLPVPLIHRDIKIENVLVDANN 193

Query: 520  DYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWA 699
            ++K+ DFGS  +      T Q+ A +  +I ++TT QYRSPEMID Y   PI+EKSDIWA
Sbjct: 194  NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 700  LGVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQ 879
            LG+FLYKL ++TTPFE  G+ AIL+ K++FP   +YS  + N+I IML ++P  RPNI Q
Sbjct: 254  LGIFLYKLLFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 880  VLEQVSKLQGVPCPIENFMLTRIKLQNSRNNSNKSTSLNDTTNN 1011
            VL  + ++  +  PIE+      K      N +K T   +   N
Sbjct: 313  VLYHLCEILNIEVPIED------KYTEGAYNFSKYTQFQNKLQN 350

>Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {ON}
           YBR059C (REAL)
          Length = 1107

 Score =  287 bits (734), Expect = 3e-79
 Identities = 150/317 (47%), Positives = 208/317 (65%), Gaps = 7/317 (2%)
 Frame = +1

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARN-------ELGT 159
           M  P + +Y  G+++ +GTH+V I  YLA GGFAQ+Y+V+ ++  N  +       ++G 
Sbjct: 14  MGHPAVERYTPGKIVCVGTHKVEIVNYLAEGGFAQIYAVKFLEYLNEFDNTASLPLKIGD 73

Query: 160 MACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEY 339
           +ACLKRV+V D++GLN +R EV+ MK LKG   +V Y DS+A R       +EV LLME 
Sbjct: 74  VACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 340 CSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENG 519
           C    ++D++N RL  +L E EI+KIM DV   ++ MHYL  PLIHRDIKIENVL+    
Sbjct: 134 CPNKSLLDYMNQRLSTKLSESEIVKIMYDVALSISEMHYLPVPLIHRDIKIENVLVDAEN 193

Query: 520 DYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWA 699
           ++K+ DFGS  +      T Q+ A +  +I ++TT QYRSPEMID Y   PI+EKSDIWA
Sbjct: 194 NFKLADFGSTSTSFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 700 LGVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQ 879
           LG+FLYKL ++TTPFE  G+ AIL+ K++FP   +YS  + N+I IML ++P  RPNI Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 880 VLEQVSKLQGVPCPIEN 930
           VL  +  +     PIE+
Sbjct: 313 VLYHICDILNAEVPIED 329

>TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3.273
           YBR059C
          Length = 1049

 Score =  286 bits (731), Expect = 4e-79
 Identities = 151/317 (47%), Positives = 204/317 (64%), Gaps = 7/317 (2%)
 Frame = +1

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVID-------SSNARNELGT 159
           +  P + ++  G V+ +GTH+V +  YLA GGFAQ+Y V+ ++        S    ++G 
Sbjct: 14  VGNPTMERFLPGAVVAVGTHRVEVVNYLAEGGFAQIYVVKFLEYLNEFENKSKVPMKVGD 73

Query: 160 MACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEY 339
           +ACLKRV+V D++GL+ +R EV+ MK L G + IV Y DS+A R       +EV LLME 
Sbjct: 74  VACLKRVLVQDENGLSEMRNEVEVMKQLMGAQNIVQYYDSNACRRHNGNAGFEVLLLMEL 133

Query: 340 CSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENG 519
           C    ++D++N RL  +L E EILKIM DV   V+ MHYL+ PLIHRDIKIENVL+    
Sbjct: 134 CPNKSLLDYMNQRLATKLTEKEILKIMYDVSLAVSQMHYLKNPLIHRDIKIENVLVDAQN 193

Query: 520 DYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWA 699
            +K+CDFGS         T QE A +  +I ++TT QYR PEMID Y   PI+EKSDIWA
Sbjct: 194 SFKLCDFGSTSQCFPVVTTHQEIAILTQNIYVHTTPQYRCPEMIDLYRCLPINEKSDIWA 253

Query: 700 LGVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQ 879
           LG+FLYKL ++ TPFE  G+ AIL+ K++FP    YS  + N+I IML ++P  RPNI Q
Sbjct: 254 LGIFLYKLLFFITPFEMTGQFAILHSKYEFPP-NHYSSQLINLIIIMLAENPFVRPNIYQ 312

Query: 880 VLEQVSKLQGVPCPIEN 930
           VL  +  + GV  PIE+
Sbjct: 313 VLNHICTMIGVEVPIED 329

>Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {ON}
           similar to Ashbya gossypii AGR027C
          Length = 894

 Score =  283 bits (723), Expect = 5e-79
 Identities = 149/311 (47%), Positives = 204/311 (65%), Gaps = 6/311 (1%)
 Frame = +1

Query: 16  IPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARN------ELGTMACLKR 177
           + K   G +L +G H+V I +YLA GGFA +Y V  I+ +N  +      + G +ACLKR
Sbjct: 25  LEKLTAGSILLVGVHRVEIIEYLAEGGFAHIYKVSFIEYTNELDRHHSVLQRGDIACLKR 84

Query: 178 VIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGV 357
           V V D++GLN LR EV+ MK LKG   +V Y DS+A R       +EV LLME CS G +
Sbjct: 85  VQVNDENGLNELRNEVEVMKKLKGCGNVVQYYDSNASRHTDGTPGFEVLLLMELCSNGSL 144

Query: 358 IDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICD 537
           +D++N RL  +L E E+LKIM D+ +G++ MH+L+ PLIHRDIKIENVL+    ++K+CD
Sbjct: 145 LDYMNQRLATKLSEREVLKIMYDITKGISHMHFLRTPLIHRDIKIENVLVDSANNFKLCD 204

Query: 538 FGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLY 717
           FGS  + L    T QE A + ++I ++TT QYRSPEMID Y    I+EKSDIWALG+FLY
Sbjct: 205 FGSTSTCLPAVSTHQEIAMLTNNIYVHTTPQYRSPEMIDLYRCLAINEKSDIWALGIFLY 264

Query: 718 KLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVS 897
           KL +YTTPFE  G+ AIL+ K+  P    +S  + N+I +ML ++P  RPNI Q+L  + 
Sbjct: 265 KLLFYTTPFELTGQFAILHSKYDIPQ-NNFSSKLINLIIVMLAENPYIRPNIYQILYHIC 323

Query: 898 KLQGVPCPIEN 930
            +     PIE+
Sbjct: 324 SIMECDVPIED 334

>KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa]
           {ON} Anc_3.273 YBR059C
          Length = 1091

 Score =  286 bits (732), Expect = 5e-79
 Identities = 149/316 (47%), Positives = 206/316 (65%), Gaps = 13/316 (4%)
 Frame = +1

Query: 16  IPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRV---------IDSSNARNE----LG 156
           I K+  G  + +G+H V I KYL  GGFAQ+Y V++         ID  N R +    +G
Sbjct: 26  IEKFSAGESVAVGSHGVEIVKYLTEGGFAQIYLVKLTEYLNEFDAIDIQNQRQQQELKIG 85

Query: 157 TMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLME 336
            + CLKRV+V D++GL+ ++ EV+ MK L+G   +V Y DS+A R+    G +EVFLLME
Sbjct: 86  DLVCLKRVMVYDEAGLSEMKNEVNVMKQLRGKPNVVQYYDSNATRNRGANGGFEVFLLME 145

Query: 337 YCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISEN 516
           YC    ++D++N RL  +L E EIL IM D+  GV+ +H+L  PLIHRDIKIENVL+  N
Sbjct: 146 YCPNKSLLDYMNQRLTTKLTESEILNIMYDITLGVSQLHFLDNPLIHRDIKIENVLVDHN 205

Query: 517 GDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIW 696
             +K+CDFGS         T Q+ + + HDI ++TT QYRSPEMID +   P++EK+DIW
Sbjct: 206 NRFKLCDFGSTNICPPIATTNQDISVLTHDIYVHTTPQYRSPEMIDLFRCLPVNEKADIW 265

Query: 697 ALGVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNIC 876
           ALGVFLYKL +YTTPFE  G+ AIL+ K++ P    YS+ + N+I +ML ++P  RPNI 
Sbjct: 266 ALGVFLYKLLFYTTPFELTGQFAILHSKYEIPQ-SHYSERLLNLIVVMLAENPNLRPNIY 324

Query: 877 QVLEQVSKLQGVPCPI 924
           QVL ++  +  V  PI
Sbjct: 325 QVLSEICSILNVEVPI 340

>NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON}
           Anc_3.273
          Length = 1157

 Score =  286 bits (733), Expect = 7e-79
 Identities = 152/325 (46%), Positives = 207/325 (63%), Gaps = 22/325 (6%)
 Frame = +1

Query: 22  KYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNE----------------- 150
           K+  G  + +G+H+V I KY+A GGFAQ+Y+V+ ++S N   +                 
Sbjct: 23  KFPAGTQVAVGSHKVEIIKYIAEGGFAQIYAVKYVESLNEFEDSNTDENAHLSGDRQAPN 82

Query: 151 -----LGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEY 315
                LG +ACLKRV+V D++GLN +R EV+ MK LKG   +V Y DS+A R       +
Sbjct: 83  PMILKLGDIACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRHNGASGF 142

Query: 316 EVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIE 495
           EV LLME C    ++D++N RL  +L E EILKIM D+   V+ MHYL+ PL+HRDIKIE
Sbjct: 143 EVLLLMELCPNKSLLDYMNQRLTTKLTEHEILKIMYDITFAVSHMHYLKIPLLHRDIKIE 202

Query: 496 NVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPI 675
           NVL+    ++K+CDFGS  + L    T Q+ A +  +I ++TT QYRSPEMID Y   PI
Sbjct: 203 NVLVDAQNNFKLCDFGSTSTRLPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPI 262

Query: 676 DEKSDIWALGVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDP 855
           DEKSDIWALG+FLYKL ++ TPFE  G+ AIL+ K++FP    YS  + N+I IML ++P
Sbjct: 263 DEKSDIWALGIFLYKLLFFITPFEMTGQFAILHSKYEFPK-NNYSSKLINLIIIMLAENP 321

Query: 856 IKRPNICQVLEQVSKLQGVPCPIEN 930
             RPNI QVL+ +  +  V  PIE+
Sbjct: 322 NLRPNIYQVLDNICSMMNVEVPIED 346

>TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3.273
            YBR059C
          Length = 1054

 Score =  285 bits (729), Expect = 8e-79
 Identities = 164/361 (45%), Positives = 218/361 (60%), Gaps = 31/361 (8%)
 Frame = +1

Query: 4    NQP-EIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVID------------SSNAR 144
            N+P  I KY++G +L +G  ++ I KYL  GGFAQ+Y+VR I+             +N+R
Sbjct: 32   NRPGSIEKYKQGTILTVGIRRIEILKYLTEGGFAQIYTVRFIEYLNEFDNDDAENDNNSR 91

Query: 145  N-ELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGE--- 312
            N ++G +ACLKRV+VPD++GL+ +R EVD MK L     IV Y DS+A  S++K      
Sbjct: 92   NLKIGDVACLKRVLVPDENGLSEMRNEVDVMKKLVNCPNIVQYYDSNA--SKIKDNSNID 149

Query: 313  --------------YEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAM 450
                          +E+ LLMEYC    ++DF+N RL  +L E EILK M+D+   V  M
Sbjct: 150  TTNNNDNNKNTDLGFEILLLMEYCPNKSLLDFMNQRLTTKLTENEILKAMTDITTAVLQM 209

Query: 451  HYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQ 630
            HYL  PLIHRDIKIENVL+  N ++K+ DFGS   +  P  T Q+ A ++ DI +NTT Q
Sbjct: 210  HYLAQPLIHRDIKIENVLVDSNNNFKLADFGSTTKIQPPITTHQDIAILNKDIYMNTTPQ 269

Query: 631  YRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYS 810
            YRSPEMID Y   PIDEKSDIWALGV LYKL +YTTPFE  G+ AIL+ K++FP+   YS
Sbjct: 270  YRSPEMIDLYKCLPIDEKSDIWALGVLLYKLLFYTTPFELTGQFAILHSKYEFPA-NNYS 328

Query: 811  DHIRNIITIMLNKDPIKRPNICQVLEQVSKLQGVPCPIENFMLTRIKLQNSRNNSNKSTS 990
                N+I IML ++P  RPNI QVL  +  +                  NS NN  ++T 
Sbjct: 329  SKFINLIIIMLAENPNLRPNIFQVLYYLKSISNT--------------MNSNNNEVQNTQ 374

Query: 991  L 993
            +
Sbjct: 375  V 375

>YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON}
            AKL1Ser-Thr protein kinase, member (with Ark1p and Prk1p)
            of the Ark kinase family; involved in endocytosis and
            actin cytoskeleton organization
          Length = 1108

 Score =  285 bits (729), Expect = 1e-78
 Identities = 156/344 (45%), Positives = 214/344 (62%), Gaps = 7/344 (2%)
 Frame = +1

Query: 1    MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARN-------ELGT 159
            M  P + +Y  G ++ +GTH+V +  YLA GGFAQ+Y V+ ++  N  +       ++G 
Sbjct: 14   MGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGD 73

Query: 160  MACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEY 339
            +ACLKRV+V D++GLN +R EV+ MK LKG   IV Y DS+A R       +EV LLME 
Sbjct: 74   VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 340  CSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENG 519
            C    ++D++N RL  +L E EI+KIM DV   ++ MHYL   LIHRDIKIENVL+    
Sbjct: 134  CPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN 193

Query: 520  DYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWA 699
            ++K+ DFGS  +      T Q+ A +  +I ++TT QYRSPEMID Y   PI+EKSDIWA
Sbjct: 194  NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 700  LGVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQ 879
            LGVFLYKL ++TTPFE  G+ AIL+ K++FP   +YS  + N+I IML ++P  RPNI Q
Sbjct: 254  LGVFLYKLLFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 880  VLEQVSKLQGVPCPIENFMLTRIKLQNSRNNSNKSTSLNDTTNN 1011
            VL  + ++  V  PIE+      K      N +K T   +   N
Sbjct: 313  VLYHLCEILNVEVPIED------KYAEGAYNFSKYTQFQNKLQN 350

>Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {ON}
           YBR059C (REAL)
          Length = 1090

 Score =  284 bits (726), Expect = 3e-78
 Identities = 151/317 (47%), Positives = 206/317 (64%), Gaps = 7/317 (2%)
 Frame = +1

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARN-------ELGT 159
           M  P + +Y  G ++ +GTH+V I  YLA GGFAQ+Y V+ ++  N  +       ++G 
Sbjct: 14  MGHPAVERYTPGDIVCVGTHKVEIVNYLAEGGFAQIYVVKFLEYLNEFDNAASVPLKIGD 73

Query: 160 MACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEY 339
           +ACLKRV+V D++GLN +R EV+ MK LKG   +V Y DS+A R       +EV LLME 
Sbjct: 74  LACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 340 CSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENG 519
           C    ++D++N RL  +L E EI+KIM DV   ++ MHYL  PLIHRDIKIENVL+    
Sbjct: 134 CPNKSLLDYMNQRLSTKLTETEIVKIMYDVALSISQMHYLPVPLIHRDIKIENVLVDAKD 193

Query: 520 DYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWA 699
            +K+ DFGS  +      T Q+ A +  +I ++TT QYRSPEMID Y   PI+EKSDIWA
Sbjct: 194 SFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 700 LGVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQ 879
           LG+FLYKL ++TTPFE  G+ AIL+ K++FP   +YS  + N+I IML ++P  RPNI Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 880 VLEQVSKLQGVPCPIEN 930
           VL  +  +  V  PIE+
Sbjct: 313 VLCHLCDILNVEVPIED 329

>TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {ON}
            Anc_3.273 YBR059C
          Length = 1061

 Score =  283 bits (724), Expect = 4e-78
 Identities = 148/314 (47%), Positives = 201/314 (64%), Gaps = 12/314 (3%)
 Frame = +1

Query: 25   YEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNEL------------GTMAC 168
            Y  G  + +G+H+V + KY+A GGFAQ+Y+V+ I+  N    L            G +AC
Sbjct: 99   YPAGTPVAVGSHKVEVIKYIAEGGFAQIYTVKFIERLNEFASLPGGNQNQKPLQPGDIAC 158

Query: 169  LKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSR 348
            LKRV+V D +GLN +R EV+ M+ L+G   +V Y DS+A         YEV LLME+C  
Sbjct: 159  LKRVLVNDDNGLNEMRNEVNVMQKLQGAPCVVQYYDSNASHRSDSAPGYEVLLLMEFCPN 218

Query: 349  GGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYK 528
              ++D++N RL  RL E EI+KIM D   G+A +HYL+ PLIHRDIKIENVL+ +  ++K
Sbjct: 219  NSLLDYMNDRLATRLSEKEIMKIMYDTTLGIAQLHYLKTPLIHRDIKIENVLVDQENNFK 278

Query: 529  ICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGV 708
            +CDFGS           ++ A    +I +NTT QYRSPEMID Y   PIDEKSDIWALGV
Sbjct: 279  LCDFGSTSICFPIVTNHRDIAIFTQNIYVNTTPQYRSPEMIDLYRYQPIDEKSDIWALGV 338

Query: 709  FLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLE 888
            FLYKL ++TTPFE+ G+ AIL+ K++FP    YS  + N+I IML ++P  RPNI QVL+
Sbjct: 339  FLYKLLFFTTPFERTGQFAILHSKYEFPK-NNYSSKLINLIIIMLAENPSVRPNIYQVLQ 397

Query: 889  QVSKLQGVPCPIEN 930
             +  + G   P+ +
Sbjct: 398  YLCSINGWKVPLND 411

>KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 814

 Score =  276 bits (707), Expect = 2e-77
 Identities = 144/293 (49%), Positives = 197/293 (67%), Gaps = 8/293 (2%)
 Frame = +1

Query: 49  IGTHQVIIEKYLACGGFAQVYSVRVIDSSNARN--------ELGTMACLKRVIVPDKSGL 204
           +GTH+  I ++LA GGFA +Y V+ ++ +N  +        + G +ACLKRVIVPD++GL
Sbjct: 37  VGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGL 96

Query: 205 NTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLY 384
           N LR EV+ MK L+G+  IV Y DS+A R       +E+ LLME C +  ++D++N +L 
Sbjct: 97  NELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLA 156

Query: 385 HRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLR 564
            +L E EILKIM DV   +A MHYL  PLIHRDIKIENVL+ ++ ++K+CDFGS      
Sbjct: 157 TKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFP 216

Query: 565 PPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPF 744
              T Q+ A + ++I ++TT QYRSPEMID Y   PI+EKSDIWALG+FLYKL +YTTPF
Sbjct: 217 IVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 276

Query: 745 EKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSKL 903
           E  G+ AIL+ K++ P    YS  + N+I IML ++P  RPNI QV+  V  +
Sbjct: 277 ELTGQFAILHSKYEIPQ-NGYSSKLINLIIIMLAENPSLRPNIYQVMHHVCSI 328

>CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa]
            {ON} some similarities with uniprot|P38080 Saccharomyces
            cerevisiae YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 991

 Score =  279 bits (713), Expect = 4e-77
 Identities = 153/322 (47%), Positives = 210/322 (65%), Gaps = 17/322 (5%)
 Frame = +1

Query: 7    QPEIP-KYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVID-----------SSNARNE 150
            QP+I  K+  G+V+ +G+H+V +  YLA GGFAQ+Y V+ ++           S N   +
Sbjct: 89   QPQIEEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLK 148

Query: 151  LGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQR-----SELKQGEY 315
             G+ ACLKRV+V D+ GLN +R+EV+ MK L+G   IV Y DS+A R       + QG +
Sbjct: 149  PGSPACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQG-F 207

Query: 316  EVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIE 495
            EV LLME C    ++D++N RL  +L E EI KIM D+   VA MHYL  PLIHRDIKIE
Sbjct: 208  EVLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIE 267

Query: 496  NVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPI 675
            NVL+  N ++K+CDFGS  +      + Q+ A +  D+ ++TT QYRSPEMID +   PI
Sbjct: 268  NVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPI 327

Query: 676  DEKSDIWALGVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDP 855
            +EKSDIWALGVFLYKL ++TTPFE+ G+ A+L+ KF+FP    YS  + N+I +ML ++P
Sbjct: 328  NEKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPP-NSYSSKLINLIIVMLAENP 386

Query: 856  IKRPNICQVLEQVSKLQGVPCP 921
              RPNI QVL  +S++     P
Sbjct: 387  SLRPNIYQVLYYLSEVTNREVP 408

>TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1361

 Score =  283 bits (723), Expect = 6e-77
 Identities = 148/314 (47%), Positives = 204/314 (64%), Gaps = 9/314 (2%)
 Frame = +1

Query: 16  IPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDS----SNARNEL-----GTMAC 168
           I KY+ G+++ +G HQV IE YLA GGFAQ+Y V+ ID      N +++L     G +AC
Sbjct: 32  IEKYKPGKLISVGAHQVKIEDYLAEGGFAQIYKVKFIDYLNEFENKKDQLNSLKSGDIAC 91

Query: 169 LKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSR 348
           LKRV+V D++GLN +R EV+ MKLL+G   IV Y DS+A R       YE+ LLME C  
Sbjct: 92  LKRVLVNDENGLNEMRNEVEVMKLLQGCPNIVQYYDSNALRRNDGLNGYEILLLMELCPN 151

Query: 349 GGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYK 528
             ++D++N RL  +L E EI+KIM D    V+ MHYL  PLIH+DIK+EN+L+  N ++K
Sbjct: 152 NSLLDYMNQRLKTKLNETEIVKIMYDTTLAVSQMHYLDKPLIHKDIKVENILVDSNNNFK 211

Query: 529 ICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGV 708
           +CDFGS         +  + A +  +I ++TT QYRSPEMID Y   PI+E SDIWALGV
Sbjct: 212 LCDFGSTSPCYEIVTSHHDIAVLTQNIYMHTTPQYRSPEMIDLYRCLPINETSDIWALGV 271

Query: 709 FLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLE 888
           FLYKL ++ TPFE+ G+ +IL+ KF  P    Y   + N+I IML+++   RPNI QV+ 
Sbjct: 272 FLYKLLFFITPFERTGQFSILHAKFDIP-VNNYHPKLINLIIIMLSENLNLRPNIYQVMY 330

Query: 889 QVSKLQGVPCPIEN 930
           ++  +   P PIE+
Sbjct: 331 EICSITNTPLPIED 344

>TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {ON}
            Anc_3.273 YBR059C
          Length = 788

 Score =  271 bits (693), Expect = 7e-76
 Identities = 153/345 (44%), Positives = 216/345 (62%), Gaps = 7/345 (2%)
 Frame = +1

Query: 16   IPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYS------VRVIDSSNARN-ELGTMACLK 174
            I  Y  G ++ +G H+V I KYLA GGFA++Y       ++ ID +  +  + G + CLK
Sbjct: 96   IDTYVPGHIVEVGIHKVEIIKYLAEGGFAKIYVAKFLQYIKQIDINKIQVLQPGDLICLK 155

Query: 175  RVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGG 354
            RV+V D +GLN +R EV  MK L G   IV   DS+A R       YEV LLME CS   
Sbjct: 156  RVLVTDDNGLNEMRNEVSVMKKLIGAPNIVQLYDSNASRRTDGIAGYEVLLLMELCSNKS 215

Query: 355  VIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKIC 534
            ++D++N RL  +L E EILKIM DV   VA MHYL  PLIHRDIKIENVL+    ++K+C
Sbjct: 216  LLDYMNQRLAVKLTEPEILKIMFDVTLAVAQMHYLPIPLIHRDIKIENVLVDSQNNFKLC 275

Query: 535  DFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFL 714
            DFGS  + +    T ++ A +  ++ ++TT QYRSPEMID Y    I+EKSDIWALG+FL
Sbjct: 276  DFGSTSTCMPIATTHRDMAALTQNLYVHTTPQYRSPEMIDVYRCIHINEKSDIWALGIFL 335

Query: 715  YKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 894
            YKL +Y TPFE+ G+ AIL+ K++FP +  YS  + N+I IML ++P  RPNI QVL  +
Sbjct: 336  YKLLFYITPFERTGQFAILHSKYEFPQH-SYSMKLINLIIIMLAENPNLRPNIYQVLAYI 394

Query: 895  SKLQGVPCPIENFMLTRIKLQNSRNNSNKSTSLNDTTNNSFNNEL 1029
             K+  +  PI++  +  +   + +  +N  T+L ++ N  +  ++
Sbjct: 395  CKIINIKTPIDD--IYGLGPYDFQKYTNYQTALQNSQNQMYQVQI 437

>AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR059C
           (AKL1)
          Length = 961

 Score =  269 bits (687), Expect = 6e-74
 Identities = 141/307 (45%), Positives = 197/307 (64%), Gaps = 6/307 (1%)
 Frame = +1

Query: 28  EKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARN------ELGTMACLKRVIVP 189
           + G  + +G HQV + +YLA GGFA +Y V  +  +N  +      + G   CLKRV V 
Sbjct: 30  QAGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVS 89

Query: 190 DKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFL 369
           D++GLN LR EV+ MK L+    IV Y DS+A R    +  YEV LLME C  G ++D++
Sbjct: 90  DENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYM 149

Query: 370 NTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSA 549
           N RL  +L E E+LKIM D+  G++ MHY + PLIHRDIKIENVL+  + ++K+CDFGS 
Sbjct: 150 NQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGST 209

Query: 550 CSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCY 729
              L    + QE A + ++I ++TT QYRSPEMID Y   PI+EKSDIWALG+FLYKL +
Sbjct: 210 SPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLF 269

Query: 730 YTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSKLQG 909
           YTTPFE  G+ AIL+ K++ P    +S  + N++ IML ++P  RPN+ QV+  +  +  
Sbjct: 270 YTTPFELTGQFAILHSKYEIPR-NSFSSKLINLVIIMLAENPYLRPNVYQVMYHICSMME 328

Query: 910 VPCPIEN 930
               I++
Sbjct: 329 CEVKIDD 335

>KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 346

 Score = 96.3 bits (238), Expect = 2e-20
 Identities = 85/332 (25%), Positives = 140/332 (42%), Gaps = 46/332 (13%)
 Frame = +1

Query: 49  IGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKS--GLNTLRAE 222
           +  H+  I++ L  GGF+ VY V          E G MA LK++  P  S   ++    E
Sbjct: 21  VNGHRYHIKRLLGEGGFSFVYLVE-------SRENGLMA-LKKIRCPFGSIGSISPAMKE 72

Query: 223 VDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQ-- 396
           VD  +  K + YI   IDS   +   + G   V++L+ Y S+G + D +N  L    Q  
Sbjct: 73  VDNYQKFK-SPYIAQIIDSQVVQE--RDGSKTVYILLPYFSKGSLQDEINRHLLDCTQVP 129

Query: 397 EFEILKIMSDVCQGVAAMHYLQPP-----------------------------------L 471
           E E++++   V +G+  +H   P                                     
Sbjct: 130 ELEVVRLALGVARGLLCIHDAAPADESDVTYSIVSAPYAEDSSLLNDLELDTFGESHQAY 189

Query: 472 IHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI 651
            H DIK  N++IS  G   I D GS         + Q           + T  + +PE++
Sbjct: 190 AHHDIKPSNIMISSEGMPVISDLGSCSRACVEINSRQALLQFQEWRSEHCTLTFMAPEIL 249

Query: 652 DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILNV-------KFQFPSYPQYS 810
           D      I EK D+W+ G  +Y +C+  +PFE+E + +  +V       K+  PS   YS
Sbjct: 250 DVKLNSVITEKCDVWSFGCTIYTMCFGISPFEREEQISGASVTYSLTTGKYSIPSGTNYS 309

Query: 811 DHIRNIITIMLNKDPIKRPNICQVLEQVSKLQ 906
             + +++   LN DP  RP++ +++  +  LQ
Sbjct: 310 SGLIDVVKKCLNVDPDGRPSVDELISLLMDLQ 341

>SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {ON}
            similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
            YPL236C Hypothetical ORF
          Length = 364

 Score = 95.9 bits (237), Expect = 4e-20
 Identities = 95/355 (26%), Positives = 146/355 (41%), Gaps = 65/355 (18%)
 Frame = +1

Query: 40   VLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRA 219
            VL  G H  I ++ L  GGF+ VY V+    S   N+L     LK++  P       + +
Sbjct: 21   VLINGQHYAI-QRLLGEGGFSFVYLVQ----SRENNDL---FALKKIHCP----FGNIES 68

Query: 220  EVDAMKLLKGNKYIVSYIDSHAQRSELKQ---GEYEVFLLMEYCSRGGVIDFLNTRLYH- 387
              +AM+ +   K   S   +H   S++ Q   G   VF+L+ Y   G ++D +NT L   
Sbjct: 69   VSEAMREVNSYKKFRSPYITHCVSSQVLQEQDGSKTVFILLPYFPTGSLLDKINTHLLDG 128

Query: 388  -RLQEFEILKIMSDVCQGVAAMH-------------YLQPPLIHRD-------------- 483
              + E EI++I+  V +G+  MH              +   L +RD              
Sbjct: 129  TTISEEEIVRILVSVARGLRTMHNPAGQEDSIEDQTSVNTDLQYRDTVSMTYNEDLRLLN 188

Query: 484  --------------------------IKIENVLISENGDYKICDFGSACSVLRPPKTPQE 585
                                      IK  N++ S +G   ICD GS         +  +
Sbjct: 189  DSLELDVLSGNTSSFMASTTAYSHKDIKPANIMFSSDGLPVICDLGSCSRAHVDISSRSQ 248

Query: 586  AAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE-- 759
                      + T  +RSPE+++      IDEK DIW+LG  LY +C+  +PFE+E +  
Sbjct: 249  LVEFQEWCNEHCTLPFRSPELLNVTLNSKIDEKVDIWSLGCTLYCMCFGISPFEREEQLS 308

Query: 760  -----NAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSKLQG 909
                  AI   KF  P    YS  +  II   +  D  KRP+I ++L ++  LQG
Sbjct: 309  GASMTYAIATGKFSIPPNTNYSPELIKIIKDCIEVDSKKRPSIDELLARLQDLQG 363

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score = 98.2 bits (243), Expect = 6e-20
 Identities = 79/295 (26%), Positives = 140/295 (47%), Gaps = 5/295 (1%)
 Frame = +1

Query: 79  YLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKY 258
           +L  GGFA+ + ++  D S       T+A L    +  +     L +E+   K +K ++ 
Sbjct: 87  FLGEGGFARCFQIK--DDSGKIFAAKTVAKLS---IKSEKTRKKLLSEIQIHKSMK-HQN 140

Query: 259 IVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQG 438
           +V +ID         + +  V++L+E C  G ++D L  R    L E E+    + +C  
Sbjct: 141 VVQFIDCF-------EDDTNVYILLEICPNGSLMDLLKKRKL--LTEPEVRFFTTQICGA 191

Query: 439 VAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMIN 618
           +  MH  +  +IHRD+K+ N+    N + KI DFG A  +    +             + 
Sbjct: 192 IKYMHSRR--VIHRDLKLGNIFFDRNYNLKIGDFGLAAVLANDRE---------RKYTVC 240

Query: 619 TTAQYRSPEMI-DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILN----VKF 783
            T  Y +PE++  K+SG+  +   DIW++GV LY L     PF+ +  N I        F
Sbjct: 241 GTPNYIAPEVLMGKHSGHSYEV--DIWSIGVMLYALLIGKPPFQSKDVNTIYERIKCCDF 298

Query: 784 QFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSKLQGVPCPIENFMLTRI 948
            FP     S+  + +I  +L+ DP++RP+I ++++ V      P  IE+ ++T +
Sbjct: 299 SFPKEKHISNEAKVLIQDLLSLDPLERPSISEIMDYVWFRGIFPPYIESTVMTEV 353

>Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C
           (SPS1) - serine/threonine kinase homologous to Ste20p;
           expressed in middle/late meiosis [contig 123] FULL
          Length = 505

 Score = 96.7 bits (239), Expect = 9e-20
 Identities = 73/276 (26%), Positives = 137/276 (49%), Gaps = 4/276 (1%)
 Frame = +1

Query: 70  IEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPD-KSGLNTLRAEVDAMKLLK 246
           I++ +  G F  VY  R ID      E G M  +K + + + +  ++ L  E+  +  L+
Sbjct: 38  IKECVGKGSFGDVY--RAIDK-----ETGEMVAVKIINLEETQDDIDVLAQEIYFLSELR 90

Query: 247 GNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSD 426
              ++ +Y  ++ +       +  ++++ME+C  G   D L     HRL E ++  I+ +
Sbjct: 91  A-PFVTTYYKTYVE-------DVSMWIVMEFCGGGSCADLLKHLPEHRLPENKVAYIIRE 142

Query: 427 VCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHD 606
           V  G+  +H  +   IHRD+K  N+L+++ G+ K+ DFG +  ++    T +   F+   
Sbjct: 143 VLYGLEYLHSQRK--IHRDVKAANILLTDEGEVKLGDFGVSGQIM---ATLKRNTFV--- 194

Query: 607 IMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEK-EGENAILNVKF 783
                T  + +PE+I + +GY  DEK+DIW+LG+   +L     P+ K +    ++N+  
Sbjct: 195 ----GTPYWMAPEIIARDNGY--DEKADIWSLGITAMELLTGQPPYAKYDPMKVLMNIPL 248

Query: 784 QFPSYPQ--YSDHIRNIITIMLNKDPIKRPNICQVL 885
           + P   Q  ++   R+ I + L KDP  RP    +L
Sbjct: 249 RKPPRLQGRFTSSARDFIALCLTKDPALRPTASDLL 284

>Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}
            YPL236C (REAL)
          Length = 364

 Score = 94.0 bits (232), Expect = 2e-19
 Identities = 81/334 (24%), Positives = 141/334 (42%), Gaps = 56/334 (16%)
 Frame = +1

Query: 70   IEKYLACGGFAQVYSVRVIDSS-NARNELGT--MACLKRVIVPDKSGLNTLRAEVDAMKL 240
            I++ L  GG + VY V+++  S +  N   T  +  LK++I P    ++    E++  K 
Sbjct: 32   IQRLLGEGGMSFVYLVQLLKGSLSMENSAATAELYALKKIICPSVENISNGMREIENYKR 91

Query: 241  LKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHR--LQEFEILK 414
             + + Y++  IDS   +   K G   +++++ Y S G + D +N RL     + E E ++
Sbjct: 92   FQ-SPYVIQSIDSQVMQE--KDGSKTIYIILPYYSLGSLQDSINRRLLEGTFISEAECVR 148

Query: 415  IMSDVCQGVAAMH-----------------------------YLQPPL------------ 471
            IM  V +G+  +H                                 PL            
Sbjct: 149  IMLGVTRGLLCLHDPASRQDNVTTRTTVDTISMTYSDETAMLLEDTPLEMDMLSSSSAGL 208

Query: 472  ---IHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSP 642
                HRDI   N+L S +G   I D GS            + + +   +  N T  Y +P
Sbjct: 209  IAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLSELQEWVNDNCTLPYTAP 268

Query: 643  EMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE-------NAILNVKFQFPSYP 801
            E+++      +  K DIW++G   Y L +  +PFE+E +        AI   K+ FP   
Sbjct: 269  ELLNLKLNQALSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASLTYAINTGKYSFPRNS 328

Query: 802  QYSDHIRNIITIMLNKDPIKRPNICQVLEQVSKL 903
            ++S+ + ++I   +  DPI+RP   Q+L  +  L
Sbjct: 329  RFSERLLDVIKRCIQVDPIQRPTTSQLLNLLQDL 362

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score = 96.7 bits (239), Expect = 2e-19
 Identities = 80/295 (27%), Positives = 140/295 (47%), Gaps = 5/295 (1%)
 Frame = +1

Query: 79  YLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKY 258
           +L  GGFA+ + ++  D S       T+A L    +  +     L +E+   K ++ +  
Sbjct: 106 FLGEGGFARCFQIK--DDSGKIFAAKTVAKLS---IKTEKTRKKLLSEIQIHKSMR-HAN 159

Query: 259 IVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQG 438
           IV +ID         + E  V++L+E C  G +++ L  R    L E E+    + +C G
Sbjct: 160 IVQFIDCF-------EDETNVYILLEICPNGSLMELLKKR--KTLTEPEVRFFTTQICGG 210

Query: 439 VAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMIN 618
           +  MH  +  +IHRD+K+ N+   +N + KI DFG A  +    +             + 
Sbjct: 211 IKYMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFGLAAVLANDRE---------RKYTVC 259

Query: 619 TTAQYRSPEMI-DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILN----VKF 783
            T  Y +PE++  K+SG+  +   DIW++GV +Y L     PF+ +  N I        F
Sbjct: 260 GTPNYIAPEVLMGKHSGHSYEV--DIWSIGVMIYALLIGKPPFQAKDVNTIYERIKCCDF 317

Query: 784 QFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSKLQGVPCPIENFMLTRI 948
            FP     S   R ++  +L+ DP++RP+I +VL+ V      P  I++ ++T +
Sbjct: 318 VFPKEKYISSEARILVQDLLSLDPLERPSIMEVLDYVWFRGIFPPYIQSDVMTEV 372

>YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON}
            ENV7Protein proposed to be involved in vacuolar
            functions; mutant shows defect in CPY processing; has
            sequence similarity with the human serine/threonine
            protein kinase STK16
          Length = 364

 Score = 93.6 bits (231), Expect = 2e-19
 Identities = 84/337 (24%), Positives = 141/337 (41%), Gaps = 59/337 (17%)
 Frame = +1

Query: 70   IEKYLACGGFAQVYSVR------VIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDA 231
            I++ L  GG + VY V+      +ID+  A  EL     LK++I P    ++    E++ 
Sbjct: 32   IQRLLGEGGMSFVYLVQLSKNSLIIDNGIATPEL---YALKKIICPSVESISNGMREIEN 88

Query: 232  MKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHR--LQEFE 405
             K  + + Y++  IDS   +   K G   +++++ Y S G + D +N RL     + E E
Sbjct: 89   YKRFQ-SPYVIKSIDSQVMQE--KDGSKTIYIVLPYYSLGSLQDSINRRLLEGTFVSEAE 145

Query: 406  ILKIMSDVCQGVAAMH-----------------------------YLQPPL--------- 471
             ++IM  V +G+  +H                                 PL         
Sbjct: 146  CVRIMLGVTRGLLCLHDPASRQDNATSRVNVDAVSMTYSDETAMLLEDTPLEMDMLSSNS 205

Query: 472  ------IHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQY 633
                   HRDI   N+L S +G   I D GS        +   + + +   +  N T  Y
Sbjct: 206  AGSIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIENRHQLSELQEWVNDNCTLPY 265

Query: 634  RSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE-------NAILNVKFQFP 792
              PE+++      +  K DIW+LG   Y L +  +PFE+E +        AI   K+ FP
Sbjct: 266  TPPELLNLKLNQVLSSKVDIWSLGCTFYTLMFGISPFEREEQIHGASLTYAINTGKYSFP 325

Query: 793  SYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSKL 903
               ++S+ + ++I   +  DPI+RP   Q+L  +  L
Sbjct: 326  RNSRFSEGLLSVIKKCIQVDPIQRPTTSQLLNLLQDL 362

>Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C
            (REAL)
          Length = 364

 Score = 93.2 bits (230), Expect = 3e-19
 Identities = 84/334 (25%), Positives = 144/334 (43%), Gaps = 56/334 (16%)
 Frame = +1

Query: 70   IEKYLACGGFAQVYSVRVIDSSNA-RNELGT--MACLKRVIVPDKSGLNTLRAEVDAMKL 240
            I++ L  GG + VY V+++ +S    N + T  M  LK++I P    ++    E++  K 
Sbjct: 32   IQRLLGEGGMSFVYLVQLLKNSLIMENGIITPEMYALKKIICPSVESISNGMREIENYKR 91

Query: 241  LKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHR--LQEFEILK 414
             + + Y++  IDS  Q ++ K G   +++++ Y S G + D +N RL     + E E ++
Sbjct: 92   FQ-SPYVIQSIDS--QVTQEKNGSKIIYIILPYYSLGSLQDSINRRLLEGTFISEAECVR 148

Query: 415  IMSDVCQGVAAMH-----------------------------YLQPPL------------ 471
            IM  V +G+  +H                                 PL            
Sbjct: 149  IMLGVTRGLLCLHDPASRQDNITPRVNVDAVSMTYSDETAMLLEDTPLEMDVLSSGSAGS 208

Query: 472  ---IHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSP 642
                HRDI   N+L S  G   I D GS         +  + + +   +  N T  Y +P
Sbjct: 209  IAYAHRDITPSNILYSSEGLPVIADLGSCSQADIRIGSRNQLSELQEWVNDNCTLPYTAP 268

Query: 643  EMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE-------NAILNVKFQFPSYP 801
            E+++      +  K DIW++G   Y L +  +PFE+E +        AI   K+ FP   
Sbjct: 269  ELLNLKLNQILSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASITYAINTGKYSFPRNS 328

Query: 802  QYSDHIRNIITIMLNKDPIKRPNICQVLEQVSKL 903
            ++S+ + N+I   +  DPI+RP   Q+L  +  L
Sbjct: 329  RFSEALLNVIKKCIQVDPIQRPTTSQLLNLLQDL 362

>KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON} 
          Length = 668

 Score = 95.1 bits (235), Expect = 5e-19
 Identities = 65/242 (26%), Positives = 122/242 (50%), Gaps = 15/242 (6%)
 Frame = +1

Query: 205 NTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLY 384
           +T+  E++  KL+ G+K I+S ID         + +  +++++E C  G + D +  R  
Sbjct: 94  STILKEIEIHKLVNGHKNIISMIDHF-------EIDATMYMVLELCGAGSLYDII-CRSK 145

Query: 385 HRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLR 564
             L+E+E  ++M  +C  V  +H  +  ++H D+K+ N+LI  + + ++CDFG       
Sbjct: 146 RSLREWEAKRLMIQLCGAVDWIH--EKNIVHADLKLSNILIDSSNNLQLCDFGH------ 197

Query: 565 PPKTPQEAAFIHHDIMINT-----TAQYRSPEMI------DKYSGYPIDEKSDIWALGVF 711
                   +F+  DI  N+     T  Y SPE+I      DK   Y   ++SDIW++G+ 
Sbjct: 198 --------SFVSTDIDNNSINKFGTPNYLSPEIISNFILSDKKDLY-FPKESDIWSIGIV 248

Query: 712 LYKLCYYTTPFE----KEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQ 879
           LY + +  TPFE    +     I+  K+ F    + S+ ++ +I  +L   P++R  I +
Sbjct: 249 LYAMIFDKTPFEATTLRSTYENIVECKYGFVENKRVSNKVKKLIQNILKIQPLERKTIVE 308

Query: 880 VL 885
           ++
Sbjct: 309 IV 310

>TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6.262
            YPL236C
          Length = 372

 Score = 92.4 bits (228), Expect = 6e-19
 Identities = 84/346 (24%), Positives = 145/346 (41%), Gaps = 60/346 (17%)
 Frame = +1

Query: 49   IGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGT-----MACLKRVIVP--DKSGLN 207
            I   +  I + L  G  + VY V+ + S  A   +       +  LKR+  P  +   ++
Sbjct: 28   INGRRYTIRRLLGEGTLSFVYLVQRLGSKTATGSISLGNAPELYALKRIRCPFGNIESIS 87

Query: 208  TLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYH 387
                EVD  K  + + YI++ +DS   +   K G   + +L+ Y   G + D +N  L  
Sbjct: 88   AAMKEVDNYKRFQ-SPYIITLVDSQVVQE--KDGSKTLCILLPYFPLGSLQDMVNRNLLK 144

Query: 388  R--LQEFEILKIMSDVCQGVAAMH--------------------------YL--QPPL-- 471
               + E E ++IM  + +G+  +H                          +L    PL  
Sbjct: 145  GTFVSEAECIRIMIGIARGLRCLHDPSARETSDAETMRDTVSLSYSDEAAFLLDDTPLEL 204

Query: 472  --------------IHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDI 609
                          +HRDI++ N+L S  G   + D GS C       T  +   +   +
Sbjct: 205  DVLSSHNTVNTRSYVHRDIRLANILFSSEGLPVVSDLGSCCKADITVSTKHQLNELQDWV 264

Query: 610  MINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE-------NAI 768
              N +  Y +PE+++      ID K+DIW++G   Y + +  +PFE+E +        AI
Sbjct: 265  TANCSFPYTAPELLNVKLNSTIDCKADIWSVGCTCYAMLFGMSPFERELQVSGASLTYAI 324

Query: 769  LNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSKLQ 906
               K+ FP   +YS+ +  +I   L  DP  RP+I ++L+ +  LQ
Sbjct: 325  GCGKYTFPKQTRYSESLLAVIKSCLQVDPTARPDINELLDTLQDLQ 370

>ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 774

 Score = 95.1 bits (235), Expect = 7e-19
 Identities = 79/301 (26%), Positives = 144/301 (47%), Gaps = 5/301 (1%)
 Frame = +1

Query: 79  YLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKY 258
           +L  GGFA+ + +R  D S       T+A L    +  +     L +E+   K +K ++ 
Sbjct: 150 FLGEGGFARCFQIR--DDSGKLFAAKTVAKLS---IKTEKTRKKLLSEIQIHKSMK-HQN 203

Query: 259 IVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQG 438
           IV +ID         + +  V++L+E C  G +++ L  R   +L E E+    + +C  
Sbjct: 204 IVQFIDCF-------EDDTNVYILLEICPNGSLMELLKKR--KQLTEPEVRFFTTQICGA 254

Query: 439 VAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMIN 618
           +  MH  +  +IHRD+K+ N+    N + KI DFG A  +       +E  F      + 
Sbjct: 255 IKYMHSRR--VIHRDLKLGNIFFDRNYNLKIGDFGLAAVL----ANDRERKF-----TVC 303

Query: 619 TTAQYRSPE-MIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILN----VKF 783
            T  Y +PE ++ K+SG+  +   D+W++GV +Y L     PF+ +  N I        F
Sbjct: 304 GTPNYIAPEVLMGKHSGHSYE--VDVWSIGVMVYALLVGKPPFQAKDVNTIYERIKCCDF 361

Query: 784 QFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSKLQGVPCPIENFMLTRIKLQNS 963
            FP     S   + ++  +L+ DP++RP+I ++++ V      P  I++ ++T +    +
Sbjct: 362 IFPKEKPISHEAKVLVQDLLSLDPLERPSISEIMDYVWFRGIFPPYIQSNVMTEVPYYEN 421

Query: 964 R 966
           R
Sbjct: 422 R 422

>TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8.141
            YGL180W
          Length = 1154

 Score = 95.5 bits (236), Expect = 7e-19
 Identities = 96/358 (26%), Positives = 164/358 (45%), Gaps = 37/358 (10%)
 Frame = +1

Query: 61   QVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKL 240
            + I+EK +  G FA VY     +  N +  + ++   K   + +K  L  L  E+  +K 
Sbjct: 131  EYILEKEIGKGSFAVVYRGYSNEDPNFKLAVKSVPKSK---LKNKKILENLEIEISILKK 187

Query: 241  LKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTR----LYHRL--QEF 402
            L  +K+IV+ ID    +++         L+MEYCS G +   +  R    + H L  Q F
Sbjct: 188  LN-HKHIVNLIDCQRNKNDF-------LLIMEYCSLGDLTFLIKKRNELIINHPLLNQIF 239

Query: 403  EILKIMSDVCQGVA---AMHYLQP-----------PLIHRDIKIENVLISEN-GDY---- 525
            +     +  C G+     ++YLQ             LIHRDIK +N+L+S    DY    
Sbjct: 240  QKFPSPNPDCNGLNIAFVLNYLQQLASALKFLRSRNLIHRDIKPQNLLLSTPYTDYHDQQ 299

Query: 526  ---KICDFGSACSVLRPPKTPQEAAFIHHDIMINT---TAQYRSPEMIDKYSGYPIDEKS 687
               K+   G +C  +        A F+ +  +  T   +  Y +PE+++ Y  Y  + K+
Sbjct: 300  TFKKLGYIGISCLPILKIADFGFARFLPNTSLAETLCGSPLYMAPEILN-YQKY--NAKA 356

Query: 688  DIWALGVFLYKLCYYTTPFEKEGENAIL------NVKFQFPSYPQYSDHIRNIITIMLNK 849
            D+W++G  LY++ Y   PF+      +L      N    FPSY +  D ++ +I+ +L  
Sbjct: 357  DLWSVGTVLYEMVYGKPPFKANNHLELLKKIKRTNDNIPFPSYIEIDDDMKFLISRLLKF 416

Query: 850  DPIKRPNICQVLEQVSKLQGVPCPIENFMLTRIKLQNSRNNSNKSTSLNDTTNNSFNN 1023
            DPIKR +  +  E    L+          L+  +++NS N+ N +   N T+NN ++N
Sbjct: 417  DPIKRMSFQEFFENNLILKD---------LSIYEIENSNNDKNNNDDDNSTSNNDYDN 465

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score = 94.4 bits (233), Expect = 1e-18
 Identities = 74/277 (26%), Positives = 137/277 (49%), Gaps = 5/277 (1%)
 Frame = +1

Query: 79  YLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKY 258
           +L  GGFA+ + ++  D S       T+A   ++ +  +     L +E+   K ++ +  
Sbjct: 96  FLGEGGFARCFQIK--DESGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMR-HFN 149

Query: 259 IVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQG 438
           +V +ID         + +  V++L+E C  G +++ L  R    + E E+   M+ +C  
Sbjct: 150 VVQFIDCF-------EDDTNVYILLEICPNGSLMELLKKR--RTVTEPEVRYFMTQICGA 200

Query: 439 VAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMIN 618
           +  MH  +  +IHRD+K+ N+   +N + KI DFG A +VL   +             + 
Sbjct: 201 IKYMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFGLA-AVLANDR--------ERKYTVC 249

Query: 619 TTAQYRSPE-MIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAIL----NVKF 783
            T  Y +PE ++ K+SG+  +   DIW++GV +Y L     PF+ +  N I     N  F
Sbjct: 250 GTPNYIAPEVLMGKHSGHSYE--VDIWSIGVMIYALLIGKPPFQSKDVNMIYERIKNRDF 307

Query: 784 QFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 894
            FP     S+  + +I  +L+ DP++RP+I ++++ V
Sbjct: 308 AFPKDKYISNEAKTLIHDILSTDPLERPSIEEIIDYV 344

>Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON}
            (48405..49868) [1464 nt, 488 aa]
          Length = 487

 Score = 93.2 bits (230), Expect = 1e-18
 Identities = 88/330 (26%), Positives = 160/330 (48%), Gaps = 7/330 (2%)
 Frame = +1

Query: 70   IEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV-IVPDKSGLNTLRAEVDAMKLLK 246
            I++ +  G F  VY  +  D +N     G +  +K V +   +  ++ L  E+  +  L+
Sbjct: 17   IQECVGRGNFGDVY--KAFDKTN-----GAIVAVKVVNLEHTEEDIDLLAQEIFFLAELR 69

Query: 247  GNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSD 426
             + YI +YI +  +       +  ++++MEYC  G   D + T   + L E ++  I  +
Sbjct: 70   -SPYITNYITTMIE-------DVSMWIVMEYCGGGACSDLIKTVYINGLPENKVGFITRE 121

Query: 427  VCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHD 606
            V +G+  +H      IHRDIK  N+L+++ G  K+ DFG +  +     T +   F+   
Sbjct: 122  VLKGLKYLH--DQKKIHRDIKAANILLTDEGKVKLGDFGVSGQI---RATMKRGTFV--- 173

Query: 607  IMINTTAQYRSPEMIDKYS-GYPIDEKSDIWALGVFLYKLCYYTTPFEK-EGENAILNVK 780
                 T  + +PE+++K S GY  +EK+DIW+LG+ +Y+L     P  K +    ++++ 
Sbjct: 174  ----GTPYWMAPEVVNKESNGY--NEKADIWSLGITVYELLKGLPPLSKCDPMKVMVSLP 227

Query: 781  FQFPS--YPQYSDHIRNIITIMLNKDPIKRPNICQVL--EQVSKLQGVPCPIENFMLTRI 948
             + P   + QYSD  +  +   L KDP  RP+   +L  E V+  +      +   + R 
Sbjct: 228  RRKPPKLHGQYSDVAKGFVAACLVKDPNLRPSAEMLLTNEFVTNTEINDLKSDIDFVKRR 287

Query: 949  KLQNSRNNSNKSTSLNDTTNNSFNNELALD 1038
            K+QN+ + + K   L +   N  NNE+  D
Sbjct: 288  KVQNNYSKAPK-FQLQEKLYNEANNEIPWD 316

>KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24
            YDR523C
          Length = 543

 Score = 93.6 bits (231), Expect = 1e-18
 Identities = 86/329 (26%), Positives = 149/329 (45%), Gaps = 16/329 (4%)
 Frame = +1

Query: 70   IEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRA--EVDAMKLL 243
            I+K +  G F  V+         A N +       ++I  D S   T     E+  M LL
Sbjct: 18   IDKCVGKGNFGDVFK--------AMNNVTKEVVAIKIINLDDSEEETFEIIKEMRLMSLL 69

Query: 244  KGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMS 423
            K + YI  YI +  +       +Y ++++MEYC  G   D + T     L E ++  ++ 
Sbjct: 70   K-SPYIARYITTINE-------DYLMWIVMEYCGGGSARDLIKTCYREGLAENKVAFVVK 121

Query: 424  DVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHH 603
             V  G+  +H      IHRDIK  N+L++++G  K+ DFG +  +     T +   F+  
Sbjct: 122  SVLLGLQYLHAQHK--IHRDIKAANILLTDSGLVKVADFGVSAEM---RSTMKAKTFV-- 174

Query: 604  DIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEK-EGENAILNVK 780
                  T  + +PE++    G   +EKSDIW+LG+  Y+L     P  K +    + N+ 
Sbjct: 175  -----GTPYWMAPEVV-MNEGMGYNEKSDIWSLGITTYELLKGVPPLAKYDAIRVMRNIP 228

Query: 781  FQFPS--YPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSKLQGVPCPIENFM------ 936
             + P   +  Y++ +++ I   L KDP KRP+  ++LE    ++G P  +EN        
Sbjct: 229  KRKPPKLHGAYTNLVKHFIATCLIKDPEKRPSASELLEHDFMVKG-PGNVENLKNEVSYL 287

Query: 937  -----LTRIKLQNSRNNSNKSTSLNDTTN 1008
                    +  + SR + N+   ++D+ N
Sbjct: 288  KFTKETQAVARKKSRYDINEQGEIHDSEN 316

>Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236C -
           Hypothetical ORF [contig 165] FULL
          Length = 346

 Score = 90.9 bits (224), Expect = 1e-18
 Identities = 82/327 (25%), Positives = 139/327 (42%), Gaps = 47/327 (14%)
 Frame = +1

Query: 70  IEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKS--GLNTLRAEVDAMKLL 243
           I+K L  GG + VY V         ++ G +  LK+   P  S   ++    EV   +  
Sbjct: 28  IQKLLGEGGLSFVYLVE--------SKEGELFALKKTRCPFGSIGSISPAMKEVANYQRF 79

Query: 244 KGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYH--RLQEFEILKI 417
             + YI   +DS   +   K G   V++L+ Y ++G + D +N  L    ++ E +IL++
Sbjct: 80  S-SPYIAQIVDSQVVQE--KDGSKTVYVLLPYFAKGSLQDLINRHLLDCTQMSELDILRM 136

Query: 418 MSDVCQGVAAMHYLQP-----------------------------------PLIHRDIKI 492
              + +G+  +H   P                                      HRD+K 
Sbjct: 137 ALGIARGLLCIHEANPNHETDVAYSIVSAPYAEDSSLLNDLELDTFGESQQSYAHRDVKP 196

Query: 493 ENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMI-NTTAQYRSPEMIDKYSGY 669
            N++IS      I D GS CS  R     ++A     +    N T  Y +PE++D     
Sbjct: 197 SNIMISPEDLPVISDLGS-CSRARIDINSRQALLRFQEWSSDNCTLSYAAPEILDVKLNS 255

Query: 670 PIDEKSDIWALGVFLYKLCYYTTPFEKEGE-------NAILNVKFQFPSYPQYSDHIRNI 828
            I EK DIW+ G  +Y +C+  +PFE+E +        AI   K+  P    YS  +  +
Sbjct: 256 VITEKCDIWSFGCTMYSMCFGISPFEREEQISGASVTYAITTGKYTVPRGTSYSSSLIEL 315

Query: 829 ITIMLNKDPIKRPNICQVLEQVSKLQG 909
           I   L+ +P +RP++ +++  + +LQG
Sbjct: 316 IGKCLSVNPEQRPSVNELIALLMELQG 342

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
            Anc_6.31 YMR001C
          Length = 787

 Score = 94.0 bits (232), Expect = 2e-18
 Identities = 86/325 (26%), Positives = 149/325 (45%), Gaps = 5/325 (1%)
 Frame = +1

Query: 76   KYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNK 255
            ++L  GGFA+ + ++  D S       T+A   ++ +  +     L +E+   K +K ++
Sbjct: 146  QFLGEGGFARCFQIK--DESGKIFAAKTVA---KISIKTEKTRRKLLSEIQIHKSMK-HQ 199

Query: 256  YIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQ 435
             IV ++D         +    V++L+  C  G +++ L  R    L E E+      +C 
Sbjct: 200  NIVQFVDCF-------EDHINVYILLGMCPNGSLMELLKKRKI--LTEPEVRFFTVQICG 250

Query: 436  GVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMI 615
             +  MH  +  +IHRD+K+ N+   EN + KI DFG A +VL   +             +
Sbjct: 251  AIKYMHSRR--VIHRDLKLGNIFFDENYNLKIGDFGLA-AVLANDR--------ERKYTV 299

Query: 616  NTTAQYRSPE-MIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAIL----NVK 780
              T  Y +PE ++ K+SG+  +   DIW++GV ++ L     PF+ +  N I     N +
Sbjct: 300  CGTPNYIAPEVLLGKHSGHSYE--VDIWSIGVMIFALLIGKPPFQAKDVNTIYSRIKNSE 357

Query: 781  FQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSKLQGVPCPIENFMLTRIKLQN 960
            + FP     S   + +I  +L  DPI RP+I +++E V      P    N + T I   +
Sbjct: 358  YTFPINKSISQEAKTLIQDILINDPIARPSINEIMEYVWFRGTFPSMTSNTVFTEIPEYD 417

Query: 961  SRNNSNKSTSLNDTTNNSFNNELAL 1035
                 N+  SLN+  N    + L L
Sbjct: 418  QFLTPNE--SLNNFRNCMIQSGLIL 440

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 93.2 bits (230), Expect = 2e-18
 Identities = 77/277 (27%), Positives = 130/277 (46%), Gaps = 5/277 (1%)
 Frame = +1

Query: 79  YLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKY 258
           +L  GGFA+ + ++  D S    E+     + +  +  +     L +E+   K +  +  
Sbjct: 87  FLGEGGFARCFQIK--DDSG---EIFAAKTVAKASIKSEKTRKKLLSEIQIHKSMS-HPN 140

Query: 259 IVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQG 438
           IV +ID     S        V++L+E C  G +++ L  R    L E E+    + +C  
Sbjct: 141 IVQFIDCFEDDSN-------VYILLEICPNGSLMELLKRRKV--LTEPEVRFFTTQICGA 191

Query: 439 VAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMIN 618
           +  MH  +  +IHRD+K+ N+    N + KI DFG A  +    +             I 
Sbjct: 192 IKYMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESE---------RKYTIC 240

Query: 619 TTAQYRSPE-MIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAIL-NVK---F 783
            T  Y +PE ++ K+SG+  +   DIW+LGV LY L     PF+    N I   +K   F
Sbjct: 241 GTPNYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDF 298

Query: 784 QFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 894
            FP     SD  + +I  +L+ DPI+RP++ ++++ V
Sbjct: 299 SFPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {ON}
            YPL236C (REAL)
          Length = 364

 Score = 90.5 bits (223), Expect = 3e-18
 Identities = 81/336 (24%), Positives = 141/336 (41%), Gaps = 57/336 (16%)
 Frame = +1

Query: 70   IEKYLACGGFAQVYSVRVIDSSNARNELGTMA----CLKRVIVPDKSGLNTLRAEVDAMK 237
            I++ L  GG + VY V+++  S    E G  A     LK++I P+   ++    E++  K
Sbjct: 32   IQRLLGEGGLSFVYLVQLLKGSLIM-ENGVAAPELYALKKIICPNVESISNGMREIENYK 90

Query: 238  LLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHR--LQEFEIL 411
              + + Y++  IDS   +   K G   +++++ + + G + D +N RL     + E E +
Sbjct: 91   RFQ-SPYVIQSIDSQVMQE--KDGSKSIYIILPFYTLGSLQDSINRRLLEGTFISEAECV 147

Query: 412  KIMSDVCQGVAAMH-----------------------------YLQPPL----------- 471
            +IM  V +G+  +H                                 PL           
Sbjct: 148  RIMLGVIRGLLCLHDPASRQDNTNSRTTVDTVSMTYSDETAFLLEDTPLEMDMLSSNLGA 207

Query: 472  ----IHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRS 639
                 HRDI   N+L S +G   I D GS            +   +   +  N T  Y +
Sbjct: 208  SIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLRELQEWVNDNCTLPYTA 267

Query: 640  PEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE-------NAILNVKFQFPSY 798
            PE++       +D K DIW+LG   Y L +  +PFE+E +        AI   K+ FP  
Sbjct: 268  PELLGLKLNQTLDCKVDIWSLGCTFYTLMFGISPFEREEQIHGASITYAINTGKYSFPRN 327

Query: 799  PQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSKLQ 906
             ++S+ + ++I   +  DP++RP   Q+L  +  L+
Sbjct: 328  SRFSEGLLSVIKKCIQVDPVQRPTTSQLLNILQDLE 363

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 92.8 bits (229), Expect = 3e-18
 Identities = 76/277 (27%), Positives = 130/277 (46%), Gaps = 5/277 (1%)
 Frame = +1

Query: 79  YLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKY 258
           +L  GGFA+ + ++  D S    E+     + +  +  +     L +E+   K +  +  
Sbjct: 87  FLGEGGFARCFQIK--DDSG---EIFAAKTVAKASIKSEKTRKKLLSEIQIHKSM-AHPN 140

Query: 259 IVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQG 438
           IV ++D     S        V++L+E C  G +++ L  R    L E E+    + +C  
Sbjct: 141 IVQFVDCFEDDSN-------VYILLEICPNGSLMELLKRRKV--LTEPEVRFFTTQICGA 191

Query: 439 VAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMIN 618
           +  MH  +  +IHRD+K+ N+    N + KI DFG A  +    +             I 
Sbjct: 192 IKYMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESE---------RKYTIC 240

Query: 619 TTAQYRSPE-MIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAIL-NVK---F 783
            T  Y +PE ++ K+SG+  +   DIW+LGV LY L     PF+    N I   +K   F
Sbjct: 241 GTPNYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDF 298

Query: 784 QFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 894
            FP     SD  + +I  +L+ DPI+RP++ ++++ V
Sbjct: 299 SFPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score = 92.8 bits (229), Expect = 3e-18
 Identities = 77/277 (27%), Positives = 130/277 (46%), Gaps = 5/277 (1%)
 Frame = +1

Query: 79  YLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKY 258
           +L  GGFA+ + ++  D S    E+     + +  +  +     L +E+   K +  +  
Sbjct: 87  FLGEGGFARCFQIK--DDSG---EIFAAKTVAKASIKSEKTRKKLLSEIQIHKSMS-HPN 140

Query: 259 IVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQG 438
           IV +ID     S        V++L+E C  G +++ L  R    L E E+    + +C  
Sbjct: 141 IVQFIDCFEDDSN-------VYILLEICPNGSLMELLKRRKV--LTEPEVRFFTTQICGA 191

Query: 439 VAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMIN 618
           +  MH  +  +IHRD+K+ N+    N + KI DFG A  +    +             I 
Sbjct: 192 IKYMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESE---------RKYTIC 240

Query: 619 TTAQYRSPE-MIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAIL-NVK---F 783
            T  Y +PE ++ K+SG+  +   DIW+LGV LY L     PF+    N I   +K   F
Sbjct: 241 GTPNYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDF 298

Query: 784 QFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 894
            FP     SD  + +I  +L+ DPI+RP++ ++++ V
Sbjct: 299 SFPRDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 92.4 bits (228), Expect = 4e-18
 Identities = 78/277 (28%), Positives = 130/277 (46%), Gaps = 5/277 (1%)
 Frame = +1

Query: 79  YLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKY 258
           +L  GGFA+ + ++  D S       T+A   +  +  +     L +E+   K +  +  
Sbjct: 87  FLGEGGFARCFQIK--DDSGDIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSM-AHPN 140

Query: 259 IVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQG 438
           IV +ID     S        V++L+E C  G +++ L  R    L E E+    + +C  
Sbjct: 141 IVQFIDCFEDDSN-------VYILLEICPNGSLMELLKRRKV--LSEPEVRFFTTQICGA 191

Query: 439 VAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMIN 618
           +  MH  +  +IHRD+K+ N+    N + KI DFG A  +    +             I 
Sbjct: 192 IKYMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESE---------RKYTIC 240

Query: 619 TTAQYRSPE-MIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAIL-NVK---F 783
            T  Y +PE ++ K+SG+  +   DIW+LGV LY L     PF+    N I   +K   F
Sbjct: 241 GTPNYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDF 298

Query: 784 QFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 894
            FP     SD  + +I  +L+ DPI+RP++ ++++ V
Sbjct: 299 SFPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score = 92.4 bits (228), Expect = 4e-18
 Identities = 79/295 (26%), Positives = 137/295 (46%), Gaps = 5/295 (1%)
 Frame = +1

Query: 79  YLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKY 258
           +L  GGFA+ +     D S       T+A L    +  +     L +E+   K +K N  
Sbjct: 88  FLGEGGFARCFQFN--DDSGKIFAAKTVAKLS---IKSEKTRRKLLSEIQIHKSMK-NVN 141

Query: 259 IVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQG 438
           IV +ID         + +  V++L+E C  G ++D L  R    L E E+    + +C  
Sbjct: 142 IVQFIDCF-------EDDTNVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGA 192

Query: 439 VAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMIN 618
           +  MH  +  +IHRD+K+ N+   ++ + KI DFG A  +    +             + 
Sbjct: 193 IKYMHSRR--VIHRDLKLGNIFFDKDYNLKIGDFGLAAVLANDRE---------RKYTVC 241

Query: 619 TTAQYRSPEMI-DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILN----VKF 783
            T  Y +PE++  K++G+  +   DIW++GV LY L     PF+ +  N I        F
Sbjct: 242 GTPNYIAPEVLMGKHTGHSYEV--DIWSIGVMLYALLIGKPPFQSKDVNTIYERIKCCDF 299

Query: 784 QFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSKLQGVPCPIENFMLTRI 948
            FP     S   + +I  +L+ DP++RP++ ++++ V      P  IE+ ++T I
Sbjct: 300 TFPKDKYISPEAKILIQDLLSLDPLERPSVDEIIDYVWFRGLFPPQIESDVMTNI 354

>TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_7.86
            YAL017W
          Length = 1262

 Score = 92.8 bits (229), Expect = 5e-18
 Identities = 70/234 (29%), Positives = 112/234 (47%), Gaps = 5/234 (2%)
 Frame = +1

Query: 202  LNTLRAEVDAMKLLK--GNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNT 375
            L T+ +E+  M  L    NK I+S +D        +  +Y  ++      + G ID  + 
Sbjct: 1049 LGTIPSEIQIMSTLNKTSNKNILSILDF------FEDDDY-YYVEQPVHGKTGCIDLFDL 1101

Query: 376  RLYH-RLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSAC 552
              +   + EFE   I   +  G++ +H  +  ++HRDIK ENV++   G  K+ DFGSA 
Sbjct: 1102 IEFKTNMTEFEAKLIFKQIISGISHLH--ESGIVHRDIKDENVIVDAKGFVKLIDFGSAA 1159

Query: 553  SVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYSGYPIDEKSDIWALGVFLYKLC 726
             V   P           D+ +  T  Y SPE++  +KY G P     DIWALG+ LY + 
Sbjct: 1160 YVKNGP----------FDVFVG-TIDYASPEVLRGEKYEGKP----QDIWALGILLYTIV 1204

Query: 727  YYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLE 888
            +   PF    E  IL    +FP     S +  ++I ++LN+  ++RP+I  + E
Sbjct: 1205 FKENPFYNIDE--ILEGDMKFPETENISANCIDLIKLILNRSALERPSITDISE 1256

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score = 92.0 bits (227), Expect = 5e-18
 Identities = 73/277 (26%), Positives = 133/277 (48%), Gaps = 5/277 (1%)
 Frame = +1

Query: 79  YLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKY 258
           +L  GGFA+ + +R  D S       T+A   ++ +  +     L +E+   K +K +  
Sbjct: 100 FLGEGGFARCFQIR--DDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMK-HVN 153

Query: 259 IVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQG 438
           IV +ID         + +  V++L+E C  G ++D L  R    L E E+    + +C  
Sbjct: 154 IVQFIDCF-------EDDTNVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGA 204

Query: 439 VAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMIN 618
           +  MH  +  +IHRD+K+ N+      + KI DFG A ++    +             + 
Sbjct: 205 IKYMHSRK--VIHRDLKLGNIFFDRKYNLKIGDFGLAATLANDRE---------RKYTVC 253

Query: 619 TTAQYRSPE-MIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAIL-NVK---F 783
            T  Y +PE ++ K+SG+  +   DIW++GV +Y L     PF+ +  N I   +K   F
Sbjct: 254 GTPNYIAPEVLMGKHSGHSYE--VDIWSIGVMIYALIIGRPPFQSKDVNTIYERIKCRDF 311

Query: 784 QFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 894
            FP     S   + +I  +L+ DP++RP++ ++++ +
Sbjct: 312 SFPKDKLISSEAKILIQDILSLDPLERPSVNEIMDYI 348

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score = 91.3 bits (225), Expect = 1e-17
 Identities = 74/278 (26%), Positives = 135/278 (48%), Gaps = 5/278 (1%)
 Frame = +1

Query: 76  KYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNK 255
           ++L  GGFA+ + ++  D S       T+A   ++ +  +     L +E+   K +    
Sbjct: 85  QFLGEGGFARCFQIK--DDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMSHTN 139

Query: 256 YIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQ 435
            IV +ID         +    V++L+E C  G +++ +  R    + E E+   M+ +C 
Sbjct: 140 -IVQFIDCF-------EDNVNVYILLEICPNGSLMELIKKR--KTITEPEVRFFMTQICG 189

Query: 436 GVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMI 615
           G+  MH  +  +IHRD+K+ N+   E+ + KI DFG A  +       +E  F      I
Sbjct: 190 GIQYMHSNR--VIHRDLKLGNIFFDEHYNLKIGDFGLAAVL----ANDRERKF-----TI 238

Query: 616 NTTAQYRSPE-MIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAIL----NVK 780
             T  Y +PE ++ K+SG+  +   DIW++GV LY L     PF+ +  N I        
Sbjct: 239 CGTPNYIAPEVLMGKHSGHSYE--VDIWSIGVMLYALLIGKPPFQAKDVNTIYERIKQRN 296

Query: 781 FQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 894
           F +P   + S   + +I  +L+ +P++RP+I ++++ V
Sbjct: 297 FAYPKDKKISQDAKYLIDDILSLNPMERPSIQEIMDYV 334

>ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} similar to
            uniprot|Q7LGU7 Saccharomyces cerevisiae YPL236C
            Hypothetical ORF
          Length = 369

 Score = 88.6 bits (218), Expect = 1e-17
 Identities = 85/345 (24%), Positives = 147/345 (42%), Gaps = 57/345 (16%)
 Frame = +1

Query: 43   LPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGT-MACLKRVIVP--DKSGLNTL 213
            L I   +  I+K L    F+ +Y V+ I S  A +   T +  LKR+  P  +   ++  
Sbjct: 26   LSINGRRYSIKKLLGESNFSFIYLVQQIGSVTASSTPRTNLYALKRIRCPFGNIESISGA 85

Query: 214  RAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHR- 390
              EVD  K  + + YI+  +DS  Q ++ + G   V++L+ Y   G + D  +  L +  
Sbjct: 86   MKEVDNYKRFQ-SPYIIHLVDS--QVAQQRDGSKTVYILLPYFPLGSLQDSTSRNLLNGT 142

Query: 391  -LQEFEILKIMSDVCQGVAAMH-----------------------------YLQPPL--- 471
             + E E ++I+  + +G+  +H                                 PL   
Sbjct: 143  FISEAECIRIVIGIARGLRCLHDPSARSQDAEQQQEHDAVSMSYSDEAAFLLEDTPLELD 202

Query: 472  -------------IHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIM 612
                          HRDIK  N+L S +G   I + GS         T  +   +   + 
Sbjct: 203  ILSSANTINSNFYAHRDIKPSNILFSSDGLPVISNLGSCSKADLSINTGMQLTELQAWVS 262

Query: 613  INTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILNVK---- 780
             + T  Y +PE++       +D K DIW+LG   Y + +  +PFE+E + +  ++K    
Sbjct: 263  DHCTVAYTAPELLHITLNRSVDTKVDIWSLGCTCYFMLFGISPFEREEQISGASLKYAIG 322

Query: 781  ---FQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSKLQ 906
               F FPS  +YS+ +  +IT  L  +P  RP+I ++L  + +LQ
Sbjct: 323  TGNFSFPSQDRYSEGLLKLITKCLQVNPAARPDINELLTLLQELQ 367

>TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {ON}
           Anc_1.24 YDR523C
          Length = 482

 Score = 89.7 bits (221), Expect = 1e-17
 Identities = 82/310 (26%), Positives = 148/310 (47%), Gaps = 6/310 (1%)
 Frame = +1

Query: 70  IEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKG 249
           I+  +  G F  VY  + ID    +NE   +A     +      +  L  E+  +  LK 
Sbjct: 17  IQDCVGRGNFGDVY--KAID----KNESKVVAIKIVNLENTDEDIELLTQEIFFLSELK- 69

Query: 250 NKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDV 429
           + +I +YI +  +       +  ++++MEYC  G   D +       + E ++  I+ D 
Sbjct: 70  SPFITNYITTLTE-------DVTMWIVMEYCGGGSCADLIKMVYSKGIPESKVSYILRDT 122

Query: 430 CQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDI 609
            +G+  +H      IHRDIK  N+L+++ G  K+ DFG +  +     T +   F+    
Sbjct: 123 VKGLKYLH--DQKKIHRDIKAANILLTDCGKVKLGDFGVSGQI---RATMKRGTFV---- 173

Query: 610 MINTTAQYRSPEMIDKY-SGYPIDEKSDIWALGVFLYKLCYYTTPFEK-EGENAILNVKF 783
               T  + +PE+I+K   GY  +EK+DIW+LG+  Y+L     P  K +    +LN+  
Sbjct: 174 ---GTPYWMAPEVINKQCKGY--NEKADIWSLGITAYELLKGVPPLSKYDPFKVMLNIPK 228

Query: 784 QFPS--YPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSKLQGVPCPIEN--FMLTRIK 951
           + P   + QYS+  +  +++ L KDP +RP+I  +LE    L      ++    ++  IK
Sbjct: 229 RKPPKLHGQYSEKAKYFVSLCLIKDPKQRPSIEALLETDFLLPNTVLNLKEDVDLIKSIK 288

Query: 952 LQNSRNNSNK 981
           L+N+ + + K
Sbjct: 289 LKNNYSKTPK 298

>Kwal_27.11544 s27 (842997..843530) [534 bp, 177 aa] {OFF} [contig
           27] FULL
          Length = 177

 Score = 83.6 bits (205), Expect = 2e-17
 Identities = 59/175 (33%), Positives = 88/175 (50%)
 Frame = -1

Query: 774 IKDGIFTFFFKWSCVIT*FV*KNP*CPNI*FFINWVTRIFIYHLRRSILGSCINHYIVMD 595
           +++G  T+ F+   V+  FV +N   PN+ FFI+ VT I +YH  R IL  CI   I+++
Sbjct: 1   MQNGSITYLFEGGSVVAEFVQENTQGPNVGFFIDRVTSIKVYHFWRPILSRCILQNIILN 60

Query: 594 ECSLLWCFWWP*YTAGRTKITDFIITIFRYXXXXXXXVPVD*RWL*IMHCSNPLTNIAHN 415
              LL   W P YT   TKI +F   I R        V +D      +H SN L  + H 
Sbjct: 61  ITKLLCILWRPNYTTNGTKIANFKGFIVRDKHVFNLDVSMDEGRQQSVHGSNTLCYVTHY 120

Query: 414 LQYFKFLQSMI*SGV*KINNPTS*TILHQ*KYFILALFQFRSLCM*IYIRYNIFI 250
            Q     + ++ S V +I   T   +LHQ K+F+ ++ +     M I +RYN+FI
Sbjct: 121 FQNLVLRKPVLKSCVHEIYETTCRAVLHQKKHFVGSILRPGFGRMRIDVRYNVFI 175

>KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa]
            {ON} weakly similar to uniprot|P38692 Saccharomyces
            cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
            kinase family required for cell integrity possibly
            through regulating 1 6-beta-glucan levels in the wall
            physically interacts with Cdc31p (centrin) which is a
            component of the spindle pole body
          Length = 1016

 Score = 90.5 bits (223), Expect = 2e-17
 Identities = 81/323 (25%), Positives = 142/323 (43%), Gaps = 11/323 (3%)
 Frame = +1

Query: 103  QVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSH 282
            QVY+++V++  N  +E+                   +R E+  +  LK    I  Y  S+
Sbjct: 40   QVYAIKVLNLDNTEDEV-----------------EDIRKEIQFLSSLKQTPNITHYYGSY 82

Query: 283  AQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQ 462
               ++L       +++MEYC+ G +   L   +   ++E  I  IM ++   + ++H  +
Sbjct: 83   LIDTKL-------WVIMEYCAGGSLRTLLRPGI---IEEKYIGVIMREILVALISIH--R 130

Query: 463  PPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSP 642
              +IHRDIK  N+LI+ NG  K+CDFG A  + +     Q  A          T  + +P
Sbjct: 131  DNVIHRDIKAANILIANNGSVKLCDFGVAAQLSQSMLKRQTMA---------GTPYWMAP 181

Query: 643  EMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPF-EKEGENAILNVKFQFP---SYPQYS 810
            E+I    G   D K DIW+LG+  Y++     P+   E   A+  +    P      +YS
Sbjct: 182  EVI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCHMEAIRAMQMITKSKPPRLEGREYS 239

Query: 811  DHIRNIITIMLNKDPIKRPNICQVLEQ--VSKLQGVPCPIENFMLTRIKLQNSRNNSNK- 981
              ++  I + L++DP +RP   ++ +   + + +G    I   ++TR  L   +N   K 
Sbjct: 240  QPLKEFIALCLDEDPKERPYAEELFKSKLIKQEKGTSTVILKELITRYLLFREKNEQYKH 299

Query: 982  ----STSLNDTTNNSFNNELALD 1038
                 TS     N+S     + D
Sbjct: 300  EEESHTSSKQNPNSSIEGNASQD 322

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score = 90.1 bits (222), Expect = 3e-17
 Identities = 67/205 (32%), Positives = 108/205 (52%), Gaps = 13/205 (6%)
 Frame = +1

Query: 310 EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIK 489
           E +V++ +EYC    + ++L   + HR+   E  K+ + +   V   H LQ   +HRD+K
Sbjct: 100 ESKVWMALEYCPGKELYEYL--LMQHRISLEESGKLFAQIVSAVYYAHSLQ--CVHRDLK 155

Query: 490 IENVLISENGDYKICDFG--SACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDK-- 657
           +EN+L+ + G  KI DFG    C+     KT  E         +  T  Y +PE+I++  
Sbjct: 156 LENILLDKKGRAKITDFGFTRECAT----KTMLET--------VCGTTVYMAPELIERKS 203

Query: 658 YSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGEN----AILNVKFQFPSYPQYSDHI-- 819
           Y G+    K DIW+LGV LY + + T PF++E E      I+N +      P Y+D +  
Sbjct: 204 YDGF----KIDIWSLGVILYTMIHGTMPFDEEDETKTKWKIINEE------PFYNDDVVS 253

Query: 820 ---RNIITIMLNKDPIKRPNICQVL 885
              +++I+ +L KDP +RP + QVL
Sbjct: 254 KDAKDLISQLLCKDPSQRPQLSQVL 278

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score = 89.7 bits (221), Expect = 3e-17
 Identities = 70/277 (25%), Positives = 134/277 (48%), Gaps = 5/277 (1%)
 Frame = +1

Query: 79  YLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKY 258
           +L  GGFA+ + ++  D S       T+A   ++ +  +     L +E+   K +K +  
Sbjct: 97  FLGEGGFARCFQIK--DESGKIFAAKTVA---KISIKTEKTKKKLLSEIQIHKSMK-HPN 150

Query: 259 IVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQG 438
           IV ++D         + +  V++L+E CS G ++D +  R    L E E+    + +C  
Sbjct: 151 IVHFVDCF-------EDDTNVYILLEICSNGSLMDLMKKR--KTLTEPEVRFFTTQICGA 201

Query: 439 VAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMIN 618
           V  MH  +  +IHRD+K+ N+   ++ + K+ DFG A  +         A        + 
Sbjct: 202 VKYMHSRR--VIHRDLKLGNIFFDKDYNLKVGDFGLAAVL---------ANNRERKYTVC 250

Query: 619 TTAQYRSPE-MIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILN----VKF 783
            T  Y +PE ++ K++G+  +   DIW++GV +Y L     PF+ +  N I +     ++
Sbjct: 251 GTPNYIAPEVLMGKHAGHSFE--VDIWSIGVMIYALLVGKPPFQAKDVNVIYDRIKACQY 308

Query: 784 QFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 894
            +P     S   + +I  +L  DP++RP+I ++++ V
Sbjct: 309 GYPKDKYVSSEAKTLIADILCVDPVERPSIREIIDDV 345

>KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.24
           YDR523C
          Length = 507

 Score = 88.6 bits (218), Expect = 3e-17
 Identities = 64/232 (27%), Positives = 117/232 (50%), Gaps = 3/232 (1%)
 Frame = +1

Query: 202 LNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRL 381
           ++ L  E+  +  LK + YI++YI +  +       +  ++++M+YC  G   D +    
Sbjct: 56  IDLLAQEIFFLAELKSD-YIINYITTIME-------DVSMWIVMDYCGGGSCSDLIKIVY 107

Query: 382 YHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVL 561
            + + E ++  I+ +V  G+  +H  +   IHRDIK  N+L++++G  K+ DFG +  + 
Sbjct: 108 PNGIVEEKVSFIVKNVLLGLQYLH--EQKKIHRDIKAANILLTDDGQVKLGDFGVSGQI- 164

Query: 562 RPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTP 741
                    A +  D  + T   + +PE+I+K      DEK DIW+LG+  Y+L     P
Sbjct: 165 --------KATLKRDTFVGTP-YWMAPEVINKEINNGYDEKVDIWSLGITTYELLKGVPP 215

Query: 742 FEKEGENAILN--VKFQFPS-YPQYSDHIRNIITIMLNKDPIKRPNICQVLE 888
             K     ++   VK + P  +  Y+D  ++ I+  L KDP  RPN+  +L+
Sbjct: 216 LSKYDPVKVMTSLVKRKPPKLHGPYNDFTKSFISFCLIKDPKLRPNVQNLLK 267

>ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]
           {ON} similar to uniprot|P08458 Saccharomyces cerevisiae
           YDR523C SPS1 dispensable for mitosis involved in
           middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 471

 Score = 87.8 bits (216), Expect = 5e-17
 Identities = 84/329 (25%), Positives = 159/329 (48%), Gaps = 7/329 (2%)
 Frame = +1

Query: 34  GRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV-IVPDKSGLNT 210
           G + P  T+  II++ +  G F  VY  +  D        G +  +K V +   +  ++ 
Sbjct: 7   GSLDPSNTY--IIQQCVGRGNFGDVY--KACDKVE-----GKVVAVKVVNLEHSEEDIDL 57

Query: 211 LRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHR 390
           L  E+  +  L+ + +I +YI +  +       +  ++++MEYC  G   D +     + 
Sbjct: 58  LAQEIFFLAELR-SPFITNYITTLTE-------DVSMWIVMEYCGGGSCADLIKHIYING 109

Query: 391 LQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPP 570
           + E ++  I S V +G+  +H  +   IHRDIK  N+L+++ G  K+ DFG +  +    
Sbjct: 110 MPEKKVAFITSQVLRGLVYLH--EQKKIHRDIKAANILLTDEGTVKLGDFGVSGQI---R 164

Query: 571 KTPQEAAFIHHDIMINTTAQYRSPEMIDKYS-GYPIDEKSDIWALGVFLYKLCYYTTPFE 747
            T +   F+        T  + +PE++ K + GY  DEK+DIW+LG+ +Y+L     P  
Sbjct: 165 ATLKRGTFV-------GTPYWMAPEVVSKENDGY--DEKADIWSLGITVYELLKGAPPLS 215

Query: 748 K-EGENAILNVKFQFPS--YPQYSDHIRNIITIMLNKDPIKRPNICQVLEQ--VSKLQGV 912
           K +    ++N+  + P   +  YS   +N ++  L K+P+ R +  +++E   V++L  V
Sbjct: 216 KCDPMKVMINLPKRKPPALHGHYSHSAKNFVSSCLVKNPVGRASAYEMVEHNFVNQL-AV 274

Query: 913 PCPIENFMLTRIKLQNSRNNSNKSTSLND 999
           P   E+    +IK  N   + +   SL +
Sbjct: 275 PNLKEDVEYLKIKKSNDNYSRSPKYSLEN 303

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score = 89.0 bits (219), Expect = 5e-17
 Identities = 72/279 (25%), Positives = 133/279 (47%), Gaps = 5/279 (1%)
 Frame = +1

Query: 73  EKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGN 252
           E +L  GGFA+ + ++  D S       T+A   ++ +  +     L +E+   K +K +
Sbjct: 98  EHFLGEGGFARCFQIK--DESGKIFAAKTVA---KISIKSEKTKRKLLSEIQIHKSMKHS 152

Query: 253 KYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVC 432
             IV +ID         + +  V++L+E C  G ++D L  R    L E E+    + +C
Sbjct: 153 N-IVQFIDCF-------EDDANVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQIC 202

Query: 433 QGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIM 612
             +  +H  +  +IHRD+K+ N+   ++ + K+ DFG A +VL   +             
Sbjct: 203 GAIKYLHSRR--IIHRDLKLGNIFFDKDYNLKVGDFGLA-AVLANDR--------ERKYT 251

Query: 613 INTTAQYRSPE-MIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILN----V 777
           +  T  Y +PE ++ K+SG+  +   DIW++GV +Y L     PF+ +  N I       
Sbjct: 252 VCGTPNYIAPEVLMGKHSGHSFE--VDIWSIGVMIYALLVGKPPFQAKDVNVIYERIKLC 309

Query: 778 KFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 894
           K+ +P     S     +I  +L+ +P++RP I  +++ V
Sbjct: 310 KYGYPKDKYVSKEAEILIHDILSLNPLQRPTIIDIIDDV 348

>NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {ON}
            Anc_6.262 YPL236C
          Length = 367

 Score = 86.3 bits (212), Expect = 7e-17
 Identities = 86/345 (24%), Positives = 141/345 (40%), Gaps = 55/345 (15%)
 Frame = +1

Query: 40   VLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVP--DKSGLNTL 213
            ++ I      IEK L     +  Y VR +DS     E G +  LKR+  P  D   ++  
Sbjct: 22   IISINARDYKIEKLLQDENLSYSYLVRTLDSEPPF-ENGPLFVLKRIYCPFGDIESVSAA 80

Query: 214  RAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHR- 390
              E+   K   GN +I+S +D   Q  +   G  ++ +L  +   G V D +N  L    
Sbjct: 81   MNEISYYKKFAGNSHIISCLDY--QLHQKYDGSKQIDVLFPFYHYGSVQDDINRHLLSSS 138

Query: 391  ------LQEFEILKIMSDVCQGVAAMH-----------------YLQ-PPLIHRDIKIEN 498
                  + E + +KIM  +C+G+  +H                 Y +  PL+  D+ +E 
Sbjct: 139  TALGTVIPEKDCIKIMIGLCRGLLPLHDPKLREQGSPDDMAIMSYSENAPLLLNDLPMEL 198

Query: 499  --------------------VLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMIN 618
                                +L+SE G+  I D  S         T  +       I  +
Sbjct: 199  SKDNENENVCFAYYNLRPDLILLSEQGNAIIADLQSCFRTNITISTEIQLNRFQQWIEEH 258

Query: 619  TTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE-------NAILNV 777
             T Q+ +PE++    G  I  K DIW+LG  LY + +  +PFE+E +         I   
Sbjct: 259  CTLQFSAPELLTLKMGDKITAKVDIWSLGCVLYSMMFGISPFEREEQLNGGVVKYCIKMG 318

Query: 778  KFQFP-SYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSKLQG 909
            K+  P +   YS  I +I+   L  DP +RP++  +L  + ++QG
Sbjct: 319  KYSIPDTKGTYSQEIIDILNTCLKVDPSERPSLNGILNNLQEIQG 363

>Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to
           Ashbya gossypii AFR724C
          Length = 440

 Score = 87.0 bits (214), Expect = 7e-17
 Identities = 77/286 (26%), Positives = 139/286 (48%), Gaps = 5/286 (1%)
 Frame = +1

Query: 46  PIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSG-LNTLRAE 222
           P  + Q  I + +  G F  VY  R +    A NE+     +K V + D    ++ L  E
Sbjct: 14  PDSSSQYEILQCIGRGNFGDVYKARYL----ATNEI---VAIKVVNLEDTDEPIDLLAQE 66

Query: 223 VDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEF 402
           +  +  L+ + YI +Y  +          +  ++++MEYC  G   + L     H+L E 
Sbjct: 67  IFFLSELR-SPYITNYKTAFLV-------DVSMWIVMEYCGGGSCAELLKYTPEHKLTED 118

Query: 403 EILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQ 582
           +   I+S+V  G+  +H  +   IHRDIK  N+L+++NG  K+ DFG +  ++   K   
Sbjct: 119 QCAFIVSEVLVGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFGVSGQMMVTRK--- 173

Query: 583 EAAFIHHDIMINTTAQYRSPEMIDK-YSGYPIDEKSDIWALGVFLYKLCYYTTPFEK-EG 756
                  D  + T   + +PE+ID+   GY  +E +DIW+LG+ + +L     P +K + 
Sbjct: 174 ------RDTFVGTPF-WMAPEVIDRNKKGY--NEMADIWSLGITVIELLMGHPPLDKYDA 224

Query: 757 ENAILNVKFQFPSY--PQYSDHIRNIITIMLNKDPIKRPNICQVLE 888
             A++ +  + P     ++S H ++ +   L KDP +RP   ++L+
Sbjct: 225 MKALMAIPKRDPPKLDKRFSSHAKDFVAQCLIKDPSQRPTASELLK 270

>Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}
           similar to Ashbya gossypii AFL143C
          Length = 363

 Score = 85.5 bits (210), Expect = 1e-16
 Identities = 72/309 (23%), Positives = 122/309 (39%), Gaps = 55/309 (17%)
 Frame = +1

Query: 142 RNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNK-YIVSYIDSHAQRSELKQGEYE 318
           R+  G +  LK+V  P        RA  +     + N  YI + +D    + +   G   
Sbjct: 53  RSHSGGVYALKKVTCPIGRADFVTRAMTEISNYQRFNSPYITNILDFQVAQHD--NGTKI 110

Query: 319 VFLLMEYCSRGGVIDFLNTRLYH--RLQEFEILKIMSDVCQGVAAMH------------- 453
           +++L+ Y   G + D +N  +     L E  ++++M D+C+GV  MH             
Sbjct: 111 IYMLLPYFPAGSLQDLINNMIIRGDSLSESRVVRLMLDICRGVRCMHEPSESDFRDPYDV 170

Query: 454 ------------------------YLQPPL--------IHRDIKIENVLISENGDYKICD 537
                                    L PPL        +H  +  EN+++S  G   I +
Sbjct: 171 AYFDAASLRYSDETHLLVDAMELDLLSPPLTNSEPSAYVHCGLNPENIMLSSEGLPVIYN 230

Query: 538 FGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLY 717
             S         +  +   +   +  N+   Y  PE++D +    I  + DIW+LG   Y
Sbjct: 231 MASCVRAPLELTSNSKLLGLQEWLNENSCLPYTCPELLDLHPNTSITNRCDIWSLGCICY 290

Query: 718 KLCYYTTPFEKEGE-------NAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNIC 876
            L Y  + F +E +       ++I    F FP  P+YS  ++ I+   L  DP KRP+I 
Sbjct: 291 ALMYSISSFAREQQLCGTPIKHSISTGNFSFPDEPRYSQSLKRIVQRCLVIDPHKRPDIY 350

Query: 877 QVLEQVSKL 903
           + L Q  +L
Sbjct: 351 ETLAQFQEL 359

>Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {ON}
           YDR466W - Hypothetical ORF [contig 196] FULL
          Length = 621

 Score = 87.4 bits (215), Expect = 1e-16
 Identities = 86/278 (30%), Positives = 132/278 (47%), Gaps = 11/278 (3%)
 Frame = +1

Query: 82  LACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLK--GNK 255
           L  G ++ VY  R ++ SN+        C K+ I+ +K  +  +  E D + +L   G+ 
Sbjct: 16  LGQGSYSTVY--RAVERSNSGRNYAIKVCSKKHIIREKK-VKYVTIEKDLLNMLAKGGHL 72

Query: 256 YIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQ 435
            IV    +      L       + ++EY S GG +  L  RL  RL E     I + +  
Sbjct: 73  GIVKLFCTFHDIENL-------YFVLEYVS-GGELLALIQRL-GRLTEDLSRHITAQLVD 123

Query: 436 GVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVL--RPPKTPQEAAFIHHDI 609
            V  MH     +IHRD+K ENVL+S+ G   I DFG+AC+    +   T + A+F+    
Sbjct: 124 TVDYMH--SKGVIHRDLKPENVLLSQEGRVVITDFGAACTAADRKFENTKRTASFV---- 177

Query: 610 MINTTAQYRSPE-MIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE------NAI 768
               TA+Y SPE ++    G+     SDIWALG  +Y+L     PF  E E         
Sbjct: 178 ---GTAEYVSPELLLHSQCGF----SSDIWALGCIIYQLNQGKPPFRGENELQTFEKIVA 230

Query: 769 LNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQV 882
           L+ K+ F + PQ    + +I+  +L  DP+KRP+  Q+
Sbjct: 231 LDYKWLFSNSPQ----VVSIVQSILVTDPLKRPSAAQL 264

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score = 87.4 bits (215), Expect = 1e-16
 Identities = 71/277 (25%), Positives = 131/277 (47%), Gaps = 5/277 (1%)
 Frame = +1

Query: 79  YLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKY 258
           +L  GGFA+ + ++  D S       T+A   ++ +  +     L +E+   K +K +  
Sbjct: 78  FLGEGGFARCFQMK--DDSGKVFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMK-HPN 131

Query: 259 IVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQG 438
           IV + D         + +  V++L+E C  G ++D L  R   +L E E+    + +   
Sbjct: 132 IVQFTDCF-------EDDTNVYILLEICPNGSLMDLLKQR--KQLTEPEVRFFTTQIVGA 182

Query: 439 VAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMIN 618
           +  MH  +  +IHRD+K+ N+   ++ + KI DFG A  +    +             I 
Sbjct: 183 IKYMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRE---------RKYTIC 231

Query: 619 TTAQYRSPEMID-KYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILN----VKF 783
            T  Y +PE++  K++G+  +   DIW++GV +Y L     PF+ +  N I        F
Sbjct: 232 GTPNYIAPEVLTGKHTGHSFEV--DIWSIGVMIYALLIGKPPFQAKEVNTIYERIKVCDF 289

Query: 784 QFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 894
            FP     S   + +I  +L+ DP++RP++ +++E V
Sbjct: 290 SFPKDKPISSEAKVLIKDILSLDPLERPSLAEIMEYV 326

>ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakly
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1262

 Score = 87.4 bits (215), Expect = 2e-16
 Identities = 62/179 (34%), Positives = 88/179 (49%), Gaps = 2/179 (1%)
 Frame = +1

Query: 352  GVIDFLNT-RLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYK 528
            G ID  +   L   + E+E   I   V   +  +H     ++HRDIK ENV++   G  K
Sbjct: 1094 GCIDLFDLIELKTNMTEYEAKLIFRQVVSAIRHLH--SQGIVHRDIKDENVVVDSKGFVK 1151

Query: 529  ICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEK-SDIWALG 705
            + DFGSA  V   P           D+ +  T  Y +PE++   SG P D K  DIWA+G
Sbjct: 1152 LIDFGSAAYVKSGP----------FDVFVG-TIDYAAPEVL---SGEPFDGKPQDIWAIG 1197

Query: 706  VFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQV 882
            V LY + +   PF    E  IL V  +F      S+   N+I ++LNK+P +RP I +V
Sbjct: 1198 VLLYTIVFKENPFYNIDE--ILEVNLKFHGTKGVSEECINLIKMILNKNPSQRPTIDEV 1254

>AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR523C
           (SPS1)
          Length = 440

 Score = 85.5 bits (210), Expect = 2e-16
 Identities = 75/286 (26%), Positives = 138/286 (48%), Gaps = 5/286 (1%)
 Frame = +1

Query: 46  PIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSG-LNTLRAE 222
           P  + Q  I + +  G F  VY  R + S+        +  +K V + D    ++ L  E
Sbjct: 14  PDPSSQYEILQCIGRGNFGDVYKARDLTSNE-------IVAIKVVNLEDTDEPIDLLAQE 66

Query: 223 VDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEF 402
           +  +  L+ + YI +Y  +          +  ++++MEYC  G   + L     H++ E 
Sbjct: 67  IFFLSELR-SPYITNYKTAFLV-------DVSMWIVMEYCGGGSCAELLKYTPEHKVTEE 118

Query: 403 EILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQ 582
           +   I+S+V  G+  +H  +   IHRDIK  N+L+++NG  K+ DFG +  ++   K   
Sbjct: 119 QCAFIVSEVLIGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFGVSGQMMVTRK--- 173

Query: 583 EAAFIHHDIMINTTAQYRSPEMIDK-YSGYPIDEKSDIWALGVFLYKLCYYTTPFEK-EG 756
                  D  + T   + +PE+ID+   GY  +E +DIW+LG+ + +L     P +K + 
Sbjct: 174 ------RDTFVGTPF-WMAPEVIDRNKQGY--NEMADIWSLGITVIELLMGHPPLDKYDA 224

Query: 757 ENAILNVKFQFPSY--PQYSDHIRNIITIMLNKDPIKRPNICQVLE 888
             A++ +  + P     ++S H R+ +   L KDP +RP   ++L+
Sbjct: 225 MKALMAIPKRDPPKLDKRFSSHARDFVAQCLIKDPSQRPTAAELLK 270

>SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar to
           uniprot|Q751V1 Ashbya gossypii AFR724C AFR724Cp and some
           similarites with YDR523C uniprot|P08458 Saccharomyces
           cerevisiae YDR523C SPS1 dispensable for mitosis involved
           in middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 564

 Score = 86.3 bits (212), Expect = 2e-16
 Identities = 72/279 (25%), Positives = 129/279 (46%), Gaps = 6/279 (2%)
 Frame = +1

Query: 70  IEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKG 249
           +++ +  G F  VY  + ID S      G    +K V + +      L A+         
Sbjct: 36  VQECVGKGNFGDVY--KAIDKST-----GNTVAIKVVNLEETDDEIDLLAQEIYFLAELH 88

Query: 250 NKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDV 429
           + YI +Y  +  +       +  ++++MEYC  G   D L       L E ++  I  ++
Sbjct: 89  SPYITNYFSTFVE-------DVSMWIVMEYCGGGSCSDLLKCLPRGTLTEEKVAFITREI 141

Query: 430 CQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDI 609
            +G+  +H  +   IHRDIK  N+L++++G  K+ DFG +  ++    T +   F+    
Sbjct: 142 LRGLEYLHSQRK--IHRDIKAANILLTDDGKVKLGDFGVSGQMM---ATRRRDTFV---- 192

Query: 610 MINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILNVKFQF 789
               T  + +PE+I + S    +EK+DIW+LG+ +++L     P  +      + V    
Sbjct: 193 ---GTPFWMAPEVIAR-SEQGYNEKADIWSLGITVFELLKGQPPLSQHDP---MKVLMSI 245

Query: 790 PS------YPQYSDHIRNIITIMLNKDPIKRPNICQVLE 888
           PS        +YS  IR  +++ LNKDP KRP   ++L+
Sbjct: 246 PSRRPPKLEDRYSHAIREFVSLCLNKDPAKRPTASELLK 284

>NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {ON}
           Anc_8.140
          Length = 915

 Score = 86.7 bits (213), Expect = 3e-16
 Identities = 74/263 (28%), Positives = 122/263 (46%), Gaps = 34/263 (12%)
 Frame = +1

Query: 187 PDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDF 366
           P ++  N ++ E+  MK    NK++V  I+     S  K     ++L++EYC +G ++  
Sbjct: 136 PKRNDPNKIKKEIAIMKKCN-NKHVVKLIEILDDLSSRK-----IYLVLEYCEKGPILWC 189

Query: 367 ------LNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYK 528
                 +++R   +L      +I  DV  G+  +H     +IHRDIK  N+L+ +NG  K
Sbjct: 190 PRDQLEIDSRGPPQLSFQRAREIFRDVILGLEYLH--SQGIIHRDIKPANLLMDKNGVVK 247

Query: 529 ICDFGSACSV----------LRPPKTPQEAAFIHHDIMINTTAQYR-SPEMIDKYSGYPI 675
           I DFG + +           L   KT     F   +I +   A  R + +  + ++G  I
Sbjct: 248 ISDFGVSLAANGNIDTNDDELELTKTVGTPVFYAPEICLGAAAMERFNLDKDELFNGSCI 307

Query: 676 DEKSDIWALGVFLYKLCYYTTPFEKEGE----NAILNVKFQFPSYPQYSD---------- 813
             K DIWALG+ LY L +   PF  E E      I+N K +FP++    D          
Sbjct: 308 SFKIDIWALGITLYCLLFGMLPFVSEFELKLFEKIVNEKLRFPTFETLQDNHISEISHIR 367

Query: 814 ---HIRNIITIMLNKDPIKRPNI 873
              H ++++  +L K+P KR +I
Sbjct: 368 EFVHAKDLLNKLLEKNPAKRISI 390

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score = 86.3 bits (212), Expect = 3e-16
 Identities = 78/300 (26%), Positives = 142/300 (47%), Gaps = 5/300 (1%)
 Frame = +1

Query: 79  YLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKY 258
           +L  GGFA+ + ++  D S       T+A   ++ +  +     L +E+   K +K +  
Sbjct: 82  FLGEGGFARCFQMK--DDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMK-HPN 135

Query: 259 IVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQG 438
           IV +ID         + +  V++L+E C  G ++D L  R    L E E+    + +   
Sbjct: 136 IVQFIDCF-------EDDTNVYILLEICPNGSLMDLLKKRKV--LTEPEVRYFTTQIVGA 186

Query: 439 VAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMIN 618
           +  MH  +  +IHRD+K+ N+    N + KI DFG A +VL   +             + 
Sbjct: 187 IKYMHNRR--VIHRDLKLGNIFFDSNYNLKIGDFGLA-AVLANDR--------ERKYTVC 235

Query: 619 TTAQYRSPEMI-DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAIL----NVKF 783
            T  Y +PE++  K+SG+  +   DIW++GV +Y L     PF+ +  N I     +  +
Sbjct: 236 GTPNYIAPEVLAGKHSGHSYE--VDIWSIGVMIYALLIGKPPFQAKEVNIIYERIKSGDY 293

Query: 784 QFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSKLQGVPCPIENFMLTRIKLQNS 963
            FP     S  +  +I  +L+ DPI+RP++ ++++ V      P  I   +LT + + ++
Sbjct: 294 IFPREKPTSKEVMVLIQDILSIDPIERPSLDEIMDYVWFRGIFPARINGDVLTSVPVYDN 353

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score = 85.9 bits (211), Expect = 4e-16
 Identities = 73/277 (26%), Positives = 134/277 (48%), Gaps = 5/277 (1%)
 Frame = +1

Query: 79  YLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKY 258
           +L  GGFA+ + ++     + + ++     + ++ +  +     L +E+   K +K +  
Sbjct: 95  FLGEGGFARCFQMK-----DDKGKVFAAKTVAKLSIKSEKTRRKLLSEIQIHKSMK-HPN 148

Query: 259 IVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQG 438
           IV + D         + +  V++L+E C  G V++ L  R +  L E E+   M  +   
Sbjct: 149 IVQFTDCF-------EDDTNVYILLEICPNGSVMELLRQRKH--LTEPEVRFCMIQIIGA 199

Query: 439 VAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMIN 618
           +  MH  +  +IHRD+K+ N+   +  + KI DFG A +VL   K             I 
Sbjct: 200 IRYMHSRR--VIHRDLKLGNIFFDKEYNLKIGDFGLA-AVLANDK--------ERKYTIC 248

Query: 619 TTAQYRSPEMI-DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFE-KEGENAILNVK---F 783
            T  Y +PE++  K++G+  +   DIW++GV LY L +   PF+ KE E     +K   F
Sbjct: 249 GTPNYIAPEVLTGKHTGHSYE--VDIWSIGVMLYALLFGKPPFQAKEVETIYERIKCRDF 306

Query: 784 QFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 894
            FP+    S   +N+I+ +L  +P  RP++ ++ + V
Sbjct: 307 IFPADKPVSSDAKNLISHLLQLNPAARPSLYEITDNV 343

>KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar to
           uniprot|P08458 Saccharomyces cerevisiae YDR523C SPS1
           dispensable for mitosis involved in middle/late stage of
           meiosis required for spore wall formation
           serine/threonine kinase homologous to Ste20p expressed
           in middle/late meiosis
          Length = 512

 Score = 85.1 bits (209), Expect = 4e-16
 Identities = 59/196 (30%), Positives = 104/196 (53%), Gaps = 4/196 (2%)
 Frame = +1

Query: 310 EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIK 489
           +  ++++ME+C  G   D L     HRL E ++  I+ +V  G+  +H  +   IHRDIK
Sbjct: 107 DVSMWIVMEFCGGGSCADLLKHLPEHRLSENKVAYIIREVLFGLDYLHSQKK--IHRDIK 164

Query: 490 IENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI-DKYSG 666
             N+L++++G+ K+ DFG +  ++    T +   F+        T  + +PE+I  K +G
Sbjct: 165 AANILLTDDGEVKLGDFGVSGQIM---ATLKRTTFV-------GTPYWMAPEIIAKKDNG 214

Query: 667 YPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAIL-NVKFQFPSYPQ--YSDHIRNIITI 837
           Y  +EK+DIW+LG+   +L     P+ K     +L N+  + P   Q  ++   R+ I +
Sbjct: 215 Y--NEKADIWSLGITAIELLTGQPPYAKHDPMKVLVNIPLRKPPKLQGRFTGSARDFIAL 272

Query: 838 MLNKDPIKRPNICQVL 885
            L KDP  RP+  ++L
Sbjct: 273 CLIKDPDLRPSAAELL 288

>TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa]
           {ON} Anc_1.24 YDR523C
          Length = 468

 Score = 84.7 bits (208), Expect = 5e-16
 Identities = 70/241 (29%), Positives = 121/241 (50%), Gaps = 6/241 (2%)
 Frame = +1

Query: 202 LNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRL 381
           +N L  E+  +  LK + YI +YI +  +       +  ++++MEYC  G   D L    
Sbjct: 57  INLLAQEIFFLAELK-SPYITNYITTMTE-------DVSMWIIMEYCGGGSCADLLRNIY 108

Query: 382 YHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVL 561
              L E +   I  +V +G+  +H  +   IHRDIK  N+L+++ G  K+ DFG +  + 
Sbjct: 109 NCGLPESKSAYITREVLKGLEYLH--EQKKIHRDIKAANILLTDEGKVKLGDFGVSGQI- 165

Query: 562 RPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYS-GYPIDEKSDIWALGVFLYKLCYYTT 738
               T +   F+        T  + +PE++ K S GY  DEK+DIW+LG+ +Y+L   + 
Sbjct: 166 --RATLKRGTFV-------GTPFWMAPEVVSKDSDGY--DEKADIWSLGITVYELLKGSP 214

Query: 739 PFEK-EGENAILNVKFQFPS--YPQYSDHIRNIITIMLNKDPIKRPNICQVL--EQVSKL 903
           P  K +    ++N+  + P   +  YS   ++ +   L K+P  RP+  ++L  E V+ L
Sbjct: 215 PLYKCDPMKVMVNLPKRKPPVLHGHYSSAAKHFVASCLVKNPKNRPSAVELLNSEFVTNL 274

Query: 904 Q 906
           Q
Sbjct: 275 Q 275

>Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {ON}
           YHR102W (KIC1) - PAK/Ste20 kinase family [contig 128]
           FULL
          Length = 865

 Score = 85.5 bits (210), Expect = 7e-16
 Identities = 76/266 (28%), Positives = 127/266 (47%), Gaps = 6/266 (2%)
 Frame = +1

Query: 211 LRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHR 390
           ++ E+  +  LK    I  Y  S+   ++L       +++MEYC+ G +   L      +
Sbjct: 62  VQKEIQFLSSLKQVPNITHYYGSYLNDTKL-------WVIMEYCAGGSLRTLLRPG---K 111

Query: 391 LQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPP 570
           + E  I  IM ++    A MH  +  +IHRDIK  NVLI+ +G  K+CDFG A  + +  
Sbjct: 112 IGEQYIGVIMRELL--TALMHIHKDGVIHRDIKAANVLITNDGHIKLCDFGVAAQLSQTK 169

Query: 571 KTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPF-E 747
              Q  A          T  + +PE+I    G   D K DIW+LG+  Y++     P+ E
Sbjct: 170 IRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCE 218

Query: 748 KEGENAI-LNVKFQFPSYP--QYSDHIRNIITIMLNKDPIKRPNICQVLEQ--VSKLQGV 912
            E   A+ L  K + P     Q+S  ++ II + L++DP +RP+   +L+   +   + V
Sbjct: 219 VEALRAMQLITKSKPPRLEGRQHSSALKEIIALCLDEDPKERPSAEDLLKTKFIKLHKNV 278

Query: 913 PCPIENFMLTRIKLQNSRNNSNKSTS 990
           P  I   +++R  L   + +  +S S
Sbjct: 279 PVSILKELISRYLLHRDKRSQRESVS 304

>NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa]
           {ON} Anc_1.24
          Length = 489

 Score = 84.3 bits (207), Expect = 7e-16
 Identities = 72/278 (25%), Positives = 129/278 (46%), Gaps = 4/278 (1%)
 Frame = +1

Query: 70  IEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV-IVPDKSGLNTLRAEVDAMKLLK 246
           I+  +  G F  VY  + ID        G +  +K V +      +  +  E+  +  LK
Sbjct: 23  IQDCVGRGNFGDVY--KAIDKLT-----GEIVAIKVVNLESSDEDIELIAQEIFFLAELK 75

Query: 247 GNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSD 426
            + YI +YI +  +       +  ++++MEYC  G   D +       L E ++  I  +
Sbjct: 76  -SPYITNYITTMLE-------DVSMWIVMEYCGGGSCSDLIRYHYNEGLHEDKVAFITKN 127

Query: 427 VCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHD 606
           V +G+  +H  +   IHRD+K  NVL++++G  K+ DFG +  +     T +   F+   
Sbjct: 128 VLRGLQYLH--EQRKIHRDVKAANVLLTDDGLVKLADFGVSGQL---RSTAKRNTFV--- 179

Query: 607 IMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILN---V 777
                T  + +PE+I   S +  +EK+DIW+LG+ +Y+L     P+ K     ++     
Sbjct: 180 ----GTPYWMAPEIISN-SSHGYNEKADIWSLGITVYELLKGCPPYAKYDAGKVMRNIPK 234

Query: 778 KFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQ 891
           K        +SD  +  I+  L KDP +RP   ++L+Q
Sbjct: 235 KNLQDCMVSFSDAAKLFISACLIKDPDERPTATELLQQ 272

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score = 85.1 bits (209), Expect = 8e-16
 Identities = 71/277 (25%), Positives = 133/277 (48%), Gaps = 5/277 (1%)
 Frame = +1

Query: 79  YLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKY 258
           +L  GGFA+ + ++  D S       T+A   ++ +  +     L +E+   K ++ +  
Sbjct: 78  FLGEGGFARCFQMK--DDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMR-HPN 131

Query: 259 IVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQG 438
           IV + D         + +  V++L+E C  G ++D L  R   +L E E+    + +   
Sbjct: 132 IVQFTDCF-------EDDTNVYILLEICPNGSLMDLLKQR--KQLTEPEVRFFTTQIVGA 182

Query: 439 VAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMIN 618
           +  MH  +  +IHRD+K+ N+   ++ + KI DFG A +VL   +             I 
Sbjct: 183 IKYMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFGLA-AVLANDR--------ERKYTIC 231

Query: 619 TTAQYRSPEMI-DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILN----VKF 783
            T  Y +PE++  K++G+  +   D+W++GV +Y L     PF+ +  N I        F
Sbjct: 232 GTPNYIAPEVLTGKHTGHSFE--VDVWSIGVMIYALLIGKPPFQAKEVNTIYERIKVCDF 289

Query: 784 QFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 894
            FP     S   + +I  +L+ DP++RP++ +++E V
Sbjct: 290 NFPRDKPISSEAKVLIKDILSLDPLERPSLTEIMEYV 326

>TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1.24
           YDR523C
          Length = 516

 Score = 84.0 bits (206), Expect = 1e-15
 Identities = 75/273 (27%), Positives = 131/273 (47%), Gaps = 5/273 (1%)
 Frame = +1

Query: 67  IIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV-IVPDKSGLNTLRAEVDAMKLL 243
           ++EK +  G F  VY    I S       G +  +K V +      +  L  E+  +  L
Sbjct: 16  LMEKCVGRGNFGDVYKAVEIKS-------GKIVAIKVVNLEHTNEDIELLSQEIFFLAEL 68

Query: 244 KGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMS 423
           + + Y+  Y+ +  +       +  ++++MEYC  G   D +       L E +   I  
Sbjct: 69  R-SPYVTKYLTTLLE-------DVSIWIVMEYCGGGSCADLIKYAYKRGLPENKASFITK 120

Query: 424 DVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHH 603
           +V +G+  +H  +   IHRDIK  N+L++++G  K+ DFG          + Q  A +  
Sbjct: 121 EVLKGLRYLH--EQKKIHRDIKAANILLTDDGMVKLGDFG---------VSGQIKATLKK 169

Query: 604 DIMINTTAQYRSPEMIDK-YSGYPIDEKSDIWALGVFLYKLCYYTTPFEK-EGENAILNV 777
           D  +  T  + +PE++ K  SGY  +EK+DIW+LG+ +Y+L     P  K +    +++V
Sbjct: 170 DTFVG-TPYWMAPEVVKKDESGY--NEKADIWSLGITVYELLKGCPPLAKYDPMKVMISV 226

Query: 778 -KFQFPS-YPQYSDHIRNIITIMLNKDPIKRPN 870
            K + P  +  YS+  ++ I+  L KDP  RPN
Sbjct: 227 PKRRAPKLHGHYSEDAKSFISHCLIKDPNARPN 259

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 61/197 (30%), Positives = 101/197 (51%), Gaps = 5/197 (2%)
 Frame = +1

Query: 310 EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIK 489
           E +V++++EYC    + D+L ++   R+   E  +I + +   V   H L    +HRD+K
Sbjct: 102 ETKVWMVIEYCPNKELYDYLLSK--KRISLDESARIFAQIVGAVYYAHSLS--CVHRDLK 157

Query: 490 IENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYS 663
           +EN+L+ ++ + K+ DFG      +   T  E         I  T  Y +PE++  +KY 
Sbjct: 158 LENILLDKDNNAKLTDFGFTRDFSK--NTQLET--------ICGTTVYMAPELLRREKYD 207

Query: 664 GYPIDEKSDIWALGVFLYKLCYYTTPF-EKEGENAILNVKFQFPSYPQ--YSDHIRNIIT 834
           GY    K DIWALG+ LY +   T PF E + +   L +    P Y    ++D   +++ 
Sbjct: 208 GY----KIDIWALGILLYTIINGTMPFDEDDPKKTELKIISASPDYDNKYFNDDSIDLVN 263

Query: 835 IMLNKDPIKRPNICQVL 885
            +L+KDP  RP I Q+L
Sbjct: 264 RLLSKDPSMRPTIEQIL 280

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 60/197 (30%), Positives = 103/197 (52%), Gaps = 5/197 (2%)
 Frame = +1

Query: 310 EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIK 489
           E +V++ +EYC    + D L +   HR+   E  ++ + +   V   H +    +HRD+K
Sbjct: 104 ETKVWMALEYCPGKELYDHLLS--LHRISLLECAELFAQISGAVYYAHSMH--CVHRDLK 159

Query: 490 IENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDK--YS 663
           +EN+L+ +NG+ K+ DFG     +   KT  E         +  T  Y +PE+I++  Y 
Sbjct: 160 LENILLDKNGNAKLTDFGFTRECM--TKTTLET--------VCGTTVYMAPELIERRTYD 209

Query: 664 GYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE-NAILNVKFQFPSYPQ--YSDHIRNIIT 834
           G+    K DIW+LGV LY L   + PF+ + E      +  + P+Y      D  +++I+
Sbjct: 210 GF----KIDIWSLGVILYTLITGSLPFDDDDEVKTKWKIVNEEPNYDSTLIPDDAKDLIS 265

Query: 835 IMLNKDPIKRPNICQVL 885
            +L K+P +RP++ QVL
Sbjct: 266 RLLAKNPKERPSLPQVL 282

>TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.406
           YHR102W
          Length = 975

 Score = 84.7 bits (208), Expect = 1e-15
 Identities = 72/270 (26%), Positives = 128/270 (47%), Gaps = 13/270 (4%)
 Frame = +1

Query: 211 LRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHR 390
           ++ E+  +  LK    I  Y  S+ + + L       +++MEYC+ G V   L      +
Sbjct: 85  IQREIQFLVSLKQVPNITRYYASYLKDTSL-------WIIMEYCAGGSVRTLLRPG---K 134

Query: 391 LQEFEILKIMSDVCQGVAAMHYLQPP-LIHRDIKIENVLISENGDYKICDFGSACSVLRP 567
           + E  I  IM ++   + A+HY+    +IHRDIK  N+LI+  G+ K+CDFG A  + + 
Sbjct: 135 IDEKYIAVIMREL---LVALHYIHKDNVIHRDIKAANLLITNEGNVKLCDFGVAAQLNQN 191

Query: 568 PKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPF- 744
               Q  A          T  + +PE+I    G   D K+DIW++G+  Y++     PF 
Sbjct: 192 TMRRQTMA---------GTPYWMAPEVI--MEGISYDTKADIWSVGITAYEIATGNPPFC 240

Query: 745 EKEGENAILNVKFQFPSYPQYSDH---IRNIITIMLNKDPIKRPNICQVLEQVSKLQGVP 915
           E E   A+  +    P+  +  +H   ++  I + L++DP +RP   ++L + + ++   
Sbjct: 241 EMEALRAMQVISKSKPARLEGKNHDPLLKEFIAMCLDEDPQERPTADKLLHESAFIKHYK 300

Query: 916 CP--------IENFMLTRIKLQNSRNNSNK 981
                     I  ++L R K  N+ N+S +
Sbjct: 301 NTHTSVLKELISRYLLFRDKYANAYNDSKE 330

 Score = 32.7 bits (73), Expect = 9.9
 Identities = 34/128 (26%), Positives = 57/128 (44%), Gaps = 6/128 (4%)
 Frame = +1

Query: 2782 TFSITMNPTTRISSVSRKSRYESDSSVYFSANSGSAFRRESVADSNIDKVESLGKNSSQY 2961
            T S T N  T I S +  S   S+ S   + N+       S+ +SN +  E +  +S+ +
Sbjct: 840  TTSTTTNNNTNILSNNNLSASNSNISGNVT-NTSLPILSPSLINSNNN--EPIMTSSNSF 896

Query: 2962 NNNSLQRMESVVENAPSETS------FKLNSSLPKMSSVTDNSQTVKETIDNNFTQRIGS 3123
             NN      +   N  ++ S      F++NSS    SS T NS T+++  +NN +     
Sbjct: 897  INNISSNTSTSNSNNNNDISGNNTNPFQINSSSTVTSSTTLNSATIEDAENNNVSHSGSK 956

Query: 3124 VVEYPLSR 3147
            ++  P  R
Sbjct: 957  MIMNPPPR 964

>NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24
          Length = 535

 Score = 83.6 bits (205), Expect = 2e-15
 Identities = 75/283 (26%), Positives = 135/283 (47%), Gaps = 6/283 (2%)
 Frame = +1

Query: 58  HQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSG-LNTLRAEVDAM 234
           H  I+++ +  G F  VY  R ID +  +     +  +K V + + +  L  L  E+  +
Sbjct: 20  HNYIVKECVGRGNFGDVY--RAIDRTTNK-----VVAIKVVDLENTNERLEVLAQEIFFL 72

Query: 235 KLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILK 414
             LK + YI++YI +  + + +       +++MEYC  G   D L     + L E ++  
Sbjct: 73  AELK-SPYIINYITTLLEDASM-------WIVMEYCGGGSCSDLLKYYFNNGLPEKKVAY 124

Query: 415 IMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAF 594
           I  ++ +G+  +H  +   IHRDIK  N+L++E G  K+ DFG          + Q  + 
Sbjct: 125 ITREILKGLQYLH--EQKKIHRDIKAANILLTEEGHVKLGDFG---------VSGQLKST 173

Query: 595 IHHDIMINTTAQYRSPEMIDK-YSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAIL 771
           +    ++  T  + +PE+  +   GY  DEK DIW+LG+ +++L     P  K     +L
Sbjct: 174 LRRGTIVG-TPYWMAPEVASQNIEGY--DEKIDIWSLGITVFELLKGVPPLVKLDPIRVL 230

Query: 772 NVKFQFPSYPQ----YSDHIRNIITIMLNKDPIKRPNICQVLE 888
                  S P+    YSD  ++ + + L K+P +RP    +L+
Sbjct: 231 -ANLSRKSAPRLQGAYSDAAKSFVALCLIKNPNERPAAVDLLK 272

>Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074 aa]
            {ON} YHR102W (REAL)
          Length = 1074

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 80/298 (26%), Positives = 133/298 (44%), Gaps = 19/298 (6%)
 Frame = +1

Query: 190  DKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFL 369
            D   +  ++ E+  +  LK    I  Y  S+ + + L       +++MEYC+ G +   L
Sbjct: 59   DSDEVEDVQREIQFLASLKQIHNITRYYGSYLKDTSL-------WIIMEYCAGGSLRSLL 111

Query: 370  NTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSA 549
                  ++ E  I  IM +V   +  +H  +  +IHRDIK  NVLI+  G+ K+CDFG A
Sbjct: 112  RPG---KIDEKYIGVIMREVLVALKCIH--KDNVIHRDIKAANVLITNEGNVKLCDFGVA 166

Query: 550  CSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCY 729
              V +     Q  A          T  + +PE+I    G   D K DIW+LG+  Y++  
Sbjct: 167  AQVNQTSLRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEIAT 215

Query: 730  YTTPF-EKEGENAI-LNVKFQFPSYP--QYSDHIRNIITIMLNKDPIKRPNICQVLEQ-- 891
               P+ E E   A+ L +K + P      YS  ++  I + L++DP +R +   +L+   
Sbjct: 216  GNPPYCEVEALRAMQLIIKSKPPRLEGRSYSPSLKEFIALCLDEDPKERLSADDLLKSKF 275

Query: 892  VSKLQGVPCPIENFMLTRIKLQNSRNNS-------------NKSTSLNDTTNNSFNNE 1026
            +   +  P  I   +++R  L   +N S             +K T   +T+  S  NE
Sbjct: 276  IKNHKTTPTSILKELISRYLLFRDKNKSMYRIEGSIPENELSKPTEAQNTSQTSGGNE 333

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 75/294 (25%), Positives = 133/294 (45%), Gaps = 6/294 (2%)
 Frame = +1

Query: 91  GGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSY 270
           GGFA+ + ++        +++G     K  IV  KS    ++ E    KLL   +   + 
Sbjct: 102 GGFARCFHIK--------DDVGISFACK--IVSKKS----IKTERTKFKLLSEIQIHQNL 147

Query: 271 IDSHAQR-SELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAA 447
             SH  +  +  + E  V++L+E C  G ++D L  R    L E E+  + + VC  +  
Sbjct: 148 RYSHIVKFMDCFEDELNVYILLELCPNGSLMDLLKKRKI--LTEAEVKFMTTQVCGAINY 205

Query: 448 MHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTA 627
           MH     +IHRD+K+ NV   +N + KI DFG A ++    +                T 
Sbjct: 206 MH--SNNIIHRDLKLGNVFFDKNFNIKIGDFGLAATLSNVSEKKYTMC---------GTP 254

Query: 628 QYRSPEMI-DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILN----VKFQFP 792
            Y +PE+I  K  G+  +  +DIW+LG+ +Y +     PF+ +    I       +++FP
Sbjct: 255 NYIAPEVILSKQIGHSFE--ADIWSLGIMIYAMVLGKPPFQAKDVTTIYEKIKLCQYEFP 312

Query: 793 SYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSKLQGVPCPIENFMLTRIKL 954
                ++ ++ +I  +L  DP +RP I  +L+        P  + + + T + L
Sbjct: 313 PDKYITNDVKVLIQDLLVLDPSQRPRIMDILKYNWFKHSFPPKLPSTIFTEVPL 366

>YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}
           TOS3Protein kinase, related to and functionally
           redundant with Elm1p and Sak1p for the phosphorylation
           and activation of Snf1p; functionally orthologous to
           LKB1, a mammalian kinase associated with Peutz-Jeghers
           cancer-susceptibility syndrome
          Length = 560

 Score = 83.2 bits (204), Expect = 2e-15
 Identities = 65/216 (30%), Positives = 102/216 (47%), Gaps = 27/216 (12%)
 Frame = +1

Query: 316 EVFLLMEYCSRGGVIDFLNTRLYHRLQEFEIL------KIMSDVCQGVAAMHYLQPPLIH 477
           +V+L++EYCSRG V      ++  +     IL      K++ DV  G+  +H     + H
Sbjct: 130 KVYLVLEYCSRGPVKWCPENKMEIKAVGPSILTFQQSRKVVLDVVSGLEYLH--SQGITH 187

Query: 478 RDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINT----TAQYRSPE 645
           RDIK  N+LIS NG  KI DFG A S        Q +    H+ ++ +    T  + +PE
Sbjct: 188 RDIKPSNLLISSNGTVKISDFGVAMSTATGSTNIQSS----HEQLLKSRALGTPAFFAPE 243

Query: 646 MIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEK----EGENAILNVKFQFPSY----- 798
           +      Y      DIW+LGV +Y L +   PF      E  ++I+N   +FPSY     
Sbjct: 244 LCSTEKEYSCSSAIDIWSLGVTIYCLLFGKLPFNANSGLELFDSIINKPLEFPSYEEMLN 303

Query: 799 --------PQYSDHIRNIITIMLNKDPIKRPNICQV 882
                    +Y+D  ++++  +L KDP KR  +  +
Sbjct: 304 GATSGITMEEYTD-AKDLLKKLLQKDPDKRIKLADI 338

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
           (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score = 83.6 bits (205), Expect = 2e-15
 Identities = 68/275 (24%), Positives = 131/275 (47%), Gaps = 6/275 (2%)
 Frame = +1

Query: 79  YLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKY 258
           +L  GGFA+ + ++  D      ++     + ++ +  +   N L +E+   K ++ ++ 
Sbjct: 103 FLGEGGFARCFQMKDDDG-----KVFAAKTVAKISIKSEKARNKLLSEIQIHKNMR-HQN 156

Query: 259 IVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQG 438
           IV +ID         + +  V++L+E C  G ++D L  R    L E E+    + +C  
Sbjct: 157 IVHFIDCF-------EDDINVYILLEICPNGSLMDLLKRRKI--LTEPEVRFFTTQICGA 207

Query: 439 VAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMIN 618
           +  MH     +IHRD+K+ N+   ++ + KI DFG A  +        E  +      I 
Sbjct: 208 LDHMHSRN--IIHRDLKLGNIFFDKDFNLKIGDFGLAAII----NNENERKY-----TIC 256

Query: 619 TTAQYRSPEMI--DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAIL----NVK 780
            T  Y +PE+I   K  G+  +   DIW+LGV ++ +     PF+ +  + I     +  
Sbjct: 257 GTPNYIAPEVIMGGKQIGHSFE--VDIWSLGVMIFAMITGKPPFQAKEVSTIYDRIKHCN 314

Query: 781 FQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVL 885
           + FP+    S  ++ +I  +L+ +P++RP I ++L
Sbjct: 315 YSFPTDKYVSKDVKKLIQDILSMNPMERPTIQEIL 349

>CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31 or
            uniprot|Q08217 Saccharomyces cerevisiae YOL045w
          Length = 1206

 Score = 84.0 bits (206), Expect = 2e-15
 Identities = 57/169 (33%), Positives = 83/169 (49%), Gaps = 1/169 (0%)
 Frame = +1

Query: 391  LQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPP 570
            + EFE   I   +  G+  +H     ++HRDIK ENV++   G  K+ DFGSA  V   P
Sbjct: 1052 MTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKGFVKLIDFGSAAYVKSGP 1109

Query: 571  KTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKS-DIWALGVFLYKLCYYTTPFE 747
                       D+ +  T  Y +PE++    G P + KS DIWA+G+ LY L Y   PF 
Sbjct: 1110 ----------FDVFVG-TIDYAAPEVL---GGNPYEGKSQDIWAIGILLYTLIYKENPFY 1155

Query: 748  KEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 894
               E  IL  + +F      S   + +IT +LN+   KRP I ++ + V
Sbjct: 1156 NIDE--ILEGELRFNDSADVSQECKALITKILNRCVRKRPTIDEICQDV 1202

>TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.668
           YPL150W
          Length = 871

 Score = 83.6 bits (205), Expect = 3e-15
 Identities = 70/237 (29%), Positives = 113/237 (47%), Gaps = 11/237 (4%)
 Frame = +1

Query: 310 EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIK 489
           E +V++ +EYC    + D+L   +  R+   E  ++ + +   V   H L    +HRD+K
Sbjct: 100 ETKVWMSLEYCPGKELYDYL--LVMRRIPLDECSRLFAQIVGAVYYAHSLN--CVHRDLK 155

Query: 490 IENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYS 663
           +EN+L+   G+ K+ DFG            +E A  +    I  T  Y +PE++  D Y 
Sbjct: 156 LENILLDMQGNAKLADFGFT----------RECATKNQLETICGTTVYMAPELLRRDTYD 205

Query: 664 GYPIDEKSDIWALGVFLYKLCYYTTPFEKEGEN----AILNVKFQFPSYPQYSDHIRN-- 825
           G+    K DIW+LGV LY L   + PF++E E      I+N +      P Y++ I N  
Sbjct: 206 GF----KIDIWSLGVILYTLINGSMPFDEEDETRTEWKIINEE------PDYNEKIFNAN 255

Query: 826 ---IITIMLNKDPIKRPNICQVLEQVSKLQGVPCPIENFMLTRIKLQNSRNNSNKST 987
              +I  +L KDP KRP++ ++L+           +E      +K +NS  N N  T
Sbjct: 256 SIELIKSLLIKDPKKRPSMTEILKHKFLEPYGESILEEADKILLKQRNSMLNFNTKT 312

>KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 878

 Score = 83.6 bits (205), Expect = 3e-15
 Identities = 74/266 (27%), Positives = 129/266 (48%), Gaps = 6/266 (2%)
 Frame = +1

Query: 211 LRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHR 390
           ++ EV  +  LK    I  Y  S+   +EL       +++MEYC+ G +   L      +
Sbjct: 62  VQKEVQFLSSLKQVPNITHYYGSYLNNTEL-------WVIMEYCAGGSLRTLLRPG---K 111

Query: 391 LQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPP 570
           + E  I  IM ++   +A MH  +  +IHRDIK  NVLI+ +G  K+CDFG A  + +  
Sbjct: 112 IGEQYIGVIMRELL--IALMHIHKDGVIHRDIKAANVLITNDGHIKLCDFGVAAQLSQTK 169

Query: 571 KTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPF-E 747
              Q  A          T  + +PE+I    G   D K DIW+LG+  Y++     P+ +
Sbjct: 170 IRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCD 218

Query: 748 KEGENAI-LNVKFQFPSYP--QYSDHIRNIITIMLNKDPIKRPNICQVLEQ--VSKLQGV 912
            E   A+ L  K + P     Q+S  ++  I + L++DP +RP+  ++L+   +   + V
Sbjct: 219 VEALRAMQLITKSKPPRLEGRQHSSALKEFIALCLDEDPKERPSAEELLKTKFIRLHKNV 278

Query: 913 PCPIENFMLTRIKLQNSRNNSNKSTS 990
              I   +++R  L   +++  +S++
Sbjct: 279 SASILKELISRYLLHRDKHSRRESST 304

>TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {ON}
            Anc_5.406 YHR102W
          Length = 996

 Score = 83.2 bits (204), Expect = 4e-15
 Identities = 77/297 (25%), Positives = 135/297 (45%), Gaps = 22/297 (7%)
 Frame = +1

Query: 190  DKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFL 369
            D + +  ++ E+  + LL+    I  Y  S+    +       ++++MEYC+ G V + +
Sbjct: 42   DINEIQDIQNEIKFLSLLRYAPNITYYYHSYLINRK-------IWIIMEYCNGGSVRNLI 94

Query: 370  NTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSA 549
                  R  E  I  I+ ++   +  +H+    +IHRDIK  N+LI++NG  K+CDFG A
Sbjct: 95   KIG---RFNEIYISVILRELLYALEYIHH--DNIIHRDIKAANILINQNGGIKLCDFGIA 149

Query: 550  CSV-LRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLC 726
              +    PK    A           T  + +PE+I + S Y  D K+DIW++G+  Y++ 
Sbjct: 150  AKLEFSKPKRQTMAG----------TPYWMAPEVIIESSLY--DTKADIWSVGITAYEIT 197

Query: 727  YYTTPF-EKEGENAI-LNVKFQFPSY--PQYSDHIRNIITIMLNKDPIKRPNICQVLEQ- 891
                P+ E +   A+ L  K + P      YS  ++  I + L++DP +R    ++LE  
Sbjct: 198  TGNPPYCEYDATKAMQLITKLKPPRLEGKMYSKSLKEFIALCLDEDPSERLTSTKLLETE 257

Query: 892  -VSKLQGVPCPIENFMLTRI---------------KLQNSRNNSNKSTSLNDTTNNS 1014
             + + Q  P  I   ++++                K  NS +NS +    N    NS
Sbjct: 258  FIKEYQETPTKILIDLISKYNELIGREKELNPLTKKQSNSSSNSKEKYIENKILENS 314

>TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5.406
            YHR102W
          Length = 1036

 Score = 83.2 bits (204), Expect = 4e-15
 Identities = 75/309 (24%), Positives = 142/309 (45%), Gaps = 6/309 (1%)
 Frame = +1

Query: 103  QVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSH 282
            QVY+++V++  +  +E+                   ++ EV  +  LK    I+ Y  S+
Sbjct: 70   QVYAIKVLNLDSESDEV-----------------EDVQREVQFLSSLKQFPNIIRYFGSY 112

Query: 283  AQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQ 462
             + + L       +++M+YC+ G +   L      ++ E  I  IM ++   +  +H  +
Sbjct: 113  LKDTNL-------WIIMDYCAGGSIRTLLRPG---KIDEKYIGIIMREILIALQYIH--K 160

Query: 463  PPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSP 642
              +IHRDIK  NVL++  G  K+CDFG A  + +     Q  A          T  + +P
Sbjct: 161  DNVIHRDIKAANVLVTNEGKVKLCDFGVAAQLNQTKLRRQTMA---------GTPYWMAP 211

Query: 643  EMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPF-EKEGENAILNVKFQFPSYPQ---YS 810
            E+I + + Y  D K+DIW+LG+  Y++     P+ E E   A+  +    P+  +   YS
Sbjct: 212  EVIMEGAYY--DTKADIWSLGITAYEIATGNPPYCEIEALRAMQLITKSKPARLEGRSYS 269

Query: 811  DHIRNIITIMLNKDPIKRPNI--CQVLEQVSKLQGVPCPIENFMLTRIKLQNSRNNSNKS 984
              ++  I + L++DP +R +    Q  + +   + VP  I   +++R  L   ++   + 
Sbjct: 270  TSLKEFIALCLDEDPKERLSAEELQKTKFIKSQRAVPTTILKELISRYLLFRDKHTPREH 329

Query: 985  TSLNDTTNN 1011
            +  +D  NN
Sbjct: 330  SYADDLGNN 338

>TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1237

 Score = 83.2 bits (204), Expect = 4e-15
 Identities = 60/184 (32%), Positives = 88/184 (47%), Gaps = 3/184 (1%)
 Frame = +1

Query: 352  GVIDFLNT-RLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYK 528
            G ID  +   L   + EFE   I   V  G+  +H  +  ++HRDIK ENV++   G  K
Sbjct: 1069 GSIDLFDLIELKTNMTEFEAKLIFKQVISGIKHLH--EQGIVHRDIKDENVIVDSKGFVK 1126

Query: 529  ICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYSGYPIDEKSDIWAL 702
            + DFGSA  V   P           D+ +  T  Y +PE++  + Y G P     DIWA+
Sbjct: 1127 LIDFGSAAYVKSGP----------FDVFVG-TIDYAAPEVLGGEPYEGKP----QDIWAV 1171

Query: 703  GVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQV 882
            G+ LY + +   PF    E     +KF   S  + S+   N+I  +LNK+  KRP I  +
Sbjct: 1172 GILLYTIVFKENPFYNIDEIMEGTLKFSIGS--EVSEECVNLIKKILNKNAPKRPTIQDI 1229

Query: 883  LEQV 894
             + V
Sbjct: 1230 YDDV 1233

>KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {ON}
            Anc_8.140 YGL179C
          Length = 518

 Score = 82.0 bits (201), Expect = 4e-15
 Identities = 82/335 (24%), Positives = 151/335 (45%), Gaps = 36/335 (10%)
 Frame = +1

Query: 115  VRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRS 294
            ++++++    NELG     K  +  +     T+  ++   K+L  N+  +    ++   +
Sbjct: 20   IQILNNYEVNNELGVGTHSKVKLGKNLFSNQTIALKI-VNKVLPNNEIKILRKINNQHNN 78

Query: 295  ELKQGEY-------EVFLLMEYCSRGGVIDFLNTRLYHRLQ-----EFEILK-IMSDVCQ 435
             +K  E        +++L++EYC  G ++ + N    +         F+  K I+ D+  
Sbjct: 79   LIKLFEILNDHHSKKIYLVLEYCPLGEIVWYPNVTTANNSIGPGQFSFQRCKEILKDITS 138

Query: 436  GVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMI 615
            G++ +H L   +IHRDIK  N+LIS++G  KI DF  +  +        E   ++   M 
Sbjct: 139  GLSYLHCLN--IIHRDIKPSNLLISDDGTIKISDFSISMIL------DYETVNLNDIYMT 190

Query: 616  NTTAQYRSPEM----IDKYSGYPIDEKS-------DIWALGVFLYKLCYYTTPFEKEGE- 759
              T  + SPE+     + YS + I+ ++       D W+LGV LY L +   PF  + E 
Sbjct: 191  VGTPLFFSPEICLGCTEFYSKFKINVRNNDIFYMIDTWSLGVTLYCLIFGKLPFNSKHEL 250

Query: 760  ---NAILNVKFQFPSY--------PQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSKLQ 906
               N I+N   QFP++         +  +  +N+++ +L K+P+KR N  Q+L       
Sbjct: 251  ELFNIIINDDLQFPTFNTCYNLSTMKEYELSKNLLSNLLTKNPLKRFNTEQILLHPFLTD 310

Query: 907  GVPCPIENFMLTRIKLQNSRNNSNKSTSLNDTTNN 1011
                 I+   L    ++      N  T+  +TTNN
Sbjct: 311  TTSLSIQPPQLCITDIEQINGTFNNYTTNANTTNN 345

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score = 82.8 bits (203), Expect = 4e-15
 Identities = 61/201 (30%), Positives = 106/201 (52%), Gaps = 8/201 (3%)
 Frame = +1

Query: 310 EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIK 489
           E  V++ +EYC    + ++L  + +  L+E    ++ S +   V   H ++   +HRD+K
Sbjct: 100 ENYVWMALEYCPGKELYEYLLAKKHIPLEECS--ELFSQIVGAVYYAHSMK--CVHRDLK 155

Query: 490 IENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDK--YS 663
           +EN+L+ + G  K+ DFG            +E A       I  T  Y +PE+I++  Y 
Sbjct: 156 LENILLDKKGHAKLTDFGFT----------RECATKGILETICGTTVYMAPELIERKPYE 205

Query: 664 GYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILNVKFQFPSY-PQY-SDHI----RN 825
           GY    K D W+LG+ LY + + T PF++  E   +  K++   Y P Y +D+I    + 
Sbjct: 206 GY----KIDTWSLGIILYTMIHGTMPFDEVDE---VKTKYKIVHYNPTYDNDYIDSNGKE 258

Query: 826 IITIMLNKDPIKRPNICQVLE 888
           +I+ +L KDP +RP++ QVL+
Sbjct: 259 LISQLLEKDPNQRPSLTQVLQ 279

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score = 82.8 bits (203), Expect = 5e-15
 Identities = 81/298 (27%), Positives = 136/298 (45%), Gaps = 10/298 (3%)
 Frame = +1

Query: 22  KYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIV---PD 192
           ++    +  +G ++  I+K +  G F +VY             L T    K+ +V    D
Sbjct: 30  QFSSSELTEVGNYK--IQKQIGEGSFGKVY-------------LATHRPTKQKVVLKTGD 74

Query: 193 KSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLN 372
           KS  N +R      ++    ++   YI    +  E+   E +V++ +EYC    + D L 
Sbjct: 75  KSDPNVVR------EVFYHRQFDYPYI---TKLYEVIVTETKVWMALEYCPGKELYDHLL 125

Query: 373 TRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSAC 552
           ++   RL   E  ++ + +   V   H L    +HRD+K+ENVL+ +NG+ K+ DFG   
Sbjct: 126 SK--SRLPTLECAELFAQITGAVHYAHTLN--CVHRDLKLENVLLDKNGNAKLTDFGF-- 179

Query: 553 SVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMID--KYSGYPIDEKSDIWALGVFLYKLC 726
                  T +       + +  TT  Y +PEMI    Y G+    K DIW+LGV LY L 
Sbjct: 180 -------TRESMTKAVLETVCGTTV-YMAPEMIQHKPYDGF----KVDIWSLGVILYTLL 227

Query: 727 YYTTPFEKEGENAILNVKFQFPSYPQYSDHI-----RNIITIMLNKDPIKRPNICQVL 885
               PF+++ +  +L  +      P   + I     +N+I  +L+KDP +RPN   +L
Sbjct: 228 CGCLPFDEDDD--LLTKQKIINDTPVIDERITIPEAQNLIEQLLSKDPTERPNTSAIL 283

>TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]
           {ON} Anc_3.92 YDR490C
          Length = 1347

 Score = 82.8 bits (203), Expect = 6e-15
 Identities = 59/202 (29%), Positives = 103/202 (50%), Gaps = 9/202 (4%)
 Frame = +1

Query: 304 QGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPP-LIHR 480
           Q E  ++ L+EY S G ++  L      +   F+    +    Q + ++HY+    +IHR
Sbjct: 329 QDEANLYFLLEYASNGDLLTLLK-----KYGSFDETSTIYFTAQIIDSIHYIHSMGIIHR 383

Query: 481 DIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINT-----TAQYRSPE 645
           DIK EN+L++++   K+ DFG+A  +L P +  Q  +  H +++  +     TA+Y SPE
Sbjct: 384 DIKPENILLTKDFKIKLTDFGTA-KILDPSQPSQSQSQPHFNLLERSKSFVGTAEYVSPE 442

Query: 646 MI-DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILN--VKFQFPSYPQYSDH 816
           ++ D Y+    D + DIWA G  L++L     PF+   E       +K Q+     +   
Sbjct: 443 LLTDSYT----DSRCDIWAFGCILFQLIAGKPPFKATNEYLTFQKIIKLQYAFTAGFPTI 498

Query: 817 IRNIITIMLNKDPIKRPNICQV 882
           +R++I  +L K+P  R  I Q+
Sbjct: 499 LRDLIKKILIKNPNNRLTIHQI 520

>CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON}
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102w NRK1 ser/thr protein kinase
          Length = 1072

 Score = 82.4 bits (202), Expect = 7e-15
 Identities = 75/302 (24%), Positives = 140/302 (46%), Gaps = 6/302 (1%)
 Frame = +1

Query: 103 QVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSH 282
           QVY+++V++  ++ +E+                   ++ E+  +  LK    I  Y  S+
Sbjct: 40  QVYAIKVLNLDSSEDEV-----------------EDVQREIQFLASLKQIPNITRYYGSY 82

Query: 283 AQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQ 462
            + + L       +++MEYC+ G +   L      ++ E  I  IM ++   +  +H  +
Sbjct: 83  LRGTSL-------WIIMEYCAGGSLRSLLRPG---KIDEKYIGVIMRELLVALKVIH--K 130

Query: 463 PPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSP 642
             +IHRDIK  NVLI+  G  K+CDFG A  + +     Q  A          T  + +P
Sbjct: 131 DNVIHRDIKAANVLITNEGQVKLCDFGVAAQLNQTSLRRQTMA---------GTPYWMAP 181

Query: 643 EMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPF-EKEGENAI-LNVKFQFPSYPQ--YS 810
           E+I    G   D K DIW+LG+  Y++     P+ + E   A+ L +K + P   +  Y+
Sbjct: 182 EVI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCDVEALRAMQLIIKSKPPRLEERNYT 239

Query: 811 DHIRNIITIMLNKDPIKRPNICQVLEQ--VSKLQGVPCPIENFMLTRIKLQNSRNNSNKS 984
             ++  I + L++DP +R +  ++L+   +   +  P  I   +++R  L   +N S K 
Sbjct: 240 PQLKEFIALCLDEDPQERLSAEELLKTKFIKTHKATPTTILKELISRYLLFRDKNKSYKD 299

Query: 985 TS 990
           ++
Sbjct: 300 SA 301

>KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7.86
            YAL017W
          Length = 1440

 Score = 82.4 bits (202), Expect = 8e-15
 Identities = 57/177 (32%), Positives = 85/177 (48%), Gaps = 3/177 (1%)
 Frame = +1

Query: 352  GVIDFLNT-RLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYK 528
            G ID  +   L + + E E+  I   +  G+  +H     +IHRDIK ENV++   G  K
Sbjct: 1272 GCIDLFDLIELKNNMTEMEVKLIFKQIVSGIKHLH--DQAIIHRDIKDENVIVDATGFVK 1329

Query: 529  ICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYSGYPIDEKSDIWAL 702
            + DFGSA  V   P           D+ +  T  Y +PE++  D Y G P     DIWA+
Sbjct: 1330 LIDFGSAAHVKSGP----------FDVFVG-TIDYAAPEVLSGDPYEGKP----QDIWAI 1374

Query: 703  GVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNI 873
            G+ LY + +   PF    E  IL  +  F      S   + +I+++LN++  KRP I
Sbjct: 1375 GILLYTIVFKENPFYNIDE--ILEGELTFSESSDVSAECKALISMILNRNVQKRPTI 1429

>KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON} 
          Length = 649

 Score = 81.6 bits (200), Expect = 8e-15
 Identities = 67/259 (25%), Positives = 115/259 (44%), Gaps = 21/259 (8%)
 Frame = +1

Query: 172 KRVIVPDKSGLNTLRAEVDAMKLL--KGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCS 345
           K+V  P+K     +  E++  K++    + +IV+  D+     E       ++++++YCS
Sbjct: 70  KKVHCPNKENKRKIIKELEIYKVICRSHHNHIVALRDAFQWGKESC-----IYMILDYCS 124

Query: 346 RGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDY 525
              +   L  R    L E E  ++M  +C G+  +H     +IH D+K+ N+L  E    
Sbjct: 125 NNSLQSILQYR--GSLNEVECKELMIQLCGGIYWLHLNN--VIHGDLKLSNILFDEGQQL 180

Query: 526 KICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYP--------IDE 681
           KICDFGS+      P+ P E         I  T  Y +PE +  +            I  
Sbjct: 181 KICDFGSSFIATSSPRGPGE---------IMGTPYYLAPETVYTHKNINKSGMAILLISF 231

Query: 682 KSDIWALGVFLYKLCYYTTPFEK---EGENAILNVKFQ--------FPSYPQYSDHIRNI 828
             DIW++G+ LY L Y   PF K   E  N  L+   Q        FP+        + +
Sbjct: 232 PIDIWSMGIVLYSLLYGINPFIKSVDELHNVSLDELMQRITSGVIEFPTNKAVGAGAQQL 291

Query: 829 ITIMLNKDPIKRPNICQVL 885
           I  ML+++P++R  + +++
Sbjct: 292 ILKMLSQNPLERITLVEIV 310

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score = 82.0 bits (201), Expect = 8e-15
 Identities = 60/197 (30%), Positives = 100/197 (50%), Gaps = 5/197 (2%)
 Frame = +1

Query: 310 EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIK 489
           E +V++ +EYC    + + L   + HR+   E  K+ + +   V   H L    +HRD+K
Sbjct: 100 ETKVWMALEYCPGRELYEHL--LMLHRIPLDECAKLFAQIVSAVHYAHSLN--CVHRDLK 155

Query: 490 IENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDK--YS 663
           +EN+L+ +NG+ K+ DFG     +   K+  E         I  T  Y +PE+I +  Y 
Sbjct: 156 LENILLDKNGNAKLTDFGFTRECV--SKSSLET--------ICGTTVYMAPELIQRQAYD 205

Query: 664 GYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAI-LNVKFQFPSYPQ--YSDHIRNIIT 834
           G+    K DIW+LGV LY +   T PF+++ E      +   FP++     S   +++I 
Sbjct: 206 GF----KIDIWSLGVILYTMINGTMPFDEDDETKTKWKIVNDFPNFNDNFVSHEAKDLIK 261

Query: 835 IMLNKDPIKRPNICQVL 885
            +L K P +RP + Q+L
Sbjct: 262 RLLAKCPSERPTMEQIL 278

>TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.591
           YDR466W
          Length = 694

 Score = 81.3 bits (199), Expect = 1e-14
 Identities = 72/284 (25%), Positives = 128/284 (45%), Gaps = 9/284 (3%)
 Frame = +1

Query: 58  HQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMK 237
           H  + ++ L  G ++ VY  + +D +NA        C K+ I+ +K  +  +  E + + 
Sbjct: 10  HDFVFKQELGHGSYSTVY--KAVDRTNANRVYAIKVCSKQHIIKEKK-VKYVTIEKNTLN 66

Query: 238 LLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKI 417
           LL   ++    +  H    +    E  ++ +++Y   G ++  L     HR++ F  +  
Sbjct: 67  LLTRARH-PGIVKLHYTFHD----EENLYFVLDYAPGGELLSLL-----HRMKTFSEMWA 116

Query: 418 MSDVCQGVAAMHYLQPP-LIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAF 594
               CQ + +M +L    +IHRD+K EN+L++  G   I DFG+A          + ++F
Sbjct: 117 CHFTCQLIDSMQFLHSQGIIHRDLKPENLLLNNEGRLMITDFGTATGT-----DSRGSSF 171

Query: 595 IHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAIL- 771
           +        TA+Y SPE++        D  SDIWALG  +Y+    + PF  E E     
Sbjct: 172 V-------GTAEYVSPELL---LHNQCDVSSDIWALGCMIYQFLQGSPPFRGENELQTFE 221

Query: 772 -NVKFQFP-SYPQYSDHIRNIITIMLNK-----DPIKRPNICQV 882
             V   +P + PQ +    N + + L +     DP  RP + Q+
Sbjct: 222 KTVSLDYPWNNPQVTPKGINPVVVDLTRRILVLDPSVRPTLQQI 265

>Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}
           YGL179C (REAL)
          Length = 563

 Score = 80.9 bits (198), Expect = 1e-14
 Identities = 69/215 (32%), Positives = 102/215 (47%), Gaps = 26/215 (12%)
 Frame = +1

Query: 316 EVFLLMEYCSRGGVIDFLNTRLYHRLQEFEIL------KIMSDVCQGVAAMHYLQPPLIH 477
           +V+L++EYCSRG V      ++  +     IL      KI+SDV  G+  +H     + H
Sbjct: 130 KVYLVLEYCSRGPVRWCPENQMEIKAVGPSILTFEQSRKILSDVVSGLEHLH--SRGITH 187

Query: 478 RDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINT---TAQYRSPEM 648
           RDIK  N+LIS NG  KI DFG A          Q +   H  I+ +    T  + +PE+
Sbjct: 188 RDIKPSNLLISSNGTVKISDFGVAILSTTGSTNIQSS---HEQILKSKTLGTPAFLAPEL 244

Query: 649 IDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEK----EGENAILNVKFQFPSY------ 798
               S +      DIW+LGV LY L + T PF      E  + I+N   + PSY      
Sbjct: 245 CSTDSEHCCTFAIDIWSLGVTLYCLLFGTLPFNANSVLELFDKIINKSLEVPSYEEMLNR 304

Query: 799 -------PQYSDHIRNIITIMLNKDPIKRPNICQV 882
                   +YSD  +N++  +L K+P KR  + ++
Sbjct: 305 GTSDITIEEYSD-AKNLLYKLLQKNPDKRIALAEI 338

>CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]
           {ON} similar to uniprot|P38990 Saccharomyces cerevisiae
           YER129w Serine/threonine-protein kinase
          Length = 1162

 Score = 81.6 bits (200), Expect = 1e-14
 Identities = 81/271 (29%), Positives = 124/271 (45%), Gaps = 39/271 (14%)
 Frame = +1

Query: 187 PDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI-- 360
           P K+  + ++ E+  MK    +K++V  I+      +LK  +  ++L++EYCSRG V   
Sbjct: 188 PGKTENDKIKREIAIMKKCH-HKHVVKLIEV---LDDLKSRK--IYLVLEYCSRGEVKWC 241

Query: 361 --DFLNTRLYHRLQ-EFEILK-IMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYK 528
             D L T         F+  + I+  V  G+  +HY    +IHRDIK  N+L+SE G  K
Sbjct: 242 PPDCLETEAKGPSPLSFQFTREILRGVVLGLEYLHY--QGIIHRDIKPANLLLSETGIVK 299

Query: 529 ICDFGSACSV--------------LRPPKTPQEAAFIHHDIMINTTA-QYRSPEMIDKYS 663
           I DFG + +               L   KT    AF   +I +   A +    +  + + 
Sbjct: 300 ISDFGVSLAASSSNVDGSDETIDELELAKTAGTPAFFAPEICLGEDAFEKYQLDREELFK 359

Query: 664 GYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILNVKFQFP-SYPQYSDHIRN----- 825
           G  I  K DIWALGV LY L +   PF    E  +       P  +P+YSD ++N     
Sbjct: 360 GSCISFKIDIWALGVTLYCLVFGMLPFVSSFELELFEKIVNDPVKFPKYSDMLKNNQVLQ 419

Query: 826 ------------IITIMLNKDPIKRPNICQV 882
                       ++T +L K+PIKR NI ++
Sbjct: 420 MTEEAEYEAAKDLLTRLLEKNPIKRINIEEI 450

>ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1204

 Score = 81.6 bits (200), Expect = 1e-14
 Identities = 62/213 (29%), Positives = 111/213 (52%), Gaps = 2/213 (0%)
 Frame = +1

Query: 322 FLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENV 501
           ++L EY S G ++D++    +  L+E    K    +   +  +H     ++HRD+KIEN+
Sbjct: 240 YMLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGIASALQYLHANN--IVHRDLKIENI 295

Query: 502 LISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDE 681
           +IS +G+ KI DFG   S +  P+T      +H       +  + +PE++ K S Y +  
Sbjct: 296 MISTSGEIKIIDFG--LSNMFDPRTQ-----LH---TFCGSLYFAAPELL-KASPY-VGP 343

Query: 682 KSDIWALGVFLYKLCYYTTPFEKEGENAI-LNVKFQFPSYPQY-SDHIRNIITIMLNKDP 855
           + D+W+ GV LY L     PF+ E  + +   +K     YPQ+ S  + ++++ ML  DP
Sbjct: 344 EVDVWSFGVVLYVLVCGKVPFDDENSSVLHEKIKQGKVDYPQHLSIEVISLLSKMLVVDP 403

Query: 856 IKRPNICQVLEQVSKLQGVPCPIENFMLTRIKL 954
            KR ++ QV+E    ++G   P  +++  RI +
Sbjct: 404 RKRASLKQVVEHHWMIRGYDFPAPSYVPNRIPM 436

>AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL209C
           (IPL1)
          Length = 367

 Score = 79.3 bits (194), Expect = 1e-14
 Identities = 81/270 (30%), Positives = 118/270 (43%), Gaps = 8/270 (2%)
 Frame = +1

Query: 70  IEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNT---LRAEVDAMKL 240
           I K L  G F +VY VR I+S       G +  LK +   D    N     R EV+    
Sbjct: 111 IGKVLGKGKFGRVYCVRHIES-------GFVCALKAMEKKDIIQYNIEKQFRREVEIQSS 163

Query: 241 LKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIM 420
           L+       Y   H ++         V+LLMEY   G +   L  R +     F  +   
Sbjct: 164 LRHPNLTQLYGYFHDEK--------RVYLLMEYLVNGELYKHLKGRSH-----FNDVVAS 210

Query: 421 SDVCQGVAAMHYL-QPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFI 597
             V Q   A+ Y+ +  ++HRDIK EN++I  N   K+ DFG   SV+ P  + ++    
Sbjct: 211 YYVYQMADALDYMHERNILHRDIKPENIIIGFNNTIKLTDFG--WSVITPKGSKRKT--- 265

Query: 598 HHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE----NA 765
                +  T  Y SPE+I        +EK D+WALGV  Y+L   + PFE+E +      
Sbjct: 266 -----LCGTVDYLSPELIRSRE---YNEKVDVWALGVLTYELLVGSPPFEEESKELTYKR 317

Query: 766 ILNVKFQFPSYPQYSDHIRNIITIMLNKDP 855
           IL     FP +       R++I+ +L  DP
Sbjct: 318 ILKRNLIFPDH--VDTEARHLISRLLEYDP 345

>KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1381

 Score = 81.6 bits (200), Expect = 1e-14
 Identities = 67/228 (29%), Positives = 101/228 (44%), Gaps = 4/228 (1%)
 Frame = +1

Query: 202  LNTLRAEVDAMKLL--KGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNT 375
            L T+ +E+  M  L  K ++ I+  +D        +  EY       +   G +  F   
Sbjct: 1168 LGTIPSEIQIMATLNKKPHENILRLLDF------FEDDEYYYIETPVHGETGSIDLFDLI 1221

Query: 376  RLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACS 555
                 + EFEI  +   V  GV  +H     ++HRDIK EN+++   G  KI DFGSA  
Sbjct: 1222 EFTSNMTEFEIKLLFKQVVSGVKHLH--DQGIVHRDIKDENIIVDNKGFIKIIDFGSAAY 1279

Query: 556  VLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYSGYPIDEKSDIWALGVFLYKLCY 729
            V   P           D+ +  T  Y +PE++  + Y G P     DIWALG+ LY + +
Sbjct: 1280 VKSGP----------FDVFVG-TIDYAAPEVLGGNPYEGKP----QDIWALGILLYTIVF 1324

Query: 730  YTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNI 873
               PF    E    ++KF  P     S     +I ++LN++  KRP I
Sbjct: 1325 KENPFYNIDEILEGDLKFNDPE--NISQDCIELIKLILNRNVFKRPTI 1370

>NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141
          Length = 349

 Score = 79.0 bits (193), Expect = 1e-14
 Identities = 87/307 (28%), Positives = 132/307 (42%), Gaps = 17/307 (5%)
 Frame = +1

Query: 19  PKYEKGRVL------PIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 180
           P  + GR+L      P+      I K L  G F +VY VR         E G +  LK  
Sbjct: 70  PAKKYGRMLNVSPPKPLSLDDFEIGKKLGKGKFGKVYCVR-------HKETGFICALK-- 120

Query: 181 IVPDKSGL------NTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYC 342
            V DK+ +         R EV+    L        Y   H ++         V+LLMEY 
Sbjct: 121 -VMDKAEIVQYNLQKQFRREVEIQTSLNHPNLTKLYGHFHDEK--------RVYLLMEYL 171

Query: 343 SRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPP-LIHRDIKIENVLISENG 519
             G +   L +        F  +     V Q   A++YL    +IHRD+K EN+LI  N 
Sbjct: 172 VYGELYKLLRSH-----GPFNDVIASRFVFQIADALNYLHDKQIIHRDLKPENILIGFNN 226

Query: 520 DYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWA 699
             K+ DFG   S++ P    ++         +  T  Y SPEMI        D+K D+WA
Sbjct: 227 VIKLTDFG--WSIINPRGVKRKT--------LCGTIDYLSPEMIRSRE---YDDKVDVWA 273

Query: 700 LGVFLYKLCYYTTPFEKEGE----NAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRP 867
           LGV  Y+L   + PFE++ +      IL    +FP     S  ++++I+ +L  +P +R 
Sbjct: 274 LGVLTYELIVGSPPFEEDTKELTYKRILKNDIKFPE--TVSHDVKDLISKLLKYNPSERI 331

Query: 868 NICQVLE 888
           ++  V++
Sbjct: 332 SMRDVMK 338

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score = 81.3 bits (199), Expect = 1e-14
 Identities = 59/198 (29%), Positives = 103/198 (52%), Gaps = 5/198 (2%)
 Frame = +1

Query: 310 EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIK 489
           E +V++ +EYC    + D + +   HR+   E +++ + +  GV   H L    +HRD+K
Sbjct: 101 ETKVWMALEYCPGKELYDRVLSM--HRVPTDECVQLFAQIVGGVHYAHSLN--CVHRDLK 156

Query: 490 IENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDK--YS 663
           +EN+L+ ++GD K+ DFG     +   KT  E         I  T  Y +PE+I++  Y 
Sbjct: 157 LENILLDKSGDAKLTDFGFTRECM--TKTTLET--------ICGTTVYMAPELIERKSYD 206

Query: 664 GYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAI-LNVKFQFPSYPQ--YSDHIRNIIT 834
           G+    K DIW+LGV LY +   + PF+++ E      +  Q P   +   +   +++I 
Sbjct: 207 GF----KIDIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQLNENIVTADAKDLIL 262

Query: 835 IMLNKDPIKRPNICQVLE 888
            +L K+P  RP + Q+L+
Sbjct: 263 RLLAKNPNDRPTVEQILK 280

>TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON} 
          Length = 434

 Score = 79.7 bits (195), Expect = 2e-14
 Identities = 74/248 (29%), Positives = 114/248 (45%), Gaps = 26/248 (10%)
 Frame = +1

Query: 223 VDAMKLLKGNKYIVSYIDSHAQRSELK-----------------QGEYEVFLLMEYCSRG 351
           + A+K++K  K IVSY      + E++                 Q E  V+L+MEY    
Sbjct: 200 ISALKVMK-KKEIVSYNAEKQFKREVEVQNSLNHPNIVKIFGFFQDEIFVYLIMEY---- 254

Query: 352 GVIDFLNTRLYHRLQE----FEILKIMSDVCQGVAAMHYLQPP-LIHRDIKIENVLISEN 516
                +N  LY  L+     F  +   + + Q   A+ Y+    +IHRDIK EN+++  N
Sbjct: 255 ----LINGELYKSLKNNNGPFNDILASNYIYQIADALKYMHSKHIIHRDIKPENIVLGFN 310

Query: 517 GDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIW 696
              K+ DFG   S+  PP   ++         I  T  Y +PE++  +  Y  D   DIW
Sbjct: 311 NKIKLADFG--WSICTPPNLRRKT--------ICGTIDYLAPELV-TFKEY--DYNVDIW 357

Query: 697 ALGVFLYKLCYYTTPFEKEGEN----AILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKR 864
           ALG+  Y+L     PFE+E ++     I+NV   FP     S   R++IT +L  DP KR
Sbjct: 358 ALGILTYELIVGNPPFEEETKDLTYKRIINVDLNFPQ--TVSMDARDLITRLLRFDPSKR 415

Query: 865 PNICQVLE 888
             +  V++
Sbjct: 416 MPLVDVMK 423

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
            similar to Ashbya gossypii ABL034W
          Length = 1434

 Score = 81.3 bits (199), Expect = 2e-14
 Identities = 88/347 (25%), Positives = 153/347 (44%), Gaps = 11/347 (3%)
 Frame = +1

Query: 4    NQPEIPKYEKGRVLPIGTH-QVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 180
            N+  +  ++ G+ L  G+  +V + K +  G  A   +++++   N R+    +  L   
Sbjct: 57   NRDTVGPWKLGKTLGKGSSGRVRLAKNMETGKLA---AIKIVPKRNVRHNNTQLTSLPYG 113

Query: 181  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 360
            I            E+  MKL+     +  Y        E+ + + E++L++EY   G + 
Sbjct: 114  I----------EREIIIMKLISHPNVMALY--------EVWENKPELYLVLEYVEGGELF 155

Query: 361  DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISE-NGDYKICD 537
            D+L +R   +L E E +     + QGV+  H+    + HRD+K EN+L+ + N   KI D
Sbjct: 156  DYLISR--GKLPEQEAVHYFKQIVQGVSYCHHFN--ICHRDLKPENLLLDKKNLSVKIAD 211

Query: 538  FGSACSVLRPPKTPQEAAFIHHDIMINTTA---QYRSPEMI--DKYSGYPIDEKSDIWAL 702
            FG A             A    D ++ T+     Y SPE++   KY G P    SD+W+ 
Sbjct: 212  FGMA-------------ALETTDKLLETSCGSPHYASPEIVMGQKYHGSP----SDVWSC 254

Query: 703  GVFLYKLCYYTTPFEKEGENAIL----NVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPN 870
            G+ L+ L     PF  +    +L    + K+Q P     S+  +++I  +L  DP  R  
Sbjct: 255  GIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQ--NISNEAKDLIAKILIVDPAMRIT 312

Query: 871  ICQVLEQVSKLQGVPCPIENFMLTRIKLQNSRNNSNKSTSLNDTTNN 1011
            I +VLE          P+       +K Q +R+ S+ +    D+T N
Sbjct: 313  IDEVLEH---------PL------LLKYQKTRSKSSSNLHALDSTPN 344

>KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {ON}
           Anc_8.668 YPL150W
          Length = 879

 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 60/201 (29%), Positives = 101/201 (50%), Gaps = 8/201 (3%)
 Frame = +1

Query: 310 EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIK 489
           E +V++ +EYC    + D L      R+   E  ++ + +   V   H L    +HRD+K
Sbjct: 104 ETKVWMALEYCPGKELYDHL--LFSKRIPIAECTELFAQIVGAVYYAHSLN--CVHRDLK 159

Query: 490 IENVLISENGDYKICDFG--SACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDK-- 657
           +EN+L+ ++G  K+ DFG    C      +T            +  T  Y +PE+I++  
Sbjct: 160 LENILLDKHGRAKLTDFGFTRECMTRSTLET------------VCGTTVYMAPELIERKS 207

Query: 658 YSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGEN----AILNVKFQFPSYPQYSDHIRN 825
           Y G+    K DIWALGV LY + Y   PF+++ E      I+N    F +    +D +++
Sbjct: 208 YDGF----KIDIWALGVILYTMIYGAMPFDEDDEVKTKWKIVNEDPDFTNNISSND-VKD 262

Query: 826 IITIMLNKDPIKRPNICQVLE 888
           +I  +L KDP +RP I ++L+
Sbjct: 263 LIKKLLKKDPTERPTIREILK 283

>KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {ON}
            Anc_5.406 YHR102W
          Length = 1027

 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 72/279 (25%), Positives = 128/279 (45%), Gaps = 6/279 (2%)
 Frame = +1

Query: 190  DKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFL 369
            D+  +  ++ E+  +  LK    +  Y  S+ + + L       +++MEYC+ G +   L
Sbjct: 77   DEDEVEDVQREIQFLASLKQLPNVTRYYGSYLKNTSL-------WIIMEYCAGGSLRSLL 129

Query: 370  NTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSA 549
                  ++ E  I  IM ++   +  +H  +  +IHRDIK  NVLI+  G  K+CDFG A
Sbjct: 130  RPG---KIDEKYIGVIMRELLVALKFIH--KDNIIHRDIKAANVLITNEGGVKLCDFGVA 184

Query: 550  CSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCY 729
              + +     Q  A          T  + +PE+I    G   D K DIW+LG+  Y++  
Sbjct: 185  AQLNQRTLRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIST 233

Query: 730  YTTPF-EKEGENAI-LNVKFQFPSYP--QYSDHIRNIITIMLNKDPIKRPNICQVLEQ-- 891
               P+ + E   A+ L  K + P      Y+  I+  I + L++DP +R +  ++L+   
Sbjct: 234  GNPPYCDVEALRAMQLITKSKPPRLEGRNYTPLIKEFIALCLDEDPNERLSADELLKSKF 293

Query: 892  VSKLQGVPCPIENFMLTRIKLQNSRNNSNKSTSLNDTTN 1008
            +   +  P  +   ++TR  L   +NN      ++D  N
Sbjct: 294  IKAHKTTPTIVLKELITRYLLFRDKNNRESVIGVDDDNN 332

>Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON}
           (25064..28447) [3384 nt, 1128 aa]
          Length = 1127

 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 75/277 (27%), Positives = 127/277 (45%), Gaps = 7/277 (2%)
 Frame = +1

Query: 190 DKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFL 369
           D   +  ++ E+  +  LK    I  Y  S+ Q + L       +++MEYC+ G +   L
Sbjct: 80  DSDEVEDVQREIQFLASLKQVPNITRYYGSYLQDTNL-------WIIMEYCAGGSLRTLL 132

Query: 370 NTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSA 549
              +   + E  I  IM ++   +  +H  +  +IHRDIK  NVLI+  G  K+CDFG A
Sbjct: 133 RPGM---IDEKYIGVIMRELLTALQCIH--KDNVIHRDIKAANVLITNEGKVKLCDFGVA 187

Query: 550 CSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCY 729
             + +     Q  A          T  + +PE+I    G   D K DIW+LG+  Y++  
Sbjct: 188 AQLNQTSLRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIAT 236

Query: 730 YTTPF-EKEGENAILNVKFQFPSY---PQYSDHIRNIITIMLNKDPIKRPNI--CQVLEQ 891
              P+ E E   A+  +    P+     QYS  ++  I + L++DP +R +    Q  + 
Sbjct: 237 GNPPYCEIEALRAMQLITKSKPARLEGRQYSSGLKEFIALCLDEDPKERLSAEELQKSKF 296

Query: 892 VSKLQGVPCPIENFMLTRIKL-QNSRNNSNKSTSLND 999
           +   +  P  I   +++R  L ++   +S +S  LND
Sbjct: 297 IKAHKSSPTAILKELISRYLLFRDKTKSSRESLLLND 333

>Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045W -
            Hypothetical ORF [contig 47] FULL
          Length = 1213

 Score = 80.9 bits (198), Expect = 2e-14
 Identities = 56/166 (33%), Positives = 82/166 (49%), Gaps = 2/166 (1%)
 Frame = +1

Query: 391  LQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPP 570
            + E E + I   +  G+  +H     ++HRDIK ENV++  NG  KI DFGSA  V   P
Sbjct: 1059 MTEHEAMLIFKQIASGIKNLH--DNGIVHRDIKDENVIVDCNGFVKIVDFGSAAYVKSGP 1116

Query: 571  KTPQEAAFIHHDIMINTTAQYRSPEMI--DKYSGYPIDEKSDIWALGVFLYKLCYYTTPF 744
                       D+ +  T  Y +PE++  + Y G P     DIWA+GV LY + Y   PF
Sbjct: 1117 ----------FDVFVG-TIDYAAPEVLGGEPYEGKP----QDIWAIGVLLYTIIYKENPF 1161

Query: 745  EKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQV 882
                E  IL+   +  S  + SD    +I  +LN+   KRP+I ++
Sbjct: 1162 YNIDE--ILDADLRVNSSERISDDCIALIRKILNRSVSKRPSIDEI 1205

>Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W
           (REAL)
          Length = 1076

 Score = 80.5 bits (197), Expect = 3e-14
 Identities = 72/268 (26%), Positives = 122/268 (45%), Gaps = 6/268 (2%)
 Frame = +1

Query: 190 DKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFL 369
           D   +  ++ E+  +  LK    I  Y  S+ + + L       ++LMEYC+ G +   L
Sbjct: 59  DSDEVEDVQREIQFLASLKQMPNITRYYGSYLKDTSL-------WILMEYCAGGSLRSLL 111

Query: 370 NTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSA 549
                 ++ E  I  IM ++   +  +H  +  +IHRDIK  NVLI+  G  K+CDFG A
Sbjct: 112 RPG---KIDEKYIGVIMRELLVALKCIH--KDNVIHRDIKAANVLITNEGSVKLCDFGVA 166

Query: 550 CSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCY 729
             V +     Q  A          T  + +PE+I    G   D K DIW+LG+  Y++  
Sbjct: 167 AQVNQTSLRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEIAT 215

Query: 730 YTTPF-EKEGENAI-LNVKFQFPSYP--QYSDHIRNIITIMLNKDPIKRPNICQVLEQ-- 891
              P+ + E   A+ L +K + P      YS  ++  I + L++DP +R +   +L    
Sbjct: 216 GNPPYCDVEALRAMQLIIKSKPPRLEGRSYSSSLKEFIALCLDEDPKERLSADDLLRSKF 275

Query: 892 VSKLQGVPCPIENFMLTRIKLQNSRNNS 975
           +   +  P  I   +++R  L   +N +
Sbjct: 276 IKTHRATPTSILKELISRYLLFRDKNKN 303

>KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1223

 Score = 80.5 bits (197), Expect = 3e-14
 Identities = 69/231 (29%), Positives = 105/231 (45%), Gaps = 4/231 (1%)
 Frame = +1

Query: 202  LNTLRAEVDAMKLL--KGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNT 375
            L T+ +E+  M  L  K ++ I+  +D        +  EY       + + G V  F   
Sbjct: 1010 LGTIPSEIQIMATLNTKPHENILMLLDF------FEDDEYYYIETPIHGTSGSVDLFDLI 1063

Query: 376  RLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACS 555
             L   + E E   I   +  G+  +H     ++HRDIK ENV++  NG  KI DFGSA  
Sbjct: 1064 ELKTDMTEHEAKLIFKQIVSGIKHLH--DNGIVHRDIKDENVIVDSNGFVKIIDFGSAAY 1121

Query: 556  VLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYSGYPIDEKSDIWALGVFLYKLCY 729
            V   P           D+ +  T  Y +PE++  + Y G P     DIWA+GV LY + +
Sbjct: 1122 VKSGP----------FDVFVG-TIDYAAPEVLGGEPYEGKP----QDIWAIGVLLYTIIF 1166

Query: 730  YTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQV 882
               PF    E  IL+   +  S  + SD    +I  +LN+   KRP+I ++
Sbjct: 1167 KENPFYNIDE--ILDADLRVDSNHRVSDECIALIRKILNRPISKRPSISKI 1215

>KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1229

 Score = 80.5 bits (197), Expect = 3e-14
 Identities = 70/234 (29%), Positives = 106/234 (45%), Gaps = 5/234 (2%)
 Frame = +1

Query: 202  LNTLRAEVDAMKLL--KGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNT 375
            L T+ +E+  M  L  K ++ I+  +D        +  +Y  +L  E     G ID  + 
Sbjct: 1016 LGTIPSEIQIMVTLNRKPHENILRILDF------FEDDDY-YYLETEMHGETGSIDLFDL 1068

Query: 376  -RLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSAC 552
              L   + EFE   +   V  G+  +H     ++HRDIK ENV++   G  K+ DFGSA 
Sbjct: 1069 IELKTNMTEFEAKLLFKQVASGIKHLH--DNGIVHRDIKDENVIVDNKGFVKLIDFGSAA 1126

Query: 553  SVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYSGYPIDEKSDIWALGVFLYKLC 726
             V   P           D+ +  T  Y +PE++  + Y G P     DIWA+GV LY + 
Sbjct: 1127 YVKSGP----------FDVFVG-TIDYAAPEVLGGEPYEGKP----QDIWAIGVLLYTII 1171

Query: 727  YYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLE 888
            Y   PF    E  IL+   +  S  + S     +I  +LN+   KRP I  ++E
Sbjct: 1172 YKENPFYNIDE--ILDGDLRIQSTHEVSAECVALIRKILNRSVSKRPTIDDIME 1223

>Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {ON}
            YJL095W (REAL)
          Length = 1484

 Score = 80.5 bits (197), Expect = 3e-14
 Identities = 81/292 (27%), Positives = 130/292 (44%), Gaps = 16/292 (5%)
 Frame = +1

Query: 154  GTMACLKRVIVPDKSGLN--------TLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQG 309
            G M  +K+V VP  S  N         LR+EV  +K L  +  IV Y+       E K  
Sbjct: 1204 GEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLD-HLNIVQYLGF-----ENKNS 1257

Query: 310  EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIK 489
             Y +FL  EY + G V   +  R+Y R  E  I  + + V +G+A +H     ++HRD+K
Sbjct: 1258 IYSLFL--EYVAGGSVGSLI--RMYGRFDESLIKHLTTQVLRGLAYLH--SKGILHRDMK 1311

Query: 490  IENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGY 669
             +N+L+ ++G  KI DFG    + R  K      + + D+ +  T  + +PEM+D   GY
Sbjct: 1312 ADNLLLDQDGICKISDFG----ISRKSKD----IYSNSDMTMRGTVFWMAPEMVDTKQGY 1363

Query: 670  PIDEKSDIWALGVFLYKLCYYTTPFEK-EGENAILNVKFQFPSYPQYSDHI-------RN 825
                K DIW+LG  + ++     P+   E   A+  +     + P   D +       R+
Sbjct: 1364 --SAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTLPLITRVGRS 1421

Query: 826  IITIMLNKDPIKRPNICQVLEQVSKLQGVPCPIENFMLTRIKLQNSRNNSNK 981
             +      DP KRP   ++L        V    ++  L +    N + NS+K
Sbjct: 1422 FLDACFEIDPEKRPTATKLLSHQFSEVDVTFDFKSTTLAKFIKSNDKLNSSK 1473

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score = 80.1 bits (196), Expect = 3e-14
 Identities = 60/197 (30%), Positives = 100/197 (50%), Gaps = 5/197 (2%)
 Frame = +1

Query: 310 EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIK 489
           E +V++ +EYC    + D L +    R+   E  ++ + +   V   H +    +HRD+K
Sbjct: 104 ESKVWMALEYCPGKELYDHLLS--LRRISLLECGELFAQISGAVYYAHSMH--CVHRDLK 159

Query: 490 IENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDK--YS 663
           +EN+L+ +NG+ K+ DFG     +   KT  E         +  T  Y +PE+I++  Y 
Sbjct: 160 LENILLDKNGNAKLTDFGFTRECM--TKTTLET--------VCGTTVYMAPELIERRTYD 209

Query: 664 GYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE-NAILNVKFQFPSYPQ--YSDHIRNIIT 834
           G+    K DIW+LGV LY L     PF+ + E      +  + P Y      D  R++I+
Sbjct: 210 GF----KIDIWSLGVILYTLITGYLPFDDDDEAKTKWKIVNEEPKYDAKVIPDDARDLIS 265

Query: 835 IMLNKDPIKRPNICQVL 885
            +L K+P +RP++ QVL
Sbjct: 266 RLLAKNPGERPSLSQVL 282

>KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5.406
            YHR102W
          Length = 1008

 Score = 80.1 bits (196), Expect = 3e-14
 Identities = 74/292 (25%), Positives = 132/292 (45%), Gaps = 12/292 (4%)
 Frame = +1

Query: 190  DKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFL 369
            D+  +  ++ E+  +  LK    I  Y  S+ + + L       +++MEYC  G +   L
Sbjct: 71   DEDEVEDVQKEIQFLASLKQLPNITRYYGSYLKNTSL-------WIIMEYCGGGSLRSLL 123

Query: 370  NTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSA 549
                  ++ E  I  IM ++   +  +H  +  +IHRDIK  NVLI+ +G  K+CDFG A
Sbjct: 124  RPG---KIDEKYIGVIMREILIALKYIH--KDNVIHRDIKAANVLINNDGSIKLCDFGVA 178

Query: 550  CSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCY 729
              + +     Q  A          T  + +PE+I    G   D K+DIW+ G+  Y++  
Sbjct: 179  AQLNQTKSRRQTMA---------GTPYWMAPEVI--MEGVYYDTKADIWSTGITAYEVTT 227

Query: 730  YTTPF-EKEGENAI-LNVKFQFPSYP--QYSDHIRNIITIMLNKDPIKRPNICQVLEQ-- 891
               P+ + E   A+ L  K + P      YS  I+  I   L++DP +RP   ++L+   
Sbjct: 228  GNPPYCDVEALRAMQLIAKSKPPRLEGRNYSALIKEFIATCLDEDPSERPTADELLKTAF 287

Query: 892  VSKLQGVPCPIENFMLTRIKLQNSRNNSNKSTSLNDTTN------NSFNNEL 1029
            +   + +P  I   +++R  L   +        + +  +      N+FNN++
Sbjct: 288  IKTYKPLPTSILKELISRYLLFRDKTKRESVAVVAEEEHEKAKLQNNFNNDI 339

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score = 80.1 bits (196), Expect = 4e-14
 Identities = 81/323 (25%), Positives = 141/323 (43%), Gaps = 15/323 (4%)
 Frame = +1

Query: 4   NQPEIPKYEKGRVLPIGTH-QVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 180
           N+  +  ++ G+ L  G+  +V + K +  G  A   +++++   N R+    +  L   
Sbjct: 54  NRDTVGPWKLGKTLGKGSSGRVRLAKNMQSGKLA---AIKIVPKRNVRHNQKQVTALPYG 110

Query: 181 IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 360
           I            E+  MKL+     +  Y        E+ + + E++L++EY   G + 
Sbjct: 111 I----------EREIIIMKLITHPNIMALY--------EVWENKSELYLVLEYVEGGELF 152

Query: 361 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISE-NGDYKICD 537
           D+L  R   +L E E +     + QGV+  H     + HRD+K EN+L+ + N   KI D
Sbjct: 153 DYLIAR--GKLPEQEAIHYFKQIVQGVSYCHNFN--ICHRDLKPENLLLDKKNKTVKIAD 208

Query: 538 FGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYSGYPIDEKSDIWALGVF 711
           FG A                H          Y SPE++   KY G P    SD+W+ G+ 
Sbjct: 209 FGMAALETTNRLLETSCGSPH----------YASPEIVMGQKYHGSP----SDVWSCGII 254

Query: 712 LYKLCYYTTPFEKEGENAIL----NVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQ 879
           L+ L     PF  +    +L    + ++Q PS    S   +++I+ +L  DP KR  + +
Sbjct: 255 LFALLTGHLPFNDDNVRKLLLKVQHGRYQMPS--NVSKEAKDLISKILVVDPEKRITVDK 312

Query: 880 VLEQVSKLQ-------GVPCPIE 927
           +LE    ++       G+ CP+E
Sbjct: 313 ILEHPLLVKYDNPGKGGLACPLE 335

>KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 843

 Score = 79.7 bits (195), Expect = 4e-14
 Identities = 63/198 (31%), Positives = 101/198 (51%), Gaps = 6/198 (3%)
 Frame = +1

Query: 310 EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIK 489
           E  V++++EYCS   + + L      RL   E  K+ S +   V   H L+   +HRD+K
Sbjct: 100 ESRVWMVLEYCSGHELYEHLLKE--QRLSLEESKKLFSQIASAVYYAHELK--CVHRDLK 155

Query: 490 IENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDK--YS 663
           +ENVL+  NG  K+ DFG          T + A     + +  TT  Y +PE+I++  Y 
Sbjct: 156 LENVLLDGNGHAKLTDFGF---------TREMATRSQLETICGTTV-YMAPELIERKCYD 205

Query: 664 GYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE----NAILNVKFQFPSYPQYSDHIRNII 831
           G+    K DIW+LG+ LY +     PF+++ +      I+N +  F +    SD   ++I
Sbjct: 206 GF----KVDIWSLGIILYTMINGYMPFDEDDDIKTKLKIVNDELDF-NQEWISDDAIDLI 260

Query: 832 TIMLNKDPIKRPNICQVL 885
             ML K+P +R ++ QVL
Sbjct: 261 QGMLRKNPNERISLAQVL 278

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score = 79.7 bits (195), Expect = 4e-14
 Identities = 57/201 (28%), Positives = 102/201 (50%), Gaps = 8/201 (3%)
 Frame = +1

Query: 310 EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIK 489
           E  V++ +EYC    + ++L  +   R+   E   + S +   V   H ++   +HRD+K
Sbjct: 100 ENSVWMALEYCPGKELYEYLLIK--KRIPLDECSHLFSQIVGAVFYAHSMK--CVHRDLK 155

Query: 490 IENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDK--YS 663
           +EN+L+ + G  K+ DFG            +E A       +  T  Y +PE+I++  Y 
Sbjct: 156 LENILLDKKGQAKLTDFGFT----------RECATKGILETVCGTTVYMAPELIERKPYE 205

Query: 664 GYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILNVKFQF-PSYPQYSDHI-----RN 825
           GY    K D W+LG+ LY + +   PF++E +   +  K++   + P Y D+      ++
Sbjct: 206 GY----KIDTWSLGIILYTMIHGAMPFDEEDD---IKTKYRIVNNEPFYDDNFIDANGKD 258

Query: 826 IITIMLNKDPIKRPNICQVLE 888
           +I  +L KDP +RP++ QVL+
Sbjct: 259 LIMQLLQKDPSQRPSLTQVLQ 279

>Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {ON}
            complement(61987..64668) [2682 nt, 894 aa]
          Length = 893

 Score = 79.7 bits (195), Expect = 4e-14
 Identities = 68/266 (25%), Positives = 122/266 (45%), Gaps = 22/266 (8%)
 Frame = +1

Query: 295  ELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLI 474
            E+ Q    + +++EY S G    ++  +   RL+E    ++ + +  GV  MH     L+
Sbjct: 116  EVLQNSKYIGIVLEYASGGEFYRYIQRK--RRLKETAGCRLFTQLVSGVNYMH--SKGLV 171

Query: 475  HRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQ--YRSPEM 648
            HRD+K+EN+L+ ++ +  I DFG     L+            +D+M  +     Y +PE+
Sbjct: 172  HRDLKLENLLLDKHENLVITDFGFVNEFLK-----------DNDLMKTSCGSPCYAAPEL 220

Query: 649  IDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENA-----------ILNVKFQFPS 795
            +     Y    K+DIW+ G+ LY +     P++ + +N            I     +FP 
Sbjct: 221  VISTKPYEA-RKADIWSCGIILYAMLAGYLPWDDDPQNPEGDDIARLYYFITRTSLKFPE 279

Query: 796  YPQYSDHIRNIITIMLNKDPIKRPNICQVLE------QVSKLQGVPCPIENFMLTRIKLQ 957
            Y   S   R+++  +L  DP KR NI Q+ +          L   P   +N M T + L 
Sbjct: 280  Y--ISPIPRDLLRRLLVSDPRKRLNIRQIQQHEWLRPHSEFLSITPEDWDNKMKTEVALS 337

Query: 958  NSRNNS---NKSTSLNDTTNNSFNNE 1026
            N + N+   NK++S+  +T+   N++
Sbjct: 338  NPQQNNEKLNKASSVESSTSKYSNSD 363

>Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}
           YGL179C (REAL)
          Length = 563

 Score = 79.0 bits (193), Expect = 5e-14
 Identities = 67/213 (31%), Positives = 99/213 (46%), Gaps = 25/213 (11%)
 Frame = +1

Query: 316 EVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILK------IMSDVCQGVAAMHYLQPPLIH 477
           +V+L++EYCSRG V      +L  +     IL       I+SDV  G+  +H     +IH
Sbjct: 130 KVYLVLEYCSRGPVKWCPENQLEIKAVGPPILSFQQARNIVSDVVSGLEYLH--SQGIIH 187

Query: 478 RDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINT---TAQYRSPEM 648
           RDIK  N+LIS NG  KI DFG +          Q +   H  I+ +    T  + +PE+
Sbjct: 188 RDIKPSNLLISSNGTVKISDFGVSILTAAESTNIQSS---HEPILKSKTFGTPAFFAPEL 244

Query: 649 IDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEK----EGENAILNVKFQFPSYPQYSDH 816
               +        DIW+LGV LY L + T PF      E  + I+N    FPSY +   H
Sbjct: 245 CSTETYCCRSSAIDIWSLGVTLYCLLFGTLPFNANSGLELFDNIINKPLDFPSYEEILKH 304

Query: 817 IRNIITI------------MLNKDPIKRPNICQ 879
             + +TI            +L K+P +R ++ +
Sbjct: 305 DSSNVTIEEYRDAKDLLYKLLEKNPSRRISLAE 337

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score = 79.3 bits (194), Expect = 5e-14
 Identities = 59/197 (29%), Positives = 100/197 (50%), Gaps = 5/197 (2%)
 Frame = +1

Query: 310 EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIK 489
           E +V++ +EYC    + D L +   HR+   E  ++ + +   V   H +    +HRD+K
Sbjct: 104 ESKVWMALEYCPGKELYDHLLS--LHRISLLECGELFAQISGAVYYAHSMH--CVHRDLK 159

Query: 490 IENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDK--YS 663
           +EN+L+ +NG+ K+ DFG     +   KT  E         +  T  Y +PE+I +  Y 
Sbjct: 160 LENILLDKNGNAKLTDFGFTRECM--TKTTLET--------VCGTTVYMAPELIGRKTYD 209

Query: 664 GYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE-NAILNVKFQFPSYPQ--YSDHIRNIIT 834
           G+    K D W+LGV LY L   + PF+ + E      +  + P Y      D  +++I+
Sbjct: 210 GF----KIDTWSLGVILYTLITGSLPFDDDDEAKTKWKIVNEEPKYDPKLIPDDAKDLIS 265

Query: 835 IMLNKDPIKRPNICQVL 885
            +L K+P +RP++ QVL
Sbjct: 266 RLLAKNPGERPSLPQVL 282

>TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.668
           YPL150W
          Length = 988

 Score = 79.3 bits (194), Expect = 6e-14
 Identities = 70/228 (30%), Positives = 114/228 (50%), Gaps = 7/228 (3%)
 Frame = +1

Query: 310 EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIK 489
           E +V++ +EYC    + + L  RL HR+   E  ++ + +   +   H L    +HRD+K
Sbjct: 100 ETKVWMALEYCPGKELYEHL-LRL-HRIPVDECSRLFAQISGAMYYAHSLN--CVHRDLK 155

Query: 490 IENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYS 663
           +EN+L+ + G+ K+ DFG            +E A  +    I  T  Y +PE+I  ++Y 
Sbjct: 156 LENILLDKVGNAKLTDFGFT----------RECASKNILETICGTTVYMAPELIKRERYD 205

Query: 664 GYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE-NAILNVKFQFPSYPQ--YSDHIRNIIT 834
           G+    K D+W+LGV LY L     PF++E + N    +  + PS+          ++++
Sbjct: 206 GF----KIDVWSLGVILYTLLNGFMPFDEEQQKNTEWKIVNEMPSFDSTLLGPDAVDLLS 261

Query: 835 IMLNKDPIKRPNICQVLEQVSKLQGVPCPIENFMLTRIK--LQNSRNN 972
            +L KDPI RP++ +VLE    LQ    P  N ML +    L   RNN
Sbjct: 262 KLLAKDPIDRPSMKEVLEH-PYLQ----PYGNVMLEQADNILYKQRNN 304

>Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W
           (REAL)
          Length = 1073

 Score = 79.3 bits (194), Expect = 6e-14
 Identities = 71/268 (26%), Positives = 123/268 (45%), Gaps = 6/268 (2%)
 Frame = +1

Query: 190 DKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFL 369
           D   +  ++ E+  +  LK    I  Y  S+ + + L       +++MEYC+ G +   L
Sbjct: 59  DSDEVEDVQREIQFLASLKQISNITRYYGSYLKDTSL-------WIIMEYCAGGSLRSLL 111

Query: 370 NTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSA 549
                 ++ E  I  IM ++   +  +H  +  +IHRDIK  NVLI+  G+ K+CDFG A
Sbjct: 112 RPG---KIDEKYIGVIMRELLVALKCIH--KDNVIHRDIKAANVLITNEGNVKLCDFGVA 166

Query: 550 CSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCY 729
             V +     Q  A          T  + +PE+I    G   D K DIW+LG+  Y++  
Sbjct: 167 AQVNQTSLRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEIAT 215

Query: 730 YTTPF-EKEGENAI-LNVKFQFPSYP--QYSDHIRNIITIMLNKDPIKRPNICQVLEQ-- 891
              P+ + E   A+ L +K + P      YS  ++  I + L++DP +R +   +L    
Sbjct: 216 GNPPYCDVEALRAMQLIIKSKPPRLEGRSYSPSLKEFIALCLDEDPKERLSADDLLRSKF 275

Query: 892 VSKLQGVPCPIENFMLTRIKLQNSRNNS 975
           +   +  P  I   +++R  L   +N +
Sbjct: 276 IKAHRATPTSILKELVSRYLLFRDKNKN 303

>Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}
           YGL179C (REAL)
          Length = 569

 Score = 78.6 bits (192), Expect = 6e-14
 Identities = 63/205 (30%), Positives = 92/205 (44%), Gaps = 22/205 (10%)
 Frame = +1

Query: 316 EVFLLMEYCSRGGVIDFLNTRLYHRLQEFEIL------KIMSDVCQGVAAMHYLQPPLIH 477
           +V+L++EYCSRG V      +L  +     IL      KI+SDV  G+  +H     + H
Sbjct: 130 KVYLVLEYCSRGPVKWCPENQLEIKAVGPSILTFEQARKIVSDVVSGLEYLH--SQGITH 187

Query: 478 RDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDK 657
           RDIK  N+LIS NG  KI DFG +          Q +           T  + +PE+   
Sbjct: 188 RDIKPSNLLISSNGAVKISDFGVSILTTTGSTNIQSSQEQISKSKTLGTPAFFAPELCTA 247

Query: 658 YSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE----NAILNVKFQFPSYPQYS----- 810
              Y      DIW+LGV LY + + T PF         + I++    FPSY Q S     
Sbjct: 248 DGDYRCSSAIDIWSLGVTLYCMLFGTLPFNANSALELFDNIISKPLSFPSYEQVSKRGHP 307

Query: 811 -------DHIRNIITIMLNKDPIKR 864
                  +  ++I+  +L K+P +R
Sbjct: 308 NLAREEYNDAKDILNRLLKKNPSER 332

>Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar to
           Ashbya gossypii ACR133C
          Length = 855

 Score = 79.0 bits (193), Expect = 7e-14
 Identities = 61/201 (30%), Positives = 102/201 (50%), Gaps = 8/201 (3%)
 Frame = +1

Query: 310 EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIK 489
           E +V++ +EYC    + D+L  +   R+   E  K+ + +   V   H LQ   +HRD+K
Sbjct: 100 ESKVWMALEYCPGNELYDYLLQK--QRIPLDETSKLFAQIVGAVFYAHSLQ--CVHRDLK 155

Query: 490 IENVLISENGDYKICDFG--SACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI--DK 657
           +EN+L+ + G   + DFG    C+     KT  E         I  T  Y +PE+I  + 
Sbjct: 156 LENILLDKQGYAMLTDFGFTRECAT----KTQLET--------ICGTTVYMAPELIKRES 203

Query: 658 YSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILNVKFQF---PSYPQYSD-HIRN 825
           Y GY    K D W+LG+ LY + +   PF++E +  +  +K      P    Y++ H ++
Sbjct: 204 YDGY----KVDTWSLGIILYTMLHGFMPFDEE-DPTLTGLKIMNEMPPIVDAYTNVHAKD 258

Query: 826 IITIMLNKDPIKRPNICQVLE 888
           +I  +L K P +RP++ +VLE
Sbjct: 259 LILKLLRKTPSERPSLNKVLE 279

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score = 79.0 bits (193), Expect = 7e-14
 Identities = 60/197 (30%), Positives = 99/197 (50%), Gaps = 5/197 (2%)
 Frame = +1

Query: 310 EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIK 489
           E +V++ +EYC    + D L +    RL   E  ++ + +   V   H +    +HRD+K
Sbjct: 104 ESKVWMALEYCPGKELYDHLLS--LRRLSLLECGELFAQISGAVYYAHSMH--CVHRDLK 159

Query: 490 IENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDK--YS 663
           +EN+L+  NG+ K+ DFG     +   KT  E         +  T  Y +PE+I++  Y 
Sbjct: 160 LENILLDRNGNAKLTDFGFTRECM--TKTTLET--------VCGTTVYMAPELIERKTYD 209

Query: 664 GYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE-NAILNVKFQFPSYPQ--YSDHIRNIIT 834
           G+    K DIW+LGV LY L     PF+ + E      +  + P Y      D  +++I+
Sbjct: 210 GF----KIDIWSLGVILYTLITGYLPFDDDDEVKTKWKIVNEEPKYDSKFIPDDAKDLIS 265

Query: 835 IMLNKDPIKRPNICQVL 885
            +L K+P +RP++ QVL
Sbjct: 266 RLLAKNPGERPSLPQVL 282

 Score = 35.4 bits (80), Expect = 1.5
 Identities = 34/164 (20%), Positives = 65/164 (39%), Gaps = 17/164 (10%)
 Frame = +1

Query: 2809 TRISSVSRKSRYESDSSVY--FSANSGSAFRRESVADSN------IDKVESLGKNSSQYN 2964
            T ++ +SRK   +S   ++  FS  S       S+A S       + KV S  K+    N
Sbjct: 419  TSMTPISRKKSKDSSKILHRNFSTISSQRVYSHSIASSPPKSSNFLQKVSSFFKSKKNSN 478

Query: 2965 NNSLQRMESVVENA---------PSETSFKLNSSLPKMSSVTDNSQTVKETIDNNFTQRI 3117
            +NS   + + V N          PSE+  + N S P  S     + ++K     +  + +
Sbjct: 479  SNSNSSIHTGVSNVLVPNNRRAPPSESFLRKNGSSPPKSRTGTGTASLKTNSKESLRKNV 538

Query: 3118 GSVVEYPLSRAESAVNSTSLSNELREVSAAVNILQRIDHEISQP 3249
             S +    +   +  ++ +  N +  +  A ++L      I +P
Sbjct: 539  VSTIALRDTNNTTLDSNKAYGNTVESLKIAPDVLLNEHIRIEEP 582

>CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {ON}
           similar to uniprot|Q12236 Saccharomyces cerevisiae
           YOL100w PKH2
          Length = 965

 Score = 79.0 bits (193), Expect = 7e-14
 Identities = 62/204 (30%), Positives = 100/204 (49%), Gaps = 9/204 (4%)
 Frame = +1

Query: 304 QGEYEVFLLMEYCSRGGVIDFLNT-RLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHR 480
           Q E  ++ L+EY   G   DFL+  + +  L E   +   + +   + +MH     +IHR
Sbjct: 188 QDEANLYFLLEYAPNG---DFLSLIKKFGTLNEECTIYYSAQIIDAIGSMH--SHGIIHR 242

Query: 481 DIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINT-----TAQYRSPE 645
           DIK EN+L+  N   K+ DFG+A  +    K   +    H++++  +     TA+Y SPE
Sbjct: 243 DIKPENILLDGNMKIKLTDFGTAKLL---QKKSDKNGKPHYNLLTRSSSFVGTAEYVSPE 299

Query: 646 MI-DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILN--VKFQFPSYPQYSDH 816
           ++ D Y+ Y    K DIWA G  +Y++     PF+   E       +K QF     +   
Sbjct: 300 LLSDNYTDY----KCDIWAFGCLVYQMIAGKPPFKATNEYLTFQKVMKVQFAFTAGFPTI 355

Query: 817 IRNIITIMLNKDPIKRPNICQVLE 888
           IR+++  +L K P KR  I Q+ E
Sbjct: 356 IRDLVKNILVKQPEKRLTIPQIKE 379

>KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7.86
            YAL017W
          Length = 1055

 Score = 79.0 bits (193), Expect = 8e-14
 Identities = 65/218 (29%), Positives = 99/218 (45%), Gaps = 8/218 (3%)
 Frame = +1

Query: 256  YIVSYIDSH-----AQRSELKQGEYEVFLLMEYCSRGGVIDFLNT-RLYHRLQEFEILKI 417
            YI+S  ++H      Q  +  + +   ++ +E     G ID  +   L   + EFE   I
Sbjct: 850  YIMSKFNAHPHDNITQIMDFFEDDDYYYIELESHGETGSIDLFDLIELKTNMTEFEAKLI 909

Query: 418  MSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFI 597
               +  G+  +H     ++HRDIK ENV++  NG  K+ DFGSA       KT     F+
Sbjct: 910  FKQIVSGIKYLH--DQGIVHRDIKDENVIVDSNGFVKLIDFGSAAYT----KTGPFEVFV 963

Query: 598  HHDIMINTTAQYRSPEMI--DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAIL 771
                    T  Y +PE++  + Y G P     DIWALGV LY L Y   PF    E  IL
Sbjct: 964  -------GTIDYAAPEILGGNPYKGKP----QDIWALGVLLYTLIYKENPFYNVDE--IL 1010

Query: 772  NVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVL 885
              + +F      +    ++I  +L K    RP+I +++
Sbjct: 1011 EGQLRFDGTCNVTQDCIDLIRWILTKSVNDRPSIDEIV 1048

>KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa]
            {ON} weakly similar to uniprot|P34244 Saccharomyces
            cerevisiae YKL101W HSL1 Nim1p-related protein kinase that
            regulates the morphogenesis and septin checkpoints
            associates with the assembled septin filament required
            along with Hsl7p for bud neck recruitment phosphorylation
            and degradation of Swe1p
          Length = 1267

 Score = 79.0 bits (193), Expect = 8e-14
 Identities = 74/261 (28%), Positives = 125/261 (47%), Gaps = 12/261 (4%)
 Frame = +1

Query: 295  ELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLI 474
            E+ + + E++L++EY   G + D+L ++   +L E E +     + Q VA  H     + 
Sbjct: 141  EVWENKSELYLVLEYVEGGELFDYLVSK--GKLPESEAIHYFKQIVQAVAYCHGFN--IC 196

Query: 475  HRDIKIENVLISENG-DYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTA---QYRSP 642
            HRD+K EN+L+ +     KI DFG A             A    D ++ T+     Y SP
Sbjct: 197  HRDLKPENLLLDKKKRSIKIADFGMA-------------ALETSDKLLETSCGSPHYASP 243

Query: 643  EMI--DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAIL----NVKFQFPSYPQ 804
            E++   KY G P    SD+W+ G+ L+ L     PF  +    +L    + K+Q P +  
Sbjct: 244  EIVLGRKYHGSP----SDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQW-- 297

Query: 805  YSDHIRNIITIMLNKDPIKRPNICQVLEQVSKLQGVPCPIENFMLTRIKLQNSRNNSNKS 984
             S   +++I+ +L  DP +R  I Q+L             ++ +LT+   Q SR+ SN  
Sbjct: 298  LSVEAKDLISRILVVDPNRRITIDQIL-------------QHELLTKYD-QKSRSKSNSD 343

Query: 985  TSLNDTTNN--SFNNELALDQ 1041
             +L + T N  SF++E  +D+
Sbjct: 344  LNLLNRTPNIVSFSSERDIDE 364

>Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL095W
            (REAL)
          Length = 1478

 Score = 79.0 bits (193), Expect = 9e-14
 Identities = 80/292 (27%), Positives = 130/292 (44%), Gaps = 16/292 (5%)
 Frame = +1

Query: 154  GTMACLKRVIVPDKSGLN--------TLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQG 309
            G M  +K+V VP  S  N         LR+EV  +K L  +  IV Y+       E K  
Sbjct: 1198 GEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLD-HLNIVQYLGF-----ENKDN 1251

Query: 310  EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIK 489
             Y +FL  EY + G V   +  R+Y R  E  I  + + V +G+A +H     ++HRD+K
Sbjct: 1252 IYSLFL--EYVAGGSVGSLI--RMYGRFDEPLIKHLTTQVLKGLAYLH--SKGILHRDMK 1305

Query: 490  IENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGY 669
             +N+L+ ++G  KI DFG    + R  K      + + D+ +  T  + +PEM+D   GY
Sbjct: 1306 ADNLLLDQDGICKISDFG----ISRKSKD----IYSNSDMTMRGTVFWMAPEMVDTKQGY 1357

Query: 670  PIDEKSDIWALGVFLYKLCYYTTPFEK-EGENAILNVKFQFPSYPQYSDHI-------RN 825
                K DIW+LG  + ++     P+   E   A+  +     + P   D +       R 
Sbjct: 1358 --SAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTLPLISQVGRG 1415

Query: 826  IITIMLNKDPIKRPNICQVLEQVSKLQGVPCPIENFMLTRIKLQNSRNNSNK 981
             +      +P KRP   ++L     +  V    ++  L +    N + NS+K
Sbjct: 1416 FLDACFEINPEKRPTATELLSHRFSVVNVTFDFKSTELAKFIKSNDKLNSSK 1467

>Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL101W
            (REAL)
          Length = 1526

 Score = 79.0 bits (193), Expect = 9e-14
 Identities = 75/250 (30%), Positives = 119/250 (47%), Gaps = 10/250 (4%)
 Frame = +1

Query: 295  ELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLI 474
            E+ + + E++L++EY   G + D+L +R   +L E E +     + +GV+  H     + 
Sbjct: 181  EVWENKSELYLVLEYVDGGELFDYLVSR--GKLPEREAIHYFKQIVEGVSYCHSFN--IC 236

Query: 475  HRDIKIENVLI-SENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI 651
            HRD+K EN+L+  +N   KI DFG A   L P K  + +    H         Y SPE++
Sbjct: 237  HRDLKPENLLLDKKNKKIKIADFGMAALEL-PNKLLKTSCGSPH---------YASPEIV 286

Query: 652  --DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAIL----NVKFQFPSYPQYSD 813
                Y G P    SD+W+ G+ L+ L     PF  +    +L    + K+Q P     S 
Sbjct: 287  MGRPYHGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPM--NLSL 340

Query: 814  HIRNIITIMLNKDPIKRPNICQVLEQ--VSKLQGVPCPIENFMLTRIKLQN-SRNNSNKS 984
              RN+I+ +L  DP KR    ++LE   + K   +P    N ML ++K  + +R  SN  
Sbjct: 341  EARNLISKILVIDPEKRITTQEILEHPLIKKYDNLPV---NKMLRKMKGDSMTRGKSNSD 397

Query: 985  TSLNDTTNNS 1014
              L D  + S
Sbjct: 398  LHLLDNVSPS 407

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score = 78.6 bits (192), Expect = 9e-14
 Identities = 64/229 (27%), Positives = 112/229 (48%), Gaps = 12/229 (5%)
 Frame = +1

Query: 310 EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIK 489
           E  V++ +EYC    + D+L   L  R+   E  ++ + +   V   H LQ   +HRD+K
Sbjct: 100 ETRVWMALEYCPGNELYDYL--LLKQRIPLDETRRLFAQIVSAVFYAHSLQ--CVHRDLK 155

Query: 490 IENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYS 663
           +EN+L+ +NG   + DFG          T + A     + +  TT  Y +PE+I  + Y 
Sbjct: 156 LENILLDKNGYAMLTDFGF---------TRECATKTQLETVCGTTV-YMAPELIKREAYD 205

Query: 664 GYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE-NAILNVKFQFPS-YPQY-SDHIRNIIT 834
           GY    K D W+LG+ LY + +   PF+++      L +  + P+   +Y S   +++I 
Sbjct: 206 GY----KVDTWSLGIILYTMLHGYMPFDEDDTVRTGLKIMHEEPAVLDEYTSPQAKDLIV 261

Query: 835 IMLNKDPIKRPNICQVLEQ-------VSKLQGVPCPIENFMLTRIKLQN 960
            +L+K+  +RPN+ +VL+           L+ V C I+      +K Q+
Sbjct: 262 RLLDKNAAQRPNLNEVLQHPFLQPYGALLLETVECLIKRQRRASLKFQS 310

>SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102W KIC1 Protein kinase of the PAK/Ste20 kinase
           family required for cell integrity possibly through
           regulating 1 6-beta-glucan levels in the wall physically
           interacts with Cdc31p (centrin) which is a component of
           the spindle pole body
          Length = 885

 Score = 78.6 bits (192), Expect = 9e-14
 Identities = 78/285 (27%), Positives = 132/285 (46%), Gaps = 8/285 (2%)
 Frame = +1

Query: 166 CLKRVIVPDKSG--LNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEY 339
           C  +V+  D S   +  ++ E+  +  LK    I  Y  S+   ++L       +++MEY
Sbjct: 52  CAIKVLNLDTSEDEVEDVQKEIQFLSSLKQVPNITHYYGSYLYDTKL-------WIIMEY 104

Query: 340 CSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENG 519
           C+ G +   L      ++ E  I  IM ++   VA ++  +  +IHRDIK  NVLI+ +G
Sbjct: 105 CAGGSLRTLLRPG---KIDEKYIGVIMRELL--VALLYIHKDNVIHRDIKAANVLITNDG 159

Query: 520 DYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWA 699
             K+CDFG A  + +     Q  A          T  + +PE+I    G   D K DIW+
Sbjct: 160 RVKLCDFGVAAQLTQSNVRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWS 208

Query: 700 LGVFLYKLCYYTTPF-EKEGENAI-LNVKFQFPSYP--QYSDHIRNIITIMLNKDPIKRP 867
           LG+  Y++     P+ + E   A+ L  K + P     QYS  ++  I + L++DP +R 
Sbjct: 209 LGITTYEITTGNPPYCDVEALRAMQLITKSKPPRLEGRQYSPLLKEFIALCLDEDPKERL 268

Query: 868 NICQVLEQ--VSKLQGVPCPIENFMLTRIKLQNSRNNSNKSTSLN 996
               +L+   +   +  P  I   ++TR  L   +N + +S   N
Sbjct: 269 AAEDLLKTRFIKTHKSSPTSILKELITRYLLHRDKNINRESAMAN 313

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score = 78.2 bits (191), Expect = 1e-13
 Identities = 72/277 (25%), Positives = 133/277 (48%), Gaps = 5/277 (1%)
 Frame = +1

Query: 79  YLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKY 258
           +L  GGFA+ + ++  D S       T+A   ++ +  +     L +E+   K ++ +  
Sbjct: 84  FLGEGGFARCFQIK--DDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMR-HFN 137

Query: 259 IVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQG 438
           IV +ID         + +  V++L+E C  G ++D L  R    L E E+    + +   
Sbjct: 138 IVQFIDCF-------EDDTNVYILLEICPNGSLMDLLKRRKV--LTEPEVRFFTTQIVGA 188

Query: 439 VAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMIN 618
           V  MH  +  +IHRD+K+ N+   ++ + KI DFG A +VL   +             + 
Sbjct: 189 VKYMHSRR--VIHRDLKLGNIFFDKHYNLKIGDFGLA-AVLANDR--------ERKYTVC 237

Query: 619 TTAQYRSPEMI-DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAIL-NVK---F 783
            T  Y +PE++  K++G+  +   DIW+ GV +Y L     PF+ +  N I   +K   +
Sbjct: 238 GTPNYIAPEVLTGKHTGHSYE--VDIWSCGVMIYALLIGKPPFQAKEVNIIYERIKCGDY 295

Query: 784 QFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 894
            FP     S     +I  +L+ DP++RP++ ++++ V
Sbjct: 296 VFPRDKCISQEALTLIRDILSIDPLERPSLDEIIDYV 332

>CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa] {ON}
            similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095w BCK1
          Length = 1447

 Score = 78.6 bits (192), Expect = 1e-13
 Identities = 86/300 (28%), Positives = 135/300 (45%), Gaps = 17/300 (5%)
 Frame = +1

Query: 154  GTMACLKRVIVPD--------KSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQG 309
            G M  +K+V VP         K  +  L++EV  +K L  +  IV Y+ S     E++  
Sbjct: 1174 GEMMAVKQVEVPKYGTQNELVKDMVEALKSEVATLKDLD-HLNIVQYLGS-----EIRGN 1227

Query: 310  EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIK 489
             Y +FL  EY + G V   +  RLY R  E  I  + + V  G+  +H     ++HRD+K
Sbjct: 1228 IYSLFL--EYVAGGSVGSLI--RLYGRFDEKLIRHLNTQVLSGLKYLH--SKGILHRDMK 1281

Query: 490  IENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGY 669
             +N+L+ E+G  KI DFG +           +  + + D+ +  T  + +PEM+D   GY
Sbjct: 1282 ADNLLLDEDGICKISDFGIS--------KKSKNIYSNSDMTMRGTVFWMAPEMVDTKQGY 1333

Query: 670  PIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITI---- 837
                K DIW+LG  + ++     P+      A +    +  S P   D    +I+     
Sbjct: 1334 --SAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFQIGKSKSAPPIPDDTIQLISSKGKD 1391

Query: 838  MLNK----DPIKRPNICQVLE-QVSKLQGVPCPIENFMLTRIKLQNSRNNSNKSTSLNDT 1002
             L+K    DP KRP    +LE   SK+     P  NF  TR+      N+   S+ L +T
Sbjct: 1392 FLSKCFEIDPEKRPTADDLLEHSFSKVD----PAFNFSRTRLYEFIKTNDKLNSSVLRNT 1447

>CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} similar
           to uniprot|P08458 Saccharomyces cerevisiae YDR523c SPS1
           ser/thr protein kinase
          Length = 521

 Score = 77.4 bits (189), Expect = 1e-13
 Identities = 70/288 (24%), Positives = 130/288 (45%), Gaps = 15/288 (5%)
 Frame = +1

Query: 67  IIEKYLACGGFAQVY-----------SVRVIDSSNARNELGTMACLKRVIVPDKSGLNTL 213
           +IE  +  G F  VY           +V+V++  N+  E+  +A                
Sbjct: 6   VIENCIGRGNFGDVYKAKDTWLNEVVAVKVVNLENSEEEVELLA---------------- 49

Query: 214 RAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRL 393
             E+  +  LK + Y+ +YI +  +       +  +++ MEYC  G V D L       L
Sbjct: 50  -QEIFFLAELK-SPYVTNYIATVVE-------DVSMWIAMEYCGGGSVGDLLKYHYTSGL 100

Query: 394 QEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPK 573
            E +   I  ++ +G++ +H  +   IHRDIK  N+L+++ G  K+ DFG +  +L    
Sbjct: 101 PEHKTRFITREILKGLSYLHSQRK--IHRDIKAANILLTDEGKVKLSDFGVSGKLL---- 154

Query: 574 TPQEAAFIHHDIMINTTAQYRSPEMIDKYS-GYPIDEKSDIWALGVFLYKLCYYTTPFEK 750
                +    D  +  T  + +PE++   S GY  DE++DIW+LG+ + ++   + P  K
Sbjct: 155 -----SSFRRDTFVG-TPYWMAPEIVAHDSEGY--DERADIWSLGITVIEMLRGSPPLSK 206

Query: 751 -EGENAILNVKFQFPS--YPQYSDHIRNIITIMLNKDPIKRPNICQVL 885
            +    I N+  + P   +  +SD  ++ + + L K+   RP    +L
Sbjct: 207 YDPMKVIANLPKRKPPKLHGDFSDDAKHFVALCLIKESAIRPTAADLL 254

>KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {ON}
            Anc_3.92 YDR490C
          Length = 1095

 Score = 78.2 bits (191), Expect = 1e-13
 Identities = 85/352 (24%), Positives = 151/352 (42%), Gaps = 27/352 (7%)
 Frame = +1

Query: 37   RVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLR 216
            +++  G       + L  G ++ V     IDS   + +       K  ++  K  +  + 
Sbjct: 170  KIIKKGIKDFKFGEMLGDGAYSTVMLATSIDS---KKQYAVKVLNKEYLIKQKK-VKYVN 225

Query: 217  AEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNT-RLYHRL 393
             E +A++ +  +K IV    +        Q E  ++ L+EYC  G   DFL+  + Y  L
Sbjct: 226  IEKNALQRINNSKMIVKLFFTF-------QDESSLYFLLEYCPNG---DFLSLMKKYGSL 275

Query: 394  QEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPK 573
             E       + V   +  +H     +IHRDIK EN+L+ +    K+ DFG+A   +    
Sbjct: 276  NETVACYYSAQVIDAIDYLH--TNGIIHRDIKPENILLDKEFKIKLTDFGTA--KILDSS 331

Query: 574  TPQEAAFIHHDIMINTTAQYRSPEMI-DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEK 750
            T  +   +        TA+Y +PE++ D +    +D + D+WA G  LY++     PF+ 
Sbjct: 332  TNNKFDLLTRSKSFVGTAEYVAPELLNDSF----VDYRCDVWAFGCILYQMIAGKPPFKA 387

Query: 751  EGENAILN--VKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLE---------QVS 897
              E       +K Q+     +   IR+++  +L KD  +RP+I Q+ +         Q  
Sbjct: 388  TNEYLTFQKVMKVQYAFTAGFPLIIRDLVKKILVKDLNQRPSISQIEKHHFFREKNFQNG 447

Query: 898  KLQGVPCP-IENFMLTRIKLQ-----NSRNN--------SNKSTSLNDTTNN 1011
             +   P P I  F ++   +Q     N RNN        +++ TS   TT++
Sbjct: 448  SVWSDPVPEISGFKISAKSMQPIPELNKRNNVTYNQLKKTHQITSTGSTTSS 499

>NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {ON}
           Anc_8.668
          Length = 883

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 55/197 (27%), Positives = 101/197 (51%), Gaps = 5/197 (2%)
 Frame = +1

Query: 310 EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIK 489
           E +V++  EYC    + D + +    R+     +++ + +   V   H L    +HRD+K
Sbjct: 101 ESKVWMAQEYCPGKDLYDHVLS--LQRVPSSACIELFTQIVGAVYYAHSLN--CVHRDLK 156

Query: 490 IENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYS 663
           +EN+L+ +NG+ K+ DFG     +   KT  E         I  T  Y +PE+I  + Y 
Sbjct: 157 LENILLDKNGNAKLTDFGFTRECM--TKTSLET--------ICGTTVYMAPELIKRESYD 206

Query: 664 GYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAI-LNVKFQFPSYPQ--YSDHIRNIIT 834
           G+    K DIW+LGV LY +   + PF+++ E      +  + P +     S+  ++++ 
Sbjct: 207 GF----KIDIWSLGVILYTMLNGSMPFDEDDETKTEWKIMNEMPVFNDTILSEDAKDLLI 262

Query: 835 IMLNKDPIKRPNICQVL 885
            +L+KDP +RP++ ++L
Sbjct: 263 KLLSKDPNERPSMQEIL 279

>SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {ON}
           similar to uniprot|P38991 Saccharomyces cerevisiae
           YPL209C IPL1 Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 400

 Score = 76.3 bits (186), Expect = 2e-13
 Identities = 86/286 (30%), Positives = 125/286 (43%), Gaps = 14/286 (4%)
 Frame = +1

Query: 70  IEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNT---LRAEVDAMKL 240
           I K L  G F +VY VR         + G +  LK +   + +  N     R EV+    
Sbjct: 142 IGKKLGKGKFGKVYCVR-------HKKTGFICALKAMEKKEITQYNVQKQFRREVEIQAS 194

Query: 241 LKGNKYIVSYIDSHAQRSELKQGEYE---VFLLMEYCSRGGVIDFLNTRLYHRLQ---EF 402
           L+           H   ++L    Y+   V+LLMEY         +N  LY  L+    F
Sbjct: 195 LR-----------HPNLTQLYGYFYDDKRVYLLMEY--------LVNGELYRHLRVNGPF 235

Query: 403 EILKIMSDVCQGVAAMHYLQPP-LIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTP 579
             +     V Q   A++Y+    ++HRDIK EN+LI      K+ DFG   SV+      
Sbjct: 236 NDILASYYVNQMADALNYMHDRNVLHRDIKPENILIGFQNTLKLTDFG--WSVISTTGAK 293

Query: 580 QEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE 759
           ++         +  T  Y SPE++ KY  Y  DEK D+WALGV  Y+L   T PFE+  +
Sbjct: 294 RKT--------LCGTLDYLSPELV-KYREY--DEKVDVWALGVLAYELLVGTPPFEEASK 342

Query: 760 ----NAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVL 885
                 I+    +FP   Q S   R++I  +L  DP  R ++  VL
Sbjct: 343 ELTYKRIVRRDLRFPD--QMSIDARDLIGRLLENDPSTRISLKDVL 386

>KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {ON}
           Anc_1.182 YJL164C
          Length = 401

 Score = 76.3 bits (186), Expect = 2e-13
 Identities = 60/192 (31%), Positives = 97/192 (50%), Gaps = 5/192 (2%)
 Frame = +1

Query: 304 QGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRD 483
           Q   +VF++M+Y   G +   L  R   R          ++VC  +  +H L   +I+RD
Sbjct: 159 QDSQQVFMVMDYIEGGELFSLL--RKSQRFPTPVAKFYAAEVCLALEYLHNLD--IIYRD 214

Query: 484 IKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYS 663
           +K EN+L+ +NG  KI DFG A  V  P  T            +  T  Y +PE++   S
Sbjct: 215 LKPENILLDKNGHIKITDFGFAKYV--PDVT----------YTLCGTPDYIAPEVM---S 259

Query: 664 GYPIDEKSDIWALGVFLYKLCYYTTPF-----EKEGENAILNVKFQFPSYPQYSDHIRNI 828
             P ++  D W+ GV +Y++    TPF      K  EN ILN K +FPS+  + D ++++
Sbjct: 260 TKPYNKSVDWWSFGVLIYEMLAGHTPFYDSNAMKTYEN-ILNAKLKFPSF--FHDDVKDL 316

Query: 829 ITIMLNKDPIKR 864
           +T ++N+D  +R
Sbjct: 317 LTRLINRDLSQR 328

>YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Protein
           kinase of the PAK/Ste20 family, required for cell
           integrity; physically interacts with Cdc31p (centrin),
           which is a component of the spindle pole body; part of
           the RAM network that regulates cellular polarity and
           morphogenesis
          Length = 1080

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 70/268 (26%), Positives = 124/268 (46%), Gaps = 6/268 (2%)
 Frame = +1

Query: 190 DKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFL 369
           D   +  ++ E+  +  LK    I  Y  S+ + + L       +++ME+C+ G +   L
Sbjct: 59  DSDEVEDVQREIQFLASLKQISNITRYYGSYLKDTSL-------WIIMEHCAGGSLRSLL 111

Query: 370 NTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSA 549
                 ++ E  I  IM ++   +  +H  +  +IHRDIK  NVLI+  G+ K+CDFG A
Sbjct: 112 RPG---KIDEKYIGVIMRELLVALKCIH--KDNVIHRDIKAANVLITNEGNVKLCDFGVA 166

Query: 550 CSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCY 729
             V +     Q  A          T  + +PE+I    G   D K DIW+LG+  Y++  
Sbjct: 167 AQVNQTSLRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEIAT 215

Query: 730 YTTPF-EKEGENAI-LNVKFQFPSYP--QYSDHIRNIITIMLNKDPIKRPNICQVLEQ-- 891
              P+ + E   A+ L +K + P      YS  ++  I + L++DP +R +   +L+   
Sbjct: 216 GNPPYCDVEALRAMQLIIKSKPPRLEDRSYSTSLKEFIALCLDEDPKERLSADDLLKSKF 275

Query: 892 VSKLQGVPCPIENFMLTRIKLQNSRNNS 975
           +   +  P  I   +++R  L   +N +
Sbjct: 276 IRAHKATPTSILKELISRYLLFRDKNKN 303

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score = 77.4 bits (189), Expect = 2e-13
 Identities = 71/293 (24%), Positives = 137/293 (46%), Gaps = 5/293 (1%)
 Frame = +1

Query: 79  YLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKY 258
           +L  GGFA+ + ++     +   ++     + ++ +  +     L +E+   K ++    
Sbjct: 84  FLGEGGFARCFQIK-----DDGGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMRHTN- 137

Query: 259 IVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQG 438
           IV ++D         + +  V++L+E C  G ++D L  R    L E E+    + +   
Sbjct: 138 IVQFVDCF-------EDDTNVYILLEICPNGSLMDLLKRR--KMLTEPEVRFFTTQIVGA 188

Query: 439 VAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMIN 618
           V  MH  +  +IHRD+K+ N+   ++ + K+ DFG A +VL   +             + 
Sbjct: 189 VKYMHSRR--VIHRDLKLGNIFFDKHYNLKVGDFGLA-AVLANDR--------ERKYTVC 237

Query: 619 TTAQYRSPEMI-DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAIL-NVK---F 783
            T  Y +PE++  K++G+  +   DIW+ GV +Y L     PF+ +  N I   +K   F
Sbjct: 238 GTPNYIAPEVLTGKHTGHSYE--VDIWSCGVMIYALLIGKPPFQAKEVNIIYERIKCGDF 295

Query: 784 QFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSKLQGVPCPIENFMLT 942
            FP     S     +I  +L+ DP++RP++ ++++ V      P  I+  +LT
Sbjct: 296 VFPKDKFISPEALVLIKDILSIDPLERPSLDEIIDYVWFRGLFPSRIDASVLT 348

>KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8.279
           YLR096W
          Length = 1095

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 61/212 (28%), Positives = 109/212 (51%), Gaps = 4/212 (1%)
 Frame = +1

Query: 322 FLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENV 501
           ++L EY S G ++D++    +  L+E    K    V   +  +H     ++HRD+KIEN+
Sbjct: 201 YMLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGVASALQYLHANN--IVHRDLKIENI 256

Query: 502 LISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDE 681
           +IS +G+ KI DFG + +V    K       +H       +  + +PE++ K + Y I  
Sbjct: 257 MISTSGEIKIIDFGLS-NVFDTRKQ------LH---TFCGSLYFAAPELL-KANPY-IGP 304

Query: 682 KSDIWALGVFLYKLCYYTTPFEKEGENA----ILNVKFQFPSYPQYSDHIRNIITIMLNK 849
           + DIW+ GV LY L     PF+ E  +     I   K ++P++   S  + ++++ ML  
Sbjct: 305 EVDIWSFGVVLYVLVCGKVPFDDENSSVLHEKIKQGKVEYPNH--LSIEVISLLSKMLVV 362

Query: 850 DPIKRPNICQVLEQVSKLQGVPCPIENFMLTR 945
           DP+KR N+ +V+E    ++G   P  +++  R
Sbjct: 363 DPLKRANLTKVIEHPWMIRGYDFPPPSYLPKR 394

>Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {ON}
            YDR490C (REAL)
          Length = 758

 Score = 77.4 bits (189), Expect = 2e-13
 Identities = 84/332 (25%), Positives = 145/332 (43%), Gaps = 24/332 (7%)
 Frame = +1

Query: 109  YSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQ 288
            YS  V+ ++    +   +  L +  +  +  +  +  E  A++ L G K I+    +   
Sbjct: 136  YSSVVLATARESGKKYAVKVLSKEYLIRQKKVKYVTVEKLALQKLNGTKGIIRLFFTF-- 193

Query: 289  RSELKQGEYEVFLLMEYCSRGGVIDFLNT-RLYHRLQEFEILKIMSDVCQGVAAMHYLQP 465
                 Q E  ++ L+EY   G   DFL   + Y  L E       S +   V ++H +  
Sbjct: 194  -----QDEASLYFLLEYAPHG---DFLGLIKKYGSLNEICARYYASQIIDAVDSLHSIG- 244

Query: 466  PLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAA-------FIHHDIMINTT 624
             +IHRDIK EN+L+ ++   K+ DFG+A  +   P+ P  AA                 T
Sbjct: 245  -IIHRDIKPENILLDKDMKVKLTDFGTAKIL---PEQPSNAADGKPCFDLYAKSKSFVGT 300

Query: 625  AQYRSPEMI-DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE----NAILNVKFQF 789
            A+Y SPE++ D Y+    D + DIWA G  LY++     PF+   E      ++ +++ F
Sbjct: 301  AEYVSPELLNDSYT----DSRCDIWAFGCILYQMLAGKPPFKAANEYLTFQKVMKIQYAF 356

Query: 790  PS-YPQYSDHIRNIITIMLNKDPIKRPNICQV----------LEQVSKLQGVPCPIENFM 936
             + +PQ    +++++  +L +DP  R  I Q+           E  S   G P  I+++ 
Sbjct: 357  TAGFPQI---VKDLVKKLLVRDPNDRLAIEQIKAHVFFDKINFEDGSVWDGDPPEIQSY- 412

Query: 937  LTRIKLQNSRNNSNKSTSLNDTTNNSFNNELA 1032
                K+           S NDTT+   N +L+
Sbjct: 413  ----KISAEAMKPPPKVSENDTTSKLGNLQLS 440

>Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {ON}
            similar to Ashbya gossypii ACR281C
          Length = 1325

 Score = 77.8 bits (190), Expect = 2e-13
 Identities = 57/177 (32%), Positives = 84/177 (47%), Gaps = 3/177 (1%)
 Frame = +1

Query: 352  GVIDFLNT-RLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYK 528
            G ID  +   L   + E+E   +   +  GV  +H     ++HRDIK ENV++   G  K
Sbjct: 1157 GSIDLFDLIELKTNMTEYEAKLLFKQITSGVKHLH--DNGIVHRDIKDENVIVDNKGCVK 1214

Query: 529  ICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYSGYPIDEKSDIWAL 702
            + DFGSA  V R P           D+ +  T  Y +PE++  D Y G P     DIWA+
Sbjct: 1215 LIDFGSAAYVKRGP----------FDVFVG-TIDYAAPEVLEGDPYEGKP----QDIWAI 1259

Query: 703  GVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNI 873
            GV LY + Y   PF    E  IL+   +       S+    +IT++L++   KRP +
Sbjct: 1260 GVLLYTIIYKENPFYNVDE--ILDGDLRINPSVIVSEECVALITMVLDRSLSKRPTV 1314

>Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON}
           complement(4445..5575) [1131 nt, 377 aa]
          Length = 376

 Score = 75.5 bits (184), Expect = 2e-13
 Identities = 74/277 (26%), Positives = 120/277 (43%), Gaps = 5/277 (1%)
 Frame = +1

Query: 70  IEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKG 249
           I + L  G F +VY VR   S      +  +  + ++ + + +     + E+D    L  
Sbjct: 120 IGRKLGKGKFGKVYCVRHKPSGL----ICALKVMNKMEIVNFNVQKQFKREIDIQYHLNH 175

Query: 250 NKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDV 429
                 Y   H  ++        V+L+MEY   G +      +L  +      +   + V
Sbjct: 176 KNLTKLYAFFHDSKN--------VYLVMEYLIGGELY-----KLLKKNGPMNDITASNYV 222

Query: 430 CQGVAAMHYLQP-PLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHD 606
            Q   A++Y+    +IHRD+K EN+LI  N   K+ DFG   S+  P    ++       
Sbjct: 223 YQMTDALNYMHKRKIIHRDLKPENILIGFNNQIKLTDFG--WSIYNPNNQKRKT------ 274

Query: 607 IMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE----NAILN 774
             +  T  Y SPE+I   S    DE  D+WALG+  Y+L     PFE++ +      I  
Sbjct: 275 --LCGTIDYLSPELI---SSREYDENVDVWALGILTYELVVGAPPFEEDTKEQTYKRIAK 329

Query: 775 VKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVL 885
              +FP  P  S   R++IT +L   P +R N+ QV+
Sbjct: 330 SDLKFP--PNVSSEARDLITNLLKVVPSERFNLQQVM 364

>ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOL045W and
            YAL017W (FUN31)
          Length = 1259

 Score = 77.4 bits (189), Expect = 2e-13
 Identities = 66/228 (28%), Positives = 101/228 (44%), Gaps = 4/228 (1%)
 Frame = +1

Query: 202  LNTLRAEVDAMKLL--KGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNT 375
            L T+ +E+  M  L  K ++ I+  +D        +  EY       +   G +  F   
Sbjct: 1046 LGTIPSEIQIMATLNKKPHENIMRLLDF------FEDDEYYYIESPMHGETGSIDLFDLI 1099

Query: 376  RLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACS 555
             L   + E E   +   V  G+  +H  +  ++HRDIK ENV++   G  KI DFGSA  
Sbjct: 1100 ELKTNMTEHEAKLLFKQVASGLRHLH--ENGIVHRDIKDENVIVDNRGRVKIIDFGSAAY 1157

Query: 556  VLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYSGYPIDEKSDIWALGVFLYKLCY 729
            V R P           D+ +  T  Y +PE++  D Y G P     D+WA+GV LY + Y
Sbjct: 1158 VKRGP----------FDVFVG-TIDYAAPEVLGGDPYEGKP----QDVWAVGVLLYTIIY 1202

Query: 730  YTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNI 873
               PF    E  IL+   +       S+    +IT +LN+   +RP +
Sbjct: 1203 KENPFYNIDE--ILDGDLRISPAVVVSEECVALITRILNRSVNRRPTV 1248

>Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209C
           (IPL1) - Protein kinase [contig 166] FULL
          Length = 381

 Score = 75.5 bits (184), Expect = 2e-13
 Identities = 75/273 (27%), Positives = 114/273 (41%), Gaps = 8/273 (2%)
 Frame = +1

Query: 70  IEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKG 249
           + K L  G F +VY V+          +  +  +K+  +   +     R EV+    LK 
Sbjct: 125 VGKKLGKGKFGKVYCVK----HKRTGFICALKAMKKSEIVQYNVQKQFRREVEIQSSLKH 180

Query: 250 NKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQE---FEILKIM 420
                 Y   H ++         V+LLMEY         +N  LY  L+    F  +   
Sbjct: 181 PNLTRLYGYFHDEK--------RVYLLMEY--------LVNGELYKHLRSHGPFNDITAS 224

Query: 421 SDVCQGVAAMHYLQPP-LIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFI 597
             V Q   A++Y+    ++HRDIK EN+L+      K+ DFG + S +   K        
Sbjct: 225 HFVHQMADALNYMHSKNILHRDIKPENILLGFQNTLKLTDFGWSVSNVGNSKRKTLCG-- 282

Query: 598 HHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE----NA 765
                   T  Y SPE+I        D K D+WALGV  Y+L   + PFE++ +      
Sbjct: 283 --------TMDYLSPELIKSRE---YDNKVDVWALGVLTYELLVGSPPFEEDTKELTYKR 331

Query: 766 ILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKR 864
           I+    +FP   Q S H R++I+ +L  DP  R
Sbjct: 332 IIKRDLRFPD--QVSPHARDLISRLLEYDPQNR 362

>TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1315

 Score = 77.4 bits (189), Expect = 2e-13
 Identities = 61/215 (28%), Positives = 106/215 (49%), Gaps = 4/215 (1%)
 Frame = +1

Query: 322 FLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENV 501
           ++L EY S G ++D++    +  L+E    K    +   +  +H     ++HRD+KIEN+
Sbjct: 283 YMLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGIASALQYLH--SNNIVHRDLKIENI 338

Query: 502 LISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYSGYPI 675
           +IS +G+ KI DFG +        T Q   F         +  + +PE++    Y+G  +
Sbjct: 339 MISTSGEIKIIDFGLSNLY---DTTRQLHTFC-------GSLYFAAPELLKAHPYTGPEV 388

Query: 676 DEKSDIWALGVFLYKLCYYTTPFEKEGENAI-LNVKFQFPSYPQY-SDHIRNIITIMLNK 849
               D+W+ GV LY L     PF+ E  + +   +K     YPQ+ S  + ++++ ML  
Sbjct: 389 ----DVWSFGVVLYVLVCGKVPFDDENSSVLHEKIKQGKVDYPQHLSIEVISLLSKMLVV 444

Query: 850 DPIKRPNICQVLEQVSKLQGVPCPIENFMLTRIKL 954
           DP KR  + QV+E    ++G   P  +++  RI L
Sbjct: 445 DPKKRATLRQVVEHHWMVRGYDNPSSSYLPNRIPL 479

>Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL095W
            (REAL)
          Length = 1481

 Score = 77.4 bits (189), Expect = 3e-13
 Identities = 79/292 (27%), Positives = 129/292 (44%), Gaps = 16/292 (5%)
 Frame = +1

Query: 154  GTMACLKRVIVPDKSGLN--------TLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQG 309
            G M  +K+V VP  S  N         LR+EV  +K L  +  IV Y+       E K  
Sbjct: 1201 GEMMAVKQVEVPKYSSQNEAILGTVEALRSEVSTLKDLD-HLNIVQYLGF-----ENKNN 1254

Query: 310  EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIK 489
             Y +FL  EY + G V   +  R+Y R  E  I  + + V +G+A +H     ++HRD+K
Sbjct: 1255 IYSLFL--EYVAGGSVGSLI--RMYGRFDESLIRHLTTQVLKGLAYLH--SKGILHRDMK 1308

Query: 490  IENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGY 669
             +N+L+ ++G  KI DFG    + R  K      + + D+ +  T  + +PEM+D   GY
Sbjct: 1309 ADNLLLDQDGICKISDFG----ISRKSKD----IYSNSDMTMRGTVFWMAPEMVDTKQGY 1360

Query: 670  PIDEKSDIWALGVFLYKLCYYTTPFEK-EGENAILNVKFQFPSYPQYSDHI-------RN 825
                K DIW+LG  + ++     P+   E   A+  +     + P   D +       R+
Sbjct: 1361 --SAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTLPLISQVGRS 1418

Query: 826  IITIMLNKDPIKRPNICQVLEQVSKLQGVPCPIENFMLTRIKLQNSRNNSNK 981
             +      +P +RP   ++L             ++  L +    N R NS+K
Sbjct: 1419 FLDACFEINPEERPTATELLSHQFSQVDTTFDFKSTRLAKFIKSNDRLNSSK 1470

>NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {ON}
           Anc_5.406
          Length = 1020

 Score = 77.0 bits (188), Expect = 3e-13
 Identities = 72/270 (26%), Positives = 124/270 (45%), Gaps = 6/270 (2%)
 Frame = +1

Query: 190 DKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFL 369
           D+  +  ++ E+  +  LK    I  Y  S+ + + L       +++MEYC+ G +   L
Sbjct: 78  DEDEVEDVQREIQFLASLKQLPNITRYYGSYLKDTSL-------WIIMEYCAGGSLRTLL 130

Query: 370 NTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSA 549
                 ++ E  I  I  ++   +  +H  +  +IHRDIK  NVLI+  G  K+CDFG A
Sbjct: 131 RPG---KIDEKYIGVITREILIALKYIH--KDNIIHRDIKAANVLITNEGSIKLCDFGVA 185

Query: 550 CSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCY 729
             + +  K  Q  A          T  + +PE+I    G   D K DIW+LG+  Y++  
Sbjct: 186 AQLNQSTKRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEIAT 234

Query: 730 YTTPF-EKEGENAI-LNVKFQFPSYP--QYSDHIRNIITIMLNKDPIKRPNICQVLEQ-- 891
              P+ E E   A+ L  K + P      YS  ++  + + L++DP +R +   +L+   
Sbjct: 235 GNPPYCEIEALRAMQLITKSKPPRLEGRNYSPLLKEFVALCLDEDPKERMSAEDLLKTKF 294

Query: 892 VSKLQGVPCPIENFMLTRIKLQNSRNNSNK 981
           +   +  P  I   +++R  L   RN + K
Sbjct: 295 IKAHKLTPVSILKELISRYLLFRDRNKTLK 324

>TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8.279
           YLR096W
          Length = 1126

 Score = 77.0 bits (188), Expect = 3e-13
 Identities = 62/213 (29%), Positives = 108/213 (50%), Gaps = 2/213 (0%)
 Frame = +1

Query: 322 FLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENV 501
           ++L EY S G ++D++    +  L+E    K    +   +  +H     ++HRD+KIEN+
Sbjct: 178 YMLFEYVSGGQLLDYIIQ--HGSLREHHARKFTRGIASALQYLHANN--IVHRDLKIENI 233

Query: 502 LISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDE 681
           +IS +G+ KI DFG +       K+ Q   F         +  + +PE++ K S Y   E
Sbjct: 234 MISTSGEIKIIDFGLSNLF---DKSKQLHTFC-------GSLYFAAPELL-KASPYTGPE 282

Query: 682 KSDIWALGVFLYKLCYYTTPFEKEGENAI-LNVKFQFPSYPQY-SDHIRNIITIMLNKDP 855
             D+W+ GV LY L     PF+ E  + +   +K     YPQ+ S  + ++++ ML  DP
Sbjct: 283 -VDVWSFGVVLYVLVCGKVPFDDENSSVLHEKIKQGKVEYPQHLSIEVISLLSKMLVVDP 341

Query: 856 IKRPNICQVLEQVSKLQGVPCPIENFMLTRIKL 954
            +R ++ QV+E    ++G   P  +++  RI L
Sbjct: 342 HRRASLKQVVEHHWMVRGYDGPPPSYVPNRIPL 374

>YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}
           PKH1Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis; activates Ypk1p and Ykr2p, components of
           signaling cascade required for maintenance of cell wall
           integrity; redundant with Pkh2p
          Length = 766

 Score = 76.6 bits (187), Expect = 3e-13
 Identities = 60/205 (29%), Positives = 102/205 (49%), Gaps = 12/205 (5%)
 Frame = +1

Query: 304 QGEYEVFLLMEYCSRGGVIDFLNT-RLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHR 480
           Q E  ++ L+EY   G   DFL   + Y  L E       S +   V ++H +   +IHR
Sbjct: 194 QDEASLYFLLEYAPHG---DFLGLIKKYGSLNETCARYYASQIIDAVDSLHNIG--IIHR 248

Query: 481 DIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINT-----TAQYRSPE 645
           DIK EN+L+ +N   K+ DFG+A  +   P    +    + D+   +     TA+Y SPE
Sbjct: 249 DIKPENILLDKNMKVKLTDFGTAKILPEEPSNTADGK-PYFDLYAKSKSFVGTAEYVSPE 307

Query: 646 MI-DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE----NAILNVKFQFPS-YPQY 807
           ++ D Y+    D + DIWA G  LY++     PF+   E      ++ +++ F + +PQ 
Sbjct: 308 LLNDNYT----DSRCDIWAFGCILYQMLAGKPPFKAANEYLTFQKVMKIQYAFTAGFPQI 363

Query: 808 SDHIRNIITIMLNKDPIKRPNICQV 882
              +++++  +L +DP  R  I Q+
Sbjct: 364 ---VKDLVKKLLVRDPNDRLTIKQI 385

>YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}
            BCK1Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway, which
            controls cell integrity; upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1478

 Score = 77.0 bits (188), Expect = 3e-13
 Identities = 80/292 (27%), Positives = 129/292 (44%), Gaps = 16/292 (5%)
 Frame = +1

Query: 154  GTMACLKRVIVPDKSGLN--------TLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQG 309
            G M  +K+V VP  S  N         LR+EV  +K L  +  IV Y+       E K  
Sbjct: 1198 GEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLD-HLNIVQYLGF-----ENKNN 1251

Query: 310  EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIK 489
             Y +FL  EY + G V   +  R+Y R  E  I  + + V +G+A +H     ++HRD+K
Sbjct: 1252 IYSLFL--EYVAGGSVGSLI--RMYGRFDEPLIKHLTTQVLKGLAYLH--SKGILHRDMK 1305

Query: 490  IENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGY 669
             +N+L+ ++G  KI DFG    + R  K      + + D+ +  T  + +PEM+D   GY
Sbjct: 1306 ADNLLLDQDGICKISDFG----ISRKSKD----IYSNSDMTMRGTVFWMAPEMVDTKQGY 1357

Query: 670  PIDEKSDIWALGVFLYKLCYYTTPFEK-EGENAILNVKFQFPSYPQYSDHI-------RN 825
                K DIW+LG  + ++     P+   E   A+  +     + P   D +       RN
Sbjct: 1358 --SAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFKIGKSKSAPPIPEDTLPLISQIGRN 1415

Query: 826  IITIMLNKDPIKRPNICQVLEQVSKLQGVPCPIENFMLTRIKLQNSRNNSNK 981
             +      +P KRP   ++L             ++  L +    N + NS+K
Sbjct: 1416 FLDACFEINPEKRPTANELLSHPFSEVNETFNFKSTRLAKFIKSNDKLNSSK 1467

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa] {ON}
            similar to uniprot|P34244 Saccharomyces cerevisiae
            YKL101w serine/threonine-protein kinase
          Length = 1489

 Score = 77.0 bits (188), Expect = 3e-13
 Identities = 74/259 (28%), Positives = 123/259 (47%), Gaps = 10/259 (3%)
 Frame = +1

Query: 295  ELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLI 474
            E+ + + E++L++EY   G + D+L ++   +L E E +   + + QGV+  H     + 
Sbjct: 193  EVWENKSELYLVLEYVDGGELFDYLVSK--GKLSEPEAVHYFTQIIQGVSYCHSFN--IC 248

Query: 475  HRDIKIENVLISE-NGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI 651
            HRD+K EN+L+ + N   KI DFG A   L P K  + +    H         Y SPE++
Sbjct: 249  HRDLKPENLLLDKKNKVIKIADFGMAALEL-PNKLLETSCGSPH---------YASPEIV 298

Query: 652  --DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEG-ENAILNV---KFQFPSYPQYSD 813
                Y G P    SD+W+ G+ L+ L     PF  +  +  +L V   +FQ P  P  ++
Sbjct: 299  MGKPYHGGP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGRFQLP--PYLTN 352

Query: 814  HIRNIITIMLNKDPIKRPNICQVLEQ--VSKLQGVPCPIENFMLTRIKLQNSRNNSNKST 987
              +++IT +L  +P KR  I ++L    + K +  P  I    L    L   ++NS+   
Sbjct: 353  DAKDLITRILVTNPEKRLTINEILNHPLIKKYRNPPAHIRKLNL----LGRGKSNSDLHV 408

Query: 988  -SLNDTTNNSFNNELALDQ 1041
               N       N+E  +DQ
Sbjct: 409  LEYNTPATVCLNSEEDIDQ 427

>CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} similar
           to uniprot|P13185 Saccharomyces cerevisiae YDR122w KIN1
           or uniprot|P13186 Saccharomyces cerevisiae YLR096w KIN2
          Length = 944

 Score = 76.3 bits (186), Expect = 5e-13
 Identities = 56/214 (26%), Positives = 113/214 (52%), Gaps = 3/214 (1%)
 Frame = +1

Query: 322 FLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPP-LIHRDIKIEN 498
           ++  E+ S G ++D++    +  L+E    K+   +   ++A+ YL    ++HRD+KIEN
Sbjct: 167 YMFFEFISGGQLLDYIIQ--HGSLKENHARKVSRGI---LSALQYLHANNIVHRDLKIEN 221

Query: 499 VLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPID 678
           +++S+ G+ K+ DFG + ++  P K+ Q             +  + +PE++  +    + 
Sbjct: 222 IMLSKTGEIKLIDFGLS-NMYDPRKSLQTFC---------GSLYFAAPELLKAHP--YLG 269

Query: 679 EKSDIWALGVFLYKLCYYTTPFEKEGENAI-LNVKFQFPSYPQY-SDHIRNIITIMLNKD 852
            + D+W+ GV LY L     PF+ E  +A+   +K    +YPQ+ S  + ++++ +L  D
Sbjct: 270 PEVDVWSFGVVLYVLVCGKVPFDDENSSALHEKIKKGKVTYPQFLSIDVISLLSKILVVD 329

Query: 853 PIKRPNICQVLEQVSKLQGVPCPIENFMLTRIKL 954
           P KR  + QV+     L+G   P ++++  R+ L
Sbjct: 330 PQKRATLQQVVNHQWMLKGYDFPPQSYLPRRVPL 363

>KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly
           similar to uniprot|Q03306 Saccharomyces cerevisiae
           YDR466W
          Length = 653

 Score = 75.9 bits (185), Expect = 5e-13
 Identities = 75/285 (26%), Positives = 130/285 (45%), Gaps = 12/285 (4%)
 Frame = +1

Query: 64  VIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLL 243
           V +EK L  G ++ V+  R ++ +N         C K+ I+ ++  +  +  E D + LL
Sbjct: 11  VFLEK-LGQGSYSTVF--RAVERANGLRNYAIKVCSKKHIIRERK-VKYVTVEKDLLNLL 66

Query: 244 KGNKY--IVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKI 417
            G  +  +V    +      L       + ++E+ S G ++  +  R   RL E    +I
Sbjct: 67  AGGGHPGVVRLFCTFHDTDNL-------YYVLEFVSGGELLGLV--RRMGRLPEEWCRRI 117

Query: 418 MSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLR----PPKTPQE 585
            S +   V  MH     +IHRD+K ENVL+S+ G   I DFG+AC        P    + 
Sbjct: 118 ASQLVDTVDYMH--AKGVIHRDLKPENVLLSQEGRIVITDFGAACCASEGGSAPGAADRA 175

Query: 586 AAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE-- 759
           A+F+        TA+Y SPE++           SD+WALG  +Y+L     PF  + E  
Sbjct: 176 ASFV-------GTAEYVSPELL---LHSQCSFGSDVWALGCIIYQLTQGAPPFRGDTELQ 225

Query: 760 ----NAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQV 882
                  L+ ++ + + P     +++I+ +    DP++RP+  Q+
Sbjct: 226 SFEKIVALDYRWVYAAPPLIVALVQSILVL----DPLQRPSAKQL 266

>NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5.406
          Length = 1015

 Score = 76.3 bits (186), Expect = 5e-13
 Identities = 72/273 (26%), Positives = 124/273 (45%), Gaps = 10/273 (3%)
 Frame = +1

Query: 190 DKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFL 369
           D+  +  ++ EV  +  LK    I  Y  S+ + + L       +++MEYC+ G +   L
Sbjct: 73  DEDEVEDVQREVQFLSSLKQIPNITRYYGSYLKDTSL-------WIIMEYCAGGSLRSLL 125

Query: 370 NTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSA 549
                 ++ E  I  IM ++   +  +H  +  +IHRDIK  NVLI+  G  K+CDFG A
Sbjct: 126 RPG---KIDEKYIGVIMRELLVALKYIH--KDNVIHRDIKAANVLITNEGSVKLCDFGVA 180

Query: 550 CSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCY 729
             + +     Q  A          T  + +PE+I    G   D K DIW+LG+  Y++  
Sbjct: 181 AQLNQSTLRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIAT 229

Query: 730 YTTPF-EKEGENAILNVKFQFP---SYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVS 897
              P+ E E   A+  +    P       Y+  ++  I + L++DP +R +     E++S
Sbjct: 230 GNPPYCEVEALRAMQLITKSKPPRLESRSYTPLLKEFIALCLDEDPKERLS----AEELS 285

Query: 898 KLQGV------PCPIENFMLTRIKLQNSRNNSN 978
           K + +      P  I   +++R  L   RN ++
Sbjct: 286 KTKFIKAHKLTPVSILKELISRYLLFRDRNKAS 318

>TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {ON}
            Anc_8.652 YOR231W
          Length = 713

 Score = 75.9 bits (185), Expect = 5e-13
 Identities = 64/227 (28%), Positives = 99/227 (43%), Gaps = 17/227 (7%)
 Frame = +1

Query: 256  YIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHR---LQEFEILKIMSD 426
            YIV Y    A           +F+ MEY   GG +D +   L  R   + E  + KI   
Sbjct: 484  YIVRYYGMFADNQRTS-----IFIAMEYMG-GGSLDGIYKHLLERGGRIGEKVLGKIAES 537

Query: 427  VCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHD 606
            V +G++ +H  +  +IHRDIK +N+L++E G  K+CDFG +   +    T          
Sbjct: 538  VLRGLSYLH--EKKVIHRDIKPQNILLNELGQVKLCDFGVSGEAVNSLAT---------- 585

Query: 607  IMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAIL----- 771
                 T+ Y +PE I    G P     D+W+LG+ L ++     PF  E     L     
Sbjct: 586  -TFTGTSFYMAPERI---QGQPYSVTCDVWSLGLTLLEVAEAKFPFGSENLKTNLAPIDL 641

Query: 772  ---------NVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVL 885
                     N+K +  ++  +S   R+ I   L KDP  RP+  Q++
Sbjct: 642  LMLILTFTPNLKEEPENHIVWSSSFRSFIDYCLKKDPSDRPSPRQMI 688

>CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096w KIN2 ser/thr protein kinase
          Length = 1192

 Score = 76.3 bits (186), Expect = 5e-13
 Identities = 60/215 (27%), Positives = 108/215 (50%), Gaps = 4/215 (1%)
 Frame = +1

Query: 322 FLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENV 501
           ++L EY + G ++D++    +  L+E    K    V   +  +H     ++HRD+KIEN+
Sbjct: 208 YMLFEYVAGGQLLDYIIQ--HGSLREHHARKFARGVASALQYLHANN--IVHRDLKIENI 263

Query: 502 LISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYSGYPI 675
           +IS +G+ KI DFG + +V    K       +H       +  + +PE++    Y+G  +
Sbjct: 264 MISNSGEIKIIDFGLS-NVYDTRKQ------LH---TFCGSLYFAAPELLKAHPYTGPEV 313

Query: 676 DEKSDIWALGVFLYKLCYYTTPFEKEGENAI-LNVKFQFPSYPQY-SDHIRNIITIMLNK 849
               D+W+ GV LY L     PF+ E  + +   +K     YPQ+ S  + ++++ ML  
Sbjct: 314 ----DVWSFGVVLYVLVCGKVPFDDENSSVLHEKIKRGKVEYPQHLSIEVMSLLSKMLVV 369

Query: 850 DPIKRPNICQVLEQVSKLQGVPCPIENFMLTRIKL 954
           DP +R ++ QV+E     +G   P  +++  RI L
Sbjct: 370 DPSRRASLKQVVEHPWMTKGYDTPAPSYVPNRIPL 404

>TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1218

 Score = 76.3 bits (186), Expect = 5e-13
 Identities = 62/224 (27%), Positives = 109/224 (48%), Gaps = 5/224 (2%)
 Frame = +1

Query: 322 FLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENV 501
           ++L EY S G ++D++    +  L+E    K    +   +  +H     ++HRD+KIEN+
Sbjct: 254 YMLFEYVSGGQLLDYIIQ--HGSLREHHARKFTRGIASALQYLHGNN--IVHRDLKIENI 309

Query: 502 LISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINT---TAQYRSPEMIDKYSGYP 672
           +IS +GD KI DFG   S L   K             +NT   +  + +PE++ K + Y 
Sbjct: 310 MISTSGDIKIIDFG--LSNLYDSKK-----------QLNTFCGSLYFAAPELL-KANPY- 354

Query: 673 IDEKSDIWALGVFLYKLCYYTTPFEKEGENAI-LNVKFQFPSYPQY-SDHIRNIITIMLN 846
           +  + DIW+ GV LY L     PF+ E  + +   +K     YPQ+ S  + ++++ ML 
Sbjct: 355 VGPEVDIWSFGVVLYVLACGKVPFDDENSSVLHEKIKQGKVDYPQHLSIEVISLLSKMLV 414

Query: 847 KDPIKRPNICQVLEQVSKLQGVPCPIENFMLTRIKLQNSRNNSN 978
            DP KR ++ Q++      +G      +++  R+ +     N N
Sbjct: 415 VDPKKRASLQQIVNHPWMTRGFDTKAPSYLPLRVPMSIDMINHN 458

>CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31
          Length = 1336

 Score = 76.3 bits (186), Expect = 6e-13
 Identities = 53/163 (32%), Positives = 77/163 (47%), Gaps = 2/163 (1%)
 Frame = +1

Query: 391  LQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPP 570
            + E E   +   V  GV  +H     ++HRDIK EN+++   G  KI DFGSA  V   P
Sbjct: 1182 MTEIEAKLLFKQVVSGVKHLH--DQGIVHRDIKDENIIVDSQGFVKIIDFGSAAYVKSGP 1239

Query: 571  KTPQEAAFIHHDIMINTTAQYRSPEMI--DKYSGYPIDEKSDIWALGVFLYKLCYYTTPF 744
                       D+ +  T  Y +PE++    Y G P     DIWA+G+ LY + +   PF
Sbjct: 1240 ----------FDVFVG-TIDYAAPEVLGGSPYEGKP----QDIWAIGILLYTIVFKENPF 1284

Query: 745  EKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNI 873
                E  IL  + +F S    S+    +I  +LN++  KRP I
Sbjct: 1285 YNIDE--ILEGELKFNSSELVSEQCTTLIAKILNRNVQKRPTI 1325

>YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One of two
            (see also PSK2) PAS domain containing S/T protein
            kinases; coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1356

 Score = 76.3 bits (186), Expect = 6e-13
 Identities = 54/163 (33%), Positives = 78/163 (47%), Gaps = 2/163 (1%)
 Frame = +1

Query: 391  LQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPP 570
            + EFE   I   V  G+  +H     ++HRDIK ENV++   G  KI DFGSA  V   P
Sbjct: 1202 MTEFEAKLIFKQVVAGIKHLH--DQGIVHRDIKDENVIVDSKGFVKIIDFGSAAYVKSGP 1259

Query: 571  KTPQEAAFIHHDIMINTTAQYRSPEMI--DKYSGYPIDEKSDIWALGVFLYKLCYYTTPF 744
                       D+ +  T  Y +PE++  + Y G P     DIWA+G+ LY + +   PF
Sbjct: 1260 ----------FDVFVG-TIDYAAPEVLGGNPYEGQP----QDIWAIGILLYTVVFKENPF 1304

Query: 745  EKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNI 873
                E  IL    +F +  + S+    +I  +LN+   KRP I
Sbjct: 1305 YNIDE--ILEGDLKFNNAEEVSEDCIELIKSILNRCVPKRPTI 1345

>NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1411

 Score = 76.3 bits (186), Expect = 6e-13
 Identities = 54/167 (32%), Positives = 81/167 (48%), Gaps = 1/167 (0%)
 Frame = +1

Query: 391  LQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPP 570
            + EFE   I   V  G+  +H+    ++HRDIK ENV++   G  KI DFGSA  V   P
Sbjct: 1257 MTEFEAKLIFKQVVSGIKHLHH--QGIVHRDIKDENVIVDSKGLVKIIDFGSAAYVKSGP 1314

Query: 571  KTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEK-SDIWALGVFLYKLCYYTTPFE 747
                       D+ +  T  Y +PE++   SG P + K  DIWALG+ LY + +   PF 
Sbjct: 1315 ----------FDVFVG-TIDYAAPEVL---SGEPYEGKPQDIWALGILLYTIVFKENPFY 1360

Query: 748  KEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLE 888
               E  IL    +F S  + ++    +I  +L +    RP I ++ +
Sbjct: 1361 NIDE--ILEGDLKFDSNTEVTEDCMELIKKVLIRQVRNRPAIDEIFD 1405

>ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YHR102W
            (KIC1)
          Length = 947

 Score = 75.9 bits (185), Expect = 6e-13
 Identities = 85/349 (24%), Positives = 152/349 (43%), Gaps = 17/349 (4%)
 Frame = +1

Query: 25   YEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGL 204
            +++  V+  G   V+ + Y A     QVY+V+V++     +E+                 
Sbjct: 25   FKRTEVIGRGKFGVVYKAYHA--KTKQVYAVKVLNLDCPEDEV----------------- 65

Query: 205  NTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNT-RL 381
              ++ E+  +  LK    I  Y  S+   ++L       +++MEYC+ G +   L   ++
Sbjct: 66   EDVQKEIQFLASLKQVPNITRYYGSYLYDTKL-------WVIMEYCAGGSLRTLLRPGKI 118

Query: 382  YHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVL 561
              +     + K++      +A ++  +  +IHRDIK  NVLI+  G  K+CDFG A    
Sbjct: 119  DEKYLGVIVRKLL------IALVYIHKDNVIHRDIKAANVLITNEGHVKLCDFGVAA--- 169

Query: 562  RPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTP 741
                  Q  A  H    +  T  + +PE+I    G   + K+DIW+LG+  Y++     P
Sbjct: 170  ------QLTAANHKRQTMAGTPYWMAPEVI--MEGVYYNTKADIWSLGITAYEIATGNPP 221

Query: 742  F-EKEGENAI-LNVKFQFPSYP--QYSDHIRNIITIMLNKDPIKRPNICQVLEQ--VSKL 903
            + + E   A+ L  K + P      YS  ++  I + L++DP +RP    +L    V   
Sbjct: 222  YCDVEALRAMQLITKSKPPRLEGRNYSPLLKEFIALCLDEDPEERPTAEDLLSSKFVKAH 281

Query: 904  QGVPCPIENFMLTRIKLQNSRNN----------SNKSTSLNDTTNNSFN 1020
            +G    I   +++R  L + ++N           +   S N+TTN   N
Sbjct: 282  KGSSATILKELISRYLLFSEKHNRESVLIPLDEDDPHKSANNTTNGGDN 330

>CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} similar
           to uniprot|P38991 Saccharomyces cerevisiae YPL209c IPL1
           ser/thr protein kinase
          Length = 358

 Score = 73.9 bits (180), Expect = 6e-13
 Identities = 79/282 (28%), Positives = 121/282 (42%), Gaps = 11/282 (3%)
 Frame = +1

Query: 70  IEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVI---VPDKSGLNTLRAEVDAMKL 240
           + + L  G F +VY VR         + G +  LK +    +   + L  L+ EVD    
Sbjct: 102 VGRKLGKGKFGKVYCVR-------HKKSGFICALKAIEKNEILQFNLLKQLKREVDIQLG 154

Query: 241 LKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQE---FEIL 411
           +     I  Y   H ++         V+LLME+         +N  LY  L+    F  +
Sbjct: 155 MDHPNIIKLYAHFHDEK--------RVYLLMEHS--------INGELYKSLKNNGPFNDV 198

Query: 412 KIMSDVCQGVAAMHYLQPP-LIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEA 588
                + Q   A+HY+    +IHRD+K ENVLI  +   K+ DFG   S+L P  + ++ 
Sbjct: 199 LASHYIYQIADALHYMHKKRIIHRDVKPENVLIGFDNVVKLADFG--WSILNPEGSKRKT 256

Query: 589 AFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE--- 759
                   +  T  Y SPEMI        DE+ D+WALGV  Y+L     PFE+  +   
Sbjct: 257 --------LCGTIDYLSPEMITPRE---YDEQVDVWALGVLAYELVVGVPPFEENSKELT 305

Query: 760 -NAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQV 882
              IL     FP     S   +++I+ +L  D  +R ++  V
Sbjct: 306 YKRILKCDLNFPE--SISKDAKDLISKLLVTDTTQRLSLTGV 345

>KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 993

 Score = 75.9 bits (185), Expect = 7e-13
 Identities = 59/197 (29%), Positives = 98/197 (49%), Gaps = 4/197 (2%)
 Frame = +1

Query: 304 QGEYEVFLLMEYCSRGGVIDFLNT-RLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHR 480
           Q E  ++ L+EY   G   DFL+  + Y  L +   +   + +   +  +H  Q  +IHR
Sbjct: 232 QDEASLYFLLEYAPNG---DFLSVIKKYGSLNQDCSVYYSAQILDAIDYLH--QKGVIHR 286

Query: 481 DIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI-DK 657
           DIK EN+L+ ++   K+ DFG+A  ++   +T Q    +        TA+Y SPE++ D 
Sbjct: 287 DIKPENILLDKDMKVKLTDFGTA-KLVEKDETTQTYNLLERSKSFVGTAEYVSPELLNDN 345

Query: 658 YSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILN--VKFQFPSYPQYSDHIRNII 831
           Y    +D K DIWA G  L+++     PF+   E       +K Q+     +   IR++I
Sbjct: 346 Y----VDYKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLIIRDLI 401

Query: 832 TIMLNKDPIKRPNICQV 882
             +L K+P +R +  QV
Sbjct: 402 KQILVKNPEQRLDTLQV 418

>CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON}
           similar to uniprot|Q12003 Saccharomyces cerevisiae
           YPL236c
          Length = 399

 Score = 74.3 bits (181), Expect = 7e-13
 Identities = 47/151 (31%), Positives = 73/151 (48%), Gaps = 7/151 (4%)
 Frame = +1

Query: 475 HRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMID 654
           H+ +   N++ S NG   I + GS        KT ++   +   +  N  + Y +PE +D
Sbjct: 249 HKMLSPSNIIFSSNGLPIISELGSCSKADVEIKTAKQLNRLREWVDDNFNS-YMAPEFLD 307

Query: 655 KYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE-------NAILNVKFQFPSYPQYSD 813
             +   +  K D+W+ G   Y L +   PFE+E +        AI   KF FPS  +YSD
Sbjct: 308 LKTNSKLSTKVDVWSFGCICYALLFGMNPFEREEQLYGASIKYAISTGKFSFPSQSRYSD 367

Query: 814 HIRNIITIMLNKDPIKRPNICQVLEQVSKLQ 906
            I +II   L  DP +RP++  VL  + +LQ
Sbjct: 368 SILDIIRSCLQVDPSERPSVSIVLNNLQQLQ 398

>TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON}
           Anc_8.140 YGL179C
          Length = 1038

 Score = 75.9 bits (185), Expect = 7e-13
 Identities = 74/257 (28%), Positives = 117/257 (45%), Gaps = 36/257 (14%)
 Frame = +1

Query: 211 LRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI----DFLNTR 378
           ++ E++ MK    N++IV  ++      +LK  +  ++L++EYCSRG V     D + T 
Sbjct: 193 IKREINIMKRCN-NEHIVKLLEV---LDDLKSKK--IYLILEYCSRGEVKWCPGDVMETE 246

Query: 379 LYHR-LQEFE-ILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFG--- 543
                L  F+ + KI+ DV  G+  +H     +IHRDIK  N+L+SE+G  KI DFG   
Sbjct: 247 ARGPPLLSFQRVRKILRDVTLGLEYLH--SRGIIHRDIKPANLLLSEDGSVKISDFGVSV 304

Query: 544 ----------SACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDI 693
                     ++   L   KT    AF   +I + + A+ +     D      +    D+
Sbjct: 305 ISHNKEENGTNSIDELELAKTAGTPAFFAPEICLGSEAKSKFNLKKDPSKDSKLIYMVDV 364

Query: 694 WALGVFLYKLCYYTTPFEKEGE----NAILNVKFQFPSY-------------PQYSDHIR 822
           WALG  LY L +   PF  + E      I+N    FP Y              +  +  +
Sbjct: 365 WALGTTLYCLLFGMLPFISDYELKLFEKIVNDPLIFPDYEIMQKNGTSNIFSEEEYEAAK 424

Query: 823 NIITIMLNKDPIKRPNI 873
           NI+  +L K+P KR +I
Sbjct: 425 NILKELLTKNPAKRMSI 441

>KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1142

 Score = 75.9 bits (185), Expect = 7e-13
 Identities = 59/215 (27%), Positives = 107/215 (49%), Gaps = 4/215 (1%)
 Frame = +1

Query: 322 FLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENV 501
           ++L EY S G ++D++    +  L+E    K    +   +  +H     ++HRD+KIEN+
Sbjct: 284 YMLFEYVSGGQLLDYIIQ--HGSLRERSARKFARGIASALQYLHLNN--IVHRDLKIENI 339

Query: 502 LISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMID--KYSGYPI 675
           +IS +G+ KI DFG + ++  P K       +H       +  + +PE++    Y+G  +
Sbjct: 340 MISTSGEIKIIDFGLS-NMFNPKKQ------LH---TFCGSLYFAAPELLKACPYTGPEV 389

Query: 676 DEKSDIWALGVFLYKLCYYTTPFEKEGENAI-LNVKFQFPSYPQY-SDHIRNIITIMLNK 849
               D+W+ GV LY L     PF+ E  + +   +K     YPQ+ S  + ++++ ML  
Sbjct: 390 ----DVWSFGVVLYVLVCGKVPFDDENSSVLHEKIKQGKVEYPQHLSIEVISLLSKMLVV 445

Query: 850 DPIKRPNICQVLEQVSKLQGVPCPIENFMLTRIKL 954
           DP KR  + QV+      +G   P  +++  R+ L
Sbjct: 446 DPSKRATLKQVVNHQWMQRGYDFPAPSYIPHRVPL 480

>Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {ON}
           YPL209C (REAL)
          Length = 368

 Score = 73.9 bits (180), Expect = 7e-13
 Identities = 58/190 (30%), Positives = 94/190 (49%), Gaps = 5/190 (2%)
 Frame = +1

Query: 310 EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYL-QPPLIHRDI 486
           E  V+LLMEY   G +   L +        F  +     + Q   A+ Y+ +  +IHRDI
Sbjct: 175 EKRVYLLMEYLVNGEMYKLLRSH-----GPFNDILASDYIYQIANALDYMHRKHIIHRDI 229

Query: 487 KIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSG 666
           K+EN++I  N   K+ DFG   S++ PP+  ++         +  T  Y SPEM++ +  
Sbjct: 230 KLENIIIGFNNIIKLTDFG--WSIINPPENRRKT--------VCGTIDYLSPEMVE-FRE 278

Query: 667 YPIDEKSDIWALGVFLYKLCYYTTPFEKEGENA----ILNVKFQFPSYPQYSDHIRNIIT 834
           Y  D   D+WALGV  ++L     PFE+E ++     I  +  +FP+    S   +++I 
Sbjct: 279 Y--DHTVDVWALGVLTFELLTGAPPFEEEMKDTTYKRIAALDIKFPN--NISQDAQDLIL 334

Query: 835 IMLNKDPIKR 864
            +L  DP +R
Sbjct: 335 KLLKYDPKER 344

>NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {ON} 
          Length = 412

 Score = 74.3 bits (181), Expect = 7e-13
 Identities = 78/285 (27%), Positives = 125/285 (43%), Gaps = 13/285 (4%)
 Frame = +1

Query: 70  IEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGL------NTLRAEVDA 231
           I K L  G F +VY V+         E G +  LK +   DKS +         R EV+ 
Sbjct: 156 IGKKLGKGKFGKVYCVK-------HKESGFICALKAM---DKSEIIQYNLQRQFRREVEI 205

Query: 232 MKLLKGNKYIVSYIDSHAQRSELKQGEYE---VFLLMEYCSRGGVIDFLNTRLYHRLQEF 402
              L           +H   ++L    Y+   V+L+MEY   G +   L  R +    + 
Sbjct: 206 QTSL-----------NHPNLTKLYGHFYDDKRVYLIMEYLVYGELYKLL--RSHGPFNDI 252

Query: 403 EILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQ 582
              + +  +   +  +H  +  +IHRD+K EN+LI  N   K+ DFG   S++ P    +
Sbjct: 253 IASRFVYQIADALNHLH--EKGIIHRDLKPENILIGFNNVLKLTDFG--WSIINPKGVKR 308

Query: 583 EAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE- 759
           +         +  T  Y SPEMI        D+  D+WALGV  Y+L     PFE++ + 
Sbjct: 309 KT--------LCGTIDYLSPEMI---RSREYDDTVDVWALGVLTYELVAGDPPFEEDSKE 357

Query: 760 ---NAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVL 885
                IL  + +FP     S  +R++I+ +L  DP +R  + +V+
Sbjct: 358 LTYKRILKGEIRFPG--TVSQDVRDLISRLLKNDPKERILLKEVM 400

>TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1.271
            YJL095W
          Length = 1434

 Score = 75.9 bits (185), Expect = 7e-13
 Identities = 70/260 (26%), Positives = 120/260 (46%), Gaps = 15/260 (5%)
 Frame = +1

Query: 154  GTMACLKRVIVPD-----KSGLNTLRAEVDAMKLLKGNKY--IVSYIDSHAQRSELKQGE 312
            G M  +K++ VP      ++ LNT+ A    +  LK   +  IV Y+       E+K   
Sbjct: 1158 GEMMAVKQIEVPSYGSQSETMLNTVEAMKSEVSTLKDLDHLNIVQYLGF-----EMKHNI 1212

Query: 313  YEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKI 492
            Y +FL  EY + G V   +  R+Y R  +  I  + + V +G++ +H     ++HRD+K 
Sbjct: 1213 YSLFL--EYVAGGSVGSLI--RMYGRFDDKLIRHLTNQVLEGLSYLH--SQGILHRDMKA 1266

Query: 493  ENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYP 672
            +N+L+ ++G  KI DFG +           E  + + ++ +  T  + +PEM+D   GY 
Sbjct: 1267 DNLLLDQDGICKISDFGIS--------KKSEDIYSNSEMTMRGTVFWMAPEMVDTKQGY- 1317

Query: 673  IDEKSDIWALGVFLYKLCYYTTP---FEKEGENAILNVKFQFPSYPQ-----YSDHIRNI 828
             + K DIW+LG  + ++     P   FE       +      P  P+      S   +N 
Sbjct: 1318 -NAKVDIWSLGCVVLEMFAGKRPWSNFEVVTAMYKIGQSKSAPPIPEDTKDLISPTAKNF 1376

Query: 829  ITIMLNKDPIKRPNICQVLE 888
            +    + DP +RP   Q+LE
Sbjct: 1377 LNQCFHIDPKERPTAGQLLE 1396

>Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}
            (4910..5845,5849..7711) [2799 nt, 933 aa]
          Length = 932

 Score = 75.5 bits (184), Expect = 8e-13
 Identities = 53/178 (29%), Positives = 81/178 (45%), Gaps = 2/178 (1%)
 Frame = +1

Query: 355  VIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKIC 534
            + DF+  +   ++ E E   I   +  G+  +H L   +IHRDIK EN++I   G  ++ 
Sbjct: 766  LFDFIEKK--DKIDEVEQKLIFKQIVAGIKHIHGLG--IIHRDIKTENIIIDSEGCVQVI 821

Query: 535  DFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYSGYPIDEKSDIWALGV 708
            DFGSA      P             + + T  Y SPE++  + Y G P     D+WALG+
Sbjct: 822  DFGSAAYATNGPFQ-----------VFHGTIDYASPEVLKGEPYEGKP----QDVWALGI 866

Query: 709  FLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQV 882
             LY + +  TPF    E     ++         SD  R +I  ML+K    RP I ++
Sbjct: 867  LLYIITFKQTPFNSVAEIIENELEIDPAHSENVSDQCRVLIHKMLDKKAWARPKISEI 924

>ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {ON}
           weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 943

 Score = 75.5 bits (184), Expect = 8e-13
 Identities = 80/334 (23%), Positives = 147/334 (44%), Gaps = 6/334 (1%)
 Frame = +1

Query: 4   NQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVI 183
           NQ     +++  V+  G   V+ + + A     QVY+++V++  +               
Sbjct: 22  NQDVTSVFKRTEVIGTGKFGVVYKGHHA--RTKQVYAIKVLNLDS--------------- 64

Query: 184 VPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVID 363
             D+  +  ++ EV  +  +K    I  Y  S+ + + L       ++++EYC+ G +  
Sbjct: 65  --DEDEVEDVQREVQFLASMKQTPNITHYYGSYLKDTTL-------WIIIEYCAGGSLRT 115

Query: 364 FLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFG 543
            L      ++ E  I  IM +V   +  +H  +  +IHRDIK  NVLI+  G  K+CDFG
Sbjct: 116 LLRPG---KIDEKYIGIIMREVLIALKYIH--KDNVIHRDIKAANVLITNEGHVKLCDFG 170

Query: 544 SACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKL 723
            A  + +     Q  A          T  + +PE+I    G   D K DIW+LG+  Y++
Sbjct: 171 VAAQLNQSSLKRQTMA---------GTPYWMAPEVI--MEGVSYDTKVDIWSLGITTYEI 219

Query: 724 CYYTTPF-EKEGENAI-LNVKFQFPSYP--QYSDHIRNIITIMLNKDPIKRPNICQVLEQ 891
                P+ + E   A+ L  K + P      YS  ++  I + L++DP +R +   +L+ 
Sbjct: 220 ATGNPPYCDVEALRAMQLITKSKPPRLEGRHYSPMLKEFIALCLDEDPKERLSADDLLKS 279

Query: 892 --VSKLQGVPCPIENFMLTRIKLQNSRNNSNKST 987
             +   +     +   ++TR  L   +  S +S+
Sbjct: 280 KLIKHHRTASTTVLKELITRYLLFRDKTKSKRSS 313

>NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {ON}
           Anc_8.279
          Length = 1049

 Score = 75.5 bits (184), Expect = 9e-13
 Identities = 54/190 (28%), Positives = 97/190 (51%), Gaps = 2/190 (1%)
 Frame = +1

Query: 322 FLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENV 501
           ++L EY S G ++D++    +  L+E         +C  +  +H     ++HRD+KIEN+
Sbjct: 176 YMLFEYVSGGQLLDYIIQ--HGSLKESRARTFTRQICSALKYLH--SHNIVHRDLKIENI 231

Query: 502 LISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDE 681
           +IS++G+ K+ DFG +    +  K       ++          + +PE++ K + Y I  
Sbjct: 232 MISKDGNIKLIDFGLSNLYDKCNKLKTYCGSLY----------FAAPELL-KATPY-IGP 279

Query: 682 KSDIWALGVFLYKLCYYTTPFEKEGENAI-LNVKFQFPSYPQY-SDHIRNIITIMLNKDP 855
           + D+W+ GV LY L     PF+ E  N +   +K     YPQ+ S  + ++++ ML  DP
Sbjct: 280 EIDVWSFGVVLYVLVCGKVPFDDENSNVLHEKIKQGKVFYPQFLSIEVISLLSKMLVVDP 339

Query: 856 IKRPNICQVL 885
            KR  + QV+
Sbjct: 340 FKRATLDQVM 349

>SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1062

 Score = 75.5 bits (184), Expect = 9e-13
 Identities = 59/213 (27%), Positives = 105/213 (49%), Gaps = 2/213 (0%)
 Frame = +1

Query: 322 FLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENV 501
           ++L EY S G ++D++    +  L+E    K    +   +  +H     ++HRD+KIEN+
Sbjct: 179 YMLFEYVSGGQLLDYIIQ--HGSLRERHARKFARGIASALQYLHMNN--IVHRDLKIENI 234

Query: 502 LISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDE 681
           +IS +G+ KI DFG   S +  PK       +H       +  + +PE++  +    I  
Sbjct: 235 MISTSGEIKIIDFG--LSNMYDPKKQ-----LH---TFCGSLYFAAPELLKAHP--YIGP 282

Query: 682 KSDIWALGVFLYKLCYYTTPFEKEGENAI-LNVKFQFPSYPQY-SDHIRNIITIMLNKDP 855
           + D+W+ GV LY L     PF+ E  + +   +K     YPQ+ S  + ++++ ML  DP
Sbjct: 283 EVDVWSFGVVLYVLVCGKVPFDDENASVLHEKIKQGKVEYPQHLSIEVISLLSKMLVVDP 342

Query: 856 IKRPNICQVLEQVSKLQGVPCPIENFMLTRIKL 954
            KR  + QV+      +G   P  +++  R+ L
Sbjct: 343 SKRATLKQVVSHQWMQRGYDFPAPSYLPYRVPL 375

>NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86
          Length = 1082

 Score = 75.5 bits (184), Expect = 9e-13
 Identities = 66/234 (28%), Positives = 106/234 (45%), Gaps = 7/234 (2%)
 Frame = +1

Query: 202  LNTLRAEVDAMKLL--KGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRG--GVIDFL 369
            L T+ +E+  M  L  K +K IV+ +D           E E +  ME  + G  G ID  
Sbjct: 869  LGTIPSEIQIMATLNKKPHKNIVALLDFF---------EDEEYYYMETPAHGETGSIDLF 919

Query: 370  NT-RLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGS 546
            +   L   + E+E   I   V  G+  +H     ++HRDIK ENV++   G  K+ D+GS
Sbjct: 920  DLIELKKNMTEYEEKLIFKQVVSGLKHLH--DQGIVHRDIKDENVIVDSKGHVKLIDYGS 977

Query: 547  ACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYSGYPIDEKSDIWALGVFLYK 720
            A      P           D+ +  T  Y +PE++    Y G P     DIWA+G+ LY 
Sbjct: 978  AAYTKSGP----------FDVFVG-TIDYAAPEVLGGSVYDGKP----QDIWAIGILLYT 1022

Query: 721  LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQV 882
            + +   PF    E  I++ + +F      S+    +I  +LN+  + RP + ++
Sbjct: 1023 IIFKENPFYNIDE--IMDGELRFNDAGNTSEACIKLIKKILNRSIVDRPCVDEI 1074

>Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii AFL101C
          Length = 366

 Score = 73.6 bits (179), Expect = 9e-13
 Identities = 82/275 (29%), Positives = 115/275 (41%), Gaps = 12/275 (4%)
 Frame = +1

Query: 76  KYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNT---LRAEVDAMKLLK 246
           K L  G F +VY VR I S       G +  LK +   +    N     R EV+    L+
Sbjct: 112 KILGKGKFGKVYCVRHIPS-------GFICALKAMEKKEIIQYNIEKQFRREVEIQSSLR 164

Query: 247 GNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSD 426
                  Y   H ++         V+L+MEY   G +   L  R       F        
Sbjct: 165 HPNLTQLYGYFHDEK--------RVYLVMEYLVNGELYKHLKGR-----NHFSDEVASYY 211

Query: 427 VCQGVAAMHYL-QPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHH 603
           V Q   A+ Y+ +  ++HRDIK EN++I  N   K+ DFG   SV+      ++      
Sbjct: 212 VYQMAGALDYMHERNILHRDIKPENIIIGFNNVIKLTDFG--WSVINSKGFKRKT----- 264

Query: 604 DIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE----NAIL 771
              +  T  Y SPE+I        DEK D+WALGV  Y+L   + PFE+E +      IL
Sbjct: 265 ---LCGTVDYLSPELIKSRE---YDEKVDVWALGVLTYELLVGSPPFEEESKELTYKRIL 318

Query: 772 NVKFQFPSYPQYSDHI----RNIITIMLNKDPIKR 864
                FP      DHI    R++I+ +L  DP  R
Sbjct: 319 KRNLVFP------DHIDPDARHLISRLLEYDPANR 347

>Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W
            (REAL)
          Length = 716

 Score = 75.1 bits (183), Expect = 9e-13
 Identities = 70/277 (25%), Positives = 125/277 (45%), Gaps = 14/277 (5%)
 Frame = +1

Query: 76   KYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNK 255
            + L  G   +VY VR  D+    N++  +  L +  +  +  +  +  E + +     + 
Sbjct: 324  RLLGQGDVGKVYLVRERDT----NQIFALKVLSKHEMIKRKKIKRVLTEQEILAT-SDHP 378

Query: 256  YIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQ 435
            +IV+   S        Q E  ++L MEYC  G     L TR   R+ E +     S+V  
Sbjct: 379  FIVTLYHSF-------QTEDFLYLCMEYCMGGEFFRALQTRKSKRITEEDAKFYASEVVA 431

Query: 436  GVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVL--RPPKTPQEAAFIHHDI 609
             +  +H L    I+RD+K EN+L+ ++G   + DF  +      R P T +++ ++   +
Sbjct: 432  ALEYLHLLG--FIYRDLKPENILLHQSGHVMLSDFDLSIQATGSRDP-TMKDSTYLDTKV 488

Query: 610  MINT--------TAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGEN- 762
              +         T +Y +PE+I    G       D W LG+ +Y++ +  TPF+ +  N 
Sbjct: 489  CSDGFRTNSFVGTEEYLAPEVI---RGNGHTAAVDWWTLGILVYEMLFGCTPFKGDNSNE 545

Query: 763  ---AILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKR 864
                IL    +FP   + S H +++I  +LNK+  KR
Sbjct: 546  TFSKILTEDVKFPHDKEISKHCKDLIKRLLNKNESKR 582

>SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] {ON}
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1274

 Score = 75.5 bits (184), Expect = 9e-13
 Identities = 65/231 (28%), Positives = 102/231 (44%), Gaps = 4/231 (1%)
 Frame = +1

Query: 202  LNTLRAEVDAMKLL--KGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNT 375
            L T+ +E+  M  L  K ++ I++ +D        +  +Y       +   G +  F   
Sbjct: 1061 LGTIPSEIQIMATLNKKPHENILTLLDF------FEDDDYYYIETPMHGETGSIDLFDLI 1114

Query: 376  RLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACS 555
             L   + E E   I   V  G+  +H     ++HRDIK EN+++   G  K+ DFGSA  
Sbjct: 1115 ELKTNMTEHEAKLIFKQVASGIKHLH--DNGIVHRDIKDENIIVDNKGFVKLIDFGSAAY 1172

Query: 556  VLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYSGYPIDEKSDIWALGVFLYKLCY 729
            V   P           D+ +  T  Y +PE++  D Y G P     DIWA+GV LY + +
Sbjct: 1173 VKSGP----------FDVFVG-TIDYAAPEVLGGDPYEGKP----QDIWAIGVLLYTIIF 1217

Query: 730  YTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQV 882
               PF    E  IL+   +  S    S+    +I  +LN+   KRP I ++
Sbjct: 1218 KENPFYNIDE--ILDGDLRISSSVTVSEECIALIRRILNRSVPKRPTIEEI 1266

>Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}
            complement(18696..23039) [4344 nt, 1448 aa]
          Length = 1447

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 83/310 (26%), Positives = 135/310 (43%), Gaps = 18/310 (5%)
 Frame = +1

Query: 154  GTMACLKRVIVPDKSGL---------NTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQ 306
            G M  +K+V VP K GL         + LR EV  +K L  +  IV Y+   A     K 
Sbjct: 1163 GEMMAVKQVEVP-KYGLQNETVVNTVDALRLEVSTLKDLD-HLNIVQYLGFEA-----KN 1215

Query: 307  GEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDI 486
            G Y +FL  EY + G V   +  R+Y R  +  I  +   V QG++ +H     ++HRD+
Sbjct: 1216 GIYSLFL--EYVAGGSVGSLI--RMYGRFDDILIRHLTIQVLQGLSYLH--SRGILHRDM 1269

Query: 487  KIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSG 666
            K +N+L+ ++G  KI DFG +              + + ++ +  T  + +PEM+D   G
Sbjct: 1270 KADNLLLDQDGVCKISDFGIS--------RKSNDIYSNSEMTMKGTVFWMAPEMVDTKQG 1321

Query: 667  YPIDEKSDIWALGVFLYKLCYYTTP---FEKEGENAILNVKFQFPSYPQ-----YSDHIR 822
            Y    K DIW+LG  + ++     P   FE       +      P  P+      S++ +
Sbjct: 1322 Y--SAKVDIWSLGCIVLEMFAGKRPWSNFEVVAAMFKIGQAKSAPPIPEDTLPLISENAK 1379

Query: 823  NIITIMLNKDPIKRPNICQVLEQ-VSKLQGVPCPIENFMLTRIKLQNSRNNSNKSTSLND 999
              +      DP KRP   ++L    SK+      + +F  T++      N+   S+ L  
Sbjct: 1380 EFLDCCFEIDPEKRPTADKLLSHPFSKVNN----LFDFKKTKLAKFIKSNDKLNSSELRV 1435

Query: 1000 TTNNSFNNEL 1029
             +     NEL
Sbjct: 1436 PSQERKMNEL 1445

>SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} similar
           to uniprot|Q03306 Saccharomyces cerevisiae YDR466W
          Length = 784

 Score = 75.1 bits (183), Expect = 1e-12
 Identities = 78/292 (26%), Positives = 131/292 (44%), Gaps = 17/292 (5%)
 Frame = +1

Query: 58  HQVIIEKYLACGGFAQVYSVRVIDSSNARNELGT-------MACLKRVIVPDKSGLNTLR 216
           H  I ++ L  G ++ VY  + +D   ARN  G          C K+ I+ +   +  + 
Sbjct: 8   HDFIFKEQLGHGSYSTVY--KALDK--ARNNSGLPQHFYAIKVCSKKHIIRENK-VKYVT 62

Query: 217 AEVDAMKLL-KGNK--YIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYH 387
            E + + LL +GN    +  Y   H Q +        ++ +++Y   G ++  L      
Sbjct: 63  IEKNTLNLLAQGNNPGIVKLYYTFHDQEN--------LYFVLDYAPGGELLHLLQ----- 109

Query: 388 RLQEFEILKIMSDVCQGVAAMHYLQPP-LIHRDIKIENVLISENGDYKICDFGSACSVLR 564
           R   F+ +     +CQ V  + Y+    +IHRD+K ENVL+S++G   + DFG+A SV+ 
Sbjct: 110 RYGTFDEVWSKHFMCQLVDVVEYIHSKGVIHRDLKPENVLLSKDGRLMVTDFGAA-SVVT 168

Query: 565 PPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPF 744
              T  + +          TA+Y SPE++     +     SDIWALG  LY+    + PF
Sbjct: 169 TDGTSSDNSVSERAASFVGTAEYVSPELLLNNQCF---FSSDIWALGCILYQFMQGSPPF 225

Query: 745 EKEGE------NAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQV 882
             E E         L+  ++    P   D +R+I+ I    DP +R +I  +
Sbjct: 226 RGENELQTFEKIVSLDYHWKLAVNPSVMDLVRHILVI----DPHERLSISAI 273

>YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}
            HSL1Nim1p-related protein kinase that regulates the
            morphogenesis and septin checkpoints; associates with the
            assembled septin filament; required along with Hsl7p for
            bud neck recruitment, phosphorylation, and degradation of
            Swe1p
          Length = 1518

 Score = 75.5 bits (184), Expect = 1e-12
 Identities = 75/278 (26%), Positives = 129/278 (46%), Gaps = 10/278 (3%)
 Frame = +1

Query: 211  LRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHR 390
            +  E+  MKL+     +  +        E+ + + E++L++EY   G + D+L ++   +
Sbjct: 161  IEREIVIMKLISHTNVMALF--------EVWENKSELYLVLEYVDGGELFDYLVSK--GK 210

Query: 391  LQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISE-NGDYKICDFGSACSVLRP 567
            L E E +     + +GV+  H     + HRD+K EN+L+ + N   KI DFG A   L P
Sbjct: 211  LPEREAIHYFKQIVEGVSYCHSFN--ICHRDLKPENLLLDKKNRRIKIADFGMAALEL-P 267

Query: 568  PKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYSGYPIDEKSDIWALGVFLYKLCYYTTP 741
             K  + +    H         Y SPE++    Y G P    SD+W+ G+ L+ L     P
Sbjct: 268  NKLLKTSCGSPH---------YASPEIVMGRPYHGGP----SDVWSCGIVLFALLTGHLP 314

Query: 742  FEKEGENAIL----NVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQ--VSKL 903
            F  +    +L    + K+Q PS    S   R++I+ +L  DP KR    ++L+   + K 
Sbjct: 315  FNDDNIKKLLLKVQSGKYQMPS--NLSSEARDLISKILVIDPEKRITTQEILKHPLIKKY 372

Query: 904  QGVPCPIENFMLTRIKLQN-SRNNSNKSTSLNDTTNNS 1014
              +P    N +L +++  N +R  SN    L +  + S
Sbjct: 373  DDLPV---NKVLRKMRKDNMARGKSNSDLHLLNNVSPS 407

>Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} similar
           to Ashbya gossypii ACL104C
          Length = 1003

 Score = 75.1 bits (183), Expect = 1e-12
 Identities = 76/304 (25%), Positives = 137/304 (45%), Gaps = 6/304 (1%)
 Frame = +1

Query: 103 QVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSH 282
           QVY+++V++     +E+                   ++ EV  +  LK    I  Y  S 
Sbjct: 47  QVYAIKVLNLDCPEDEV-----------------EDVQKEVQFLSSLKQVPNITQYYGSF 89

Query: 283 AQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQ 462
              ++L       +++MEYC+ G +   L      ++ E  +  I+ ++   VA ++  +
Sbjct: 90  LYETKL-------WVIMEYCAGGSLRTLLRPG---KIDEKYLGVIVRNLL--VALLYIHK 137

Query: 463 PPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSP 642
             +IHRDIK  NVLI+  G  K+CDFG A  +       Q  A          T  + +P
Sbjct: 138 DNVIHRDIKAANVLITNGGHVKLCDFGVAAQLTTANHKRQTMA---------GTPYWMAP 188

Query: 643 EMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPF-EKEGENAI-LNVKFQFPSYP--QYS 810
           E+I    G   + K+DIW+LG+  Y++     P+ + E   A+ L  K + P      YS
Sbjct: 189 EVI--MEGVYYNTKADIWSLGITTYEIATGNPPYCDVEALRAMQLITKSKPPRLEGRNYS 246

Query: 811 DHIRNIITIMLNKDPIKRPNICQVL--EQVSKLQGVPCPIENFMLTRIKLQNSRNNSNKS 984
             ++  I + L++DP  RP   ++L  + V   +G    I   +++R  L + ++ + +S
Sbjct: 247 PLLKEFIALCLDEDPEARPTAEELLTTKLVKTHKGSSVTILKELISRYLLFSEKHKNRES 306

Query: 985 TSLN 996
             +N
Sbjct: 307 VMIN 310

>Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {ON}
           complement(67104..68684) [1581 nt, 527 aa]
          Length = 526

 Score = 74.3 bits (181), Expect = 1e-12
 Identities = 70/255 (27%), Positives = 111/255 (43%), Gaps = 26/255 (10%)
 Frame = +1

Query: 202 LNTLRAEVDAMKL----LKGNK-----YIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGG 354
           +NTL  + +  K     L+ NK     YIV Y       S        +F+ MEY   G 
Sbjct: 267 INTLNTDPEYQKQIFRELQFNKSFKSDYIVRYYGMFTDESNSS-----IFIAMEYMG-GR 320

Query: 355 VIDFLNTRLYH---RLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDY 525
            +D +   L +   R+ E  + KI   V +G++ +H  +  +IHRDIK +N+L++E G  
Sbjct: 321 SLDAIYLNLLNLGGRIGEKVLGKIAESVLRGLSYLH--ERKVIHRDIKPQNILLNEKGQV 378

Query: 526 KICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALG 705
           K+CDFG +   +    T               T+ Y +PE I    G P     D+W+LG
Sbjct: 379 KLCDFGVSGEAVNSLAT-----------TFTGTSFYMAPERI---QGQPYSVTCDVWSLG 424

Query: 706 VFLYKLCYYTTPFEKEGENA----------ILNVKFQFPSYPQ----YSDHIRNIITIML 843
           + L ++     PF  +   A          IL    Q    P+    +S   ++ I   L
Sbjct: 425 LTLLEVAQAKFPFGSDKMTATIAPIELLMLILTFSPQLKDEPELNIVWSKSFKSFIEYCL 484

Query: 844 NKDPIKRPNICQVLE 888
            KDP +RP+  Q+++
Sbjct: 485 KKDPSERPSPRQMIQ 499

>ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} similar
            to uniprot|P38990 Saccharomyces cerevisiae YER129W PAK1
            Upstream kinase for the SNF1 complex partially redundant
            function with Elm1p and Tos3p members of this family of
            kinases have functional orthology with LKB1 a mammalian
            kinase associated with Peutz-Jeghers
            cancer-susceptibility syndrome and some similarities with
            YGL179C uniprot|P43637 Saccharomyces cerevisiae YGL179C
            TOS3 Putative protein kinase, related to and redundant
            with Elm1p and Pak1p in activating the SNF1 complex
          Length = 1131

 Score = 75.1 bits (183), Expect = 1e-12
 Identities = 92/334 (27%), Positives = 147/334 (44%), Gaps = 48/334 (14%)
 Frame = +1

Query: 25   YEKGRVLPIGTH-QVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSG 201
            YE  + L  G H +V + + L  G   Q+ +++++D    +         +R +V DK  
Sbjct: 115  YELIQELGHGQHGKVKLARELLTG---QLVAIKIVDRHEKKG--------RRFLVLDKKN 163

Query: 202  LNT----LRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI--- 360
              T    +R E+  MK     K++V  ++      +LK  +  ++L++EYCSRG V    
Sbjct: 164  SLTQNEKIRREIAIMKKCH-YKHVVKLVEV---LDDLKSRK--IYLVLEYCSRGEVKWCP 217

Query: 361  -DFLNTRL-------YHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISEN 516
             D L T         + R +E     I+  V  G+  +HY    +IHRDIK  N+L++E+
Sbjct: 218  GDVLETEARGPPLLNFQRTRE-----IIRGVVLGLEYLHY--QGVIHRDIKPANLLMAED 270

Query: 517  GDYKICDFGSACSVLRP--------------PKTPQEAAFIHHDIMINTTA-QYRSPEMI 651
            G  KI DFG + +   P               KT    AF   +I +   A +  S +  
Sbjct: 271  GTVKISDFGVSLAARDPNGDANLESLDELELAKTAGTPAFFAPEICLGEEAFEKFSIDRS 330

Query: 652  DKYSGYPIDEKSDIWALGVFLYKLCYYTTPF----EKEGENAILNVKFQFPSYPQYSD-- 813
            D + G  +    DIWALGV LY L +   PF    E E    I+N     PS+   ++  
Sbjct: 331  DLFKGSSVSFMIDIWALGVTLYCLLFGMLPFISDYELELFEKIVNQPLTCPSFQNLNNNG 390

Query: 814  --HIR---------NIITIMLNKDPIKRPNICQV 882
              HI          +++T +L K P+ R  I ++
Sbjct: 391  VSHISSKEEYDLAVDLLTRLLKKSPLDRIGIQEI 424

>NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa]
           {ON} 
          Length = 1176

 Score = 75.1 bits (183), Expect = 1e-12
 Identities = 54/191 (28%), Positives = 96/191 (50%), Gaps = 2/191 (1%)
 Frame = +1

Query: 322 FLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENV 501
           ++L EY S G ++D++    +  L+E         +   +  +H     ++HRD+KIEN+
Sbjct: 203 YMLFEYVSGGQLLDYIIQ--HGSLKESHARNFARQILSALKYLHANN--IVHRDLKIENI 258

Query: 502 LISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDE 681
           +IS NG+ KI DFG +    +  K       ++          + +PE++ + + Y I  
Sbjct: 259 MISSNGNIKIIDFGLSNLYDKSKKLKTYCGSLY----------FAAPELL-RANPY-IGP 306

Query: 682 KSDIWALGVFLYKLCYYTTPFEKEGENAI-LNVKFQFPSYPQY-SDHIRNIITIMLNKDP 855
           + D+W+ GV LY L     PF+ E  N +   +K     YPQ+ S  + ++++ ML  DP
Sbjct: 307 EIDVWSFGVVLYVLVCGKVPFDDENSNVLHEKIKQGRVFYPQFLSIEVISLLSTMLVVDP 366

Query: 856 IKRPNICQVLE 888
            KR  + QV++
Sbjct: 367 FKRATLDQVMK 377

>YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON}
           IPL1Aurora kinase subunit of the conserved chromosomal
           passenger complex (CPC; Ipl1p-Sli15p-Bir1p-Nbl1p),
           involved in regulating kinetochore-microtubule
           attachments; helps maintain condensed chromosomes during
           anaphase and early telophase; required for SPB cohesion
           and prevention of multipolar spindle formation
          Length = 367

 Score = 73.2 bits (178), Expect = 1e-12
 Identities = 77/276 (27%), Positives = 115/276 (41%), Gaps = 7/276 (2%)
 Frame = +1

Query: 76  KYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNT---LRAEVDAMKLLK 246
           K L  G F +VY VR           G +  LK +   +    N     R EV+    L 
Sbjct: 108 KKLGKGKFGKVYCVR-------HRSTGYICALKVMEKEEIIKYNLQKQFRREVEIQTSLN 160

Query: 247 GNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSD 426
                 SY   H ++         V+LLMEY   G +   L  RL+    +      +  
Sbjct: 161 HPNLTKSYGYFHDEK--------RVYLLMEYLVNGEMYKLL--RLHGPFNDILASDYIYQ 210

Query: 427 VCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHD 606
           +   +  MH  +  +IHRDIK EN+LI  N   K+ DFG   S++ PP+  ++       
Sbjct: 211 IANALDYMH--KKNIIHRDIKPENILIGFNNVIKLTDFG--WSIINPPENRRKT------ 260

Query: 607 IMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENA----ILN 774
             +  T  Y SPEM++       D   D WALGV  ++L     PFE+E ++     I  
Sbjct: 261 --VCGTIDYLSPEMVESRE---YDHTIDAWALGVLAFELLTGAPPFEEEMKDTTYKRIAA 315

Query: 775 VKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQV 882
           +  + PS    S   +++I  +L  DP  R  +  V
Sbjct: 316 LDIKMPS--NISQDAQDLILKLLKYDPKDRMRLGDV 349

>NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2.479
           YKL101W
          Length = 1515

 Score = 75.1 bits (183), Expect = 1e-12
 Identities = 63/204 (30%), Positives = 99/204 (48%), Gaps = 7/204 (3%)
 Frame = +1

Query: 295 ELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLI 474
           E+ + + E++L++EY   G + D+L +R   +L E E +     + QGV+  H     + 
Sbjct: 219 EVWENKSELYLILEYVDGGELFDYLVSR--GKLPEAEAIHYFKQIIQGVSYCHSFN--IC 274

Query: 475 HRDIKIENVLI-SENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI 651
           HRD+K EN+LI  +    KI DFG A   L P K  Q +    H         Y SPE++
Sbjct: 275 HRDLKPENLLIDKKKKSIKIADFGMAALEL-PKKLLQTSCGSPH---------YASPEIV 324

Query: 652 --DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEG-ENAILNV---KFQFPSYPQYSD 813
               Y G P    SD+W+ G+ L+ L     PF  +  +  +L V   K+Q P     SD
Sbjct: 325 MGKSYHGGP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGKYQMPK--NLSD 378

Query: 814 HIRNIITIMLNKDPIKRPNICQVL 885
             +++I+ +L   P KR    ++L
Sbjct: 379 EAKDLISRILVVSPSKRLTTVEIL 402

>Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {ON}
           YDR122W (KIN1) - Serine/threonine protein kinase [contig
           174] PARTIAL
          Length = 858

 Score = 74.7 bits (182), Expect = 1e-12
 Identities = 58/215 (26%), Positives = 108/215 (50%), Gaps = 4/215 (1%)
 Frame = +1

Query: 322 FLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENV 501
           ++L EY S G ++D++    +  L+E    K    +   +  +H     ++HRD+KIEN+
Sbjct: 9   YMLFEYVSGGQLLDYIIQ--HGSLRERSARKFARGIASALQYLHMNN--IVHRDLKIENI 64

Query: 502 LISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMID--KYSGYPI 675
           +IS +G+ KI DFG + ++  P K       +H       +  + +PE++    Y+G  +
Sbjct: 65  MISTSGEIKIIDFGLS-NMYNPKKQ------LH---TFCGSLYFAAPELLKACPYTGPEV 114

Query: 676 DEKSDIWALGVFLYKLCYYTTPFEKEGENAI-LNVKFQFPSYPQY-SDHIRNIITIMLNK 849
               D+W+ GV L+ L     PF+ E  + +   +K     YPQ+ S  + ++++ ML  
Sbjct: 115 ----DVWSFGVVLFVLVCGKVPFDDENSSVLHEKIKQGKVEYPQHLSIEVISLLSKMLVV 170

Query: 850 DPIKRPNICQVLEQVSKLQGVPCPIENFMLTRIKL 954
           DP KR ++ QV+      +G   P  +++  R+ L
Sbjct: 171 DPTKRASLKQVVNHQWMQRGYDFPAPSYIPHRVPL 205

>ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {ON}
           some similarities with uniprot|Q03306 Saccharomyces
           cerevisiae YDR466W
          Length = 890

 Score = 74.7 bits (182), Expect = 1e-12
 Identities = 65/278 (23%), Positives = 128/278 (46%), Gaps = 3/278 (1%)
 Frame = +1

Query: 58  HQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMK 237
           H  + ++ L  G +++VY  + +D S+ +       C KR I+ +   +  +  E + + 
Sbjct: 10  HDFVFKEELGNGSYSRVY--KAVDRSDPQRVYAVKVCSKRHIIHENK-VKYVTIEKNTLN 66

Query: 238 LLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKI 417
           LL    +    +  H+   +    E  ++ ++++ + G ++  LN     R+ +F     
Sbjct: 67  LLARANH-PGIVKLHSTFHD----EENLYFVLDFAAGGELLSLLN-----RVGKFTEPCA 116

Query: 418 MSDVCQGVAAMHYLQPP-LIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAF 594
              + Q +    ++    +IHRD+K ENVL+  +G   + DFG+A ++ +   T   A+F
Sbjct: 117 RHFIAQLIDTTEFIHSQGVIHRDLKPENVLLHRDGRLMVTDFGTATNITK-ENTEGGASF 175

Query: 595 IHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILN 774
           +        TA+Y SPE++  Y+       SD+WALG  LY+      PF  E E     
Sbjct: 176 V-------GTAEYVSPELL-LYN--QCQFASDVWALGCMLYQFIEGVPPFRGENELHTFE 225

Query: 775 --VKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQV 882
             V  ++P        + +++  +L  DP +RP++  +
Sbjct: 226 KIVALEYPWANNNKGGVVSLVRRILTLDPSQRPSLTSI 263

>TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1057

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 64/262 (24%), Positives = 118/262 (45%), Gaps = 4/262 (1%)
 Frame = +1

Query: 109 YSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQ 288
           YS  ++ +S    +   +  L +  +  +  +  +  E +A++ L  ++ IV    +   
Sbjct: 178 YSTVMLATSKESGKKYAVKVLSKEYLIRQKKVKYVNIEKNALQRLNNSRGIVKLYFTF-- 235

Query: 289 RSELKQGEYEVFLLMEYCSRGGVIDFLNT-RLYHRLQEFEILKIMSDVCQGVAAMHYLQP 465
                Q E  ++ L+EY   G   DFL+  + Y  L E       + +   +  +H    
Sbjct: 236 -----QDESSLYFLLEYAPNG---DFLSIMKKYGSLNEDCACYYSAQIIDAIDFLH--SK 285

Query: 466 PLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPE 645
            ++HRDIK EN+L+ ++   K+ DFG+A  +   P T      +        TA+Y SPE
Sbjct: 286 GIVHRDIKPENILLDKDFKVKLTDFGTAKILEPKPNTTDSYDLLSRSKSFVGTAEYVSPE 345

Query: 646 MI-DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILN--VKFQFPSYPQYSDH 816
           ++ D Y    +D + DIWA G  L+++     PF+   E       +K Q+     +   
Sbjct: 346 LLNDNY----VDYRCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLV 401

Query: 817 IRNIITIMLNKDPIKRPNICQV 882
           +R+++  +L K P +R  I Q+
Sbjct: 402 VRDLVKGILIKQPAQRLTIPQI 423

>CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507c GIN4
          Length = 1103

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 57/201 (28%), Positives = 100/201 (49%), Gaps = 10/201 (4%)
 Frame = +1

Query: 316 EVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIE 495
           +++L++EY  +G + + L  R    L E E ++    +  G++  H L   ++HRD+K E
Sbjct: 103 DLYLVLEYAEKGELFNMLVER--GPLPENEAVRAFRQIIIGISYCHSLG--VVHRDLKPE 158

Query: 496 NVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTA---QYRSPEMIDKYSG 666
           N+L+    + KI DFG              AA    D ++ T+     Y +PE+I   SG
Sbjct: 159 NLLLDNKLNIKIADFGM-------------AALESEDKLLETSCGSPHYAAPEII---SG 202

Query: 667 YPIDE-KSDIWALGVFLYKLCYYTTPFEKEG---ENAILNV---KFQFPSYPQYSDHIRN 825
            P +   SD+W+ GV L+ L     PF++E     N +L V   +F+ P   + +   ++
Sbjct: 203 LPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDEITKEAQD 262

Query: 826 IITIMLNKDPIKRPNICQVLE 888
           ++  +L  DP KR  I ++L+
Sbjct: 263 LLARLLTVDPSKRITIREILK 283

>NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON} 
          Length = 1210

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 56/215 (26%), Positives = 106/215 (49%), Gaps = 4/215 (1%)
 Frame = +1

Query: 322 FLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENV 501
           ++L EY S G ++D++    +  L+E    K    +   +  +H     ++HRD+KIEN+
Sbjct: 262 YMLFEYVSGGQLLDYIIQ--HGSLREHHARKFARGIASALEYIHANN--IVHRDLKIENI 317

Query: 502 LISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYSGYPI 675
           +IS +G+ KI DFG +    R  +       ++          + +PE++    Y+G  +
Sbjct: 318 MISTSGEIKIIDFGLSNVFDRKKQLHTFCGSLY----------FAAPELLKAHPYTGPEV 367

Query: 676 DEKSDIWALGVFLYKLCYYTTPFEKEGENAI-LNVKFQFPSYPQY-SDHIRNIITIMLNK 849
               D+W+ GV LY L     PF+ E  + +   +K     YP + S  + ++++ ML  
Sbjct: 368 ----DVWSFGVVLYVLVCGKVPFDDENSSVLHEKIKQGKVDYPNHLSIEVISLLSKMLVV 423

Query: 850 DPIKRPNICQVLEQVSKLQGVPCPIENFMLTRIKL 954
           DP++R ++ QV+E     +G   P  +++  RI +
Sbjct: 424 DPLRRASLKQVVEHPWMTRGYDYPPPSYVPRRIPM 458

>NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {ON}
           Anc_6.262 YPL236C
          Length = 406

 Score = 73.2 bits (178), Expect = 2e-12
 Identities = 51/153 (33%), Positives = 72/153 (47%), Gaps = 9/153 (5%)
 Frame = +1

Query: 475 HRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMID 654
           HR+IK  N+L S +G   I D  S        KT ++       I    +  + SPE++D
Sbjct: 251 HRNIKPSNILFSSDGSQVISDLSSTSKSNIHLKTGKQILDFKEWIDSCCSVPFMSPELLD 310

Query: 655 KYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE-------NAILNVKFQFPSYPQ--Y 807
              G  IDEK DIW+LG  +Y +    +PFE+E +         IL+  F FP   +   
Sbjct: 311 LKMGSKIDEKVDIWSLGCTIYTIILGVSPFEREVQLTGKSIRMLILSANFTFPEGMERHA 370

Query: 808 SDHIRNIITIMLNKDPIKRPNICQVLEQVSKLQ 906
           S  + + I   L  DP KRP I Q+L  +  LQ
Sbjct: 371 SRELIDTIKQCLQVDPTKRPTINQLLNDLQALQ 403

>Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (REAL)
          Length = 1356

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 53/163 (32%), Positives = 77/163 (47%), Gaps = 2/163 (1%)
 Frame = +1

Query: 391  LQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPP 570
            + EFE   I   V  G+  +H     ++HRDIK ENV++   G  KI DFGSA  V   P
Sbjct: 1202 MTEFEAKLIFKQVVAGIKHLH--DQGIVHRDIKDENVIVDSKGFVKIIDFGSAAYVKSGP 1259

Query: 571  KTPQEAAFIHHDIMINTTAQYRSPEMI--DKYSGYPIDEKSDIWALGVFLYKLCYYTTPF 744
                       D+ +  T  Y +PE++  + Y G P     DIWA+G+ LY + +   PF
Sbjct: 1260 ----------FDVFVG-TIDYAAPEVLGGNPYEGQP----QDIWAIGILLYTVVFKENPF 1304

Query: 745  EKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNI 873
                E  IL    +F +  + S+    +I  +LN+    RP I
Sbjct: 1305 YNIDE--ILEGDLKFNNAEEVSEDCIELIKSILNRRVPNRPTI 1345

>Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W
            (REAL)
          Length = 1357

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 54/163 (33%), Positives = 77/163 (47%), Gaps = 2/163 (1%)
 Frame = +1

Query: 391  LQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPP 570
            + EFE   I   V  G+  +H     ++HRDIK ENV++   G  KI DFGSA  V   P
Sbjct: 1203 MTEFEAKLIFKQVVAGIKHLH--DQGIVHRDIKDENVIVDSKGFVKIIDFGSAAYVKSGP 1260

Query: 571  KTPQEAAFIHHDIMINTTAQYRSPEMI--DKYSGYPIDEKSDIWALGVFLYKLCYYTTPF 744
                       D+ +  T  Y +PE++  + Y G P     DIWA+G+ LY + +   PF
Sbjct: 1261 ----------FDVFVG-TIDYAAPEVLGGNPYEGQP----QDIWAIGILLYTVVFKENPF 1305

Query: 745  EKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNI 873
                E  IL    +F +    S+    +I  +LN+   KRP I
Sbjct: 1306 YNIDE--ILEGDLKFNNAEGVSEDCIELIKSILNRCVPKRPTI 1346

>TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1391

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 74/298 (24%), Positives = 137/298 (45%), Gaps = 10/298 (3%)
 Frame = +1

Query: 25  YEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGL 204
           ++ G  L +G+   +   Y +  G  Q  +++VI  +   N+    A    ++ PD    
Sbjct: 20  WKLGETLGLGSTGKVQLAYNSSTG--QQAAIKVISKAVFNND-NANASDSALLTPDSLPY 76

Query: 205 NTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLY 384
              R E+  MKLL     +  Y        ++ + +  +++++EY  +G + + L  R  
Sbjct: 77  GIER-EIIIMKLLNHPNVLRLY--------DVWETDSNLYMVLEYAEKGELFNLLVER-- 125

Query: 385 HRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLR 564
             L E E ++    +  G++  H L   ++HRD+K EN+L+    + KI DFG       
Sbjct: 126 GPLPENEAIRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKYNIKIADFGM------ 177

Query: 565 PPKTPQEAAFIHHDIMINTTA---QYRSPEMIDKYSGYPIDE-KSDIWALGVFLYKLCYY 732
                  AA    D ++ T+     Y +PE+I   SG P    ++D+W+ G+ L+ L   
Sbjct: 178 -------AALETEDKLLETSCGSPHYAAPEII---SGLPYHGLETDVWSCGIILFALLTG 227

Query: 733 TTPFEKEG---ENAILNV---KFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLE 888
             PF++E     N +L V   +F+ P   + S   +++I+ +L  DP KR    ++L+
Sbjct: 228 RLPFDEEDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILK 285

>Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL101W
            (REAL)
          Length = 1534

 Score = 74.7 bits (182), Expect = 2e-12
 Identities = 75/278 (26%), Positives = 128/278 (46%), Gaps = 10/278 (3%)
 Frame = +1

Query: 211  LRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHR 390
            +  E+  MKL+     +  +        E+ + + E++L++EY   G + D+L ++   +
Sbjct: 161  IEREIVIMKLISHTNVMALF--------EVWENKSELYLVLEYVDGGELFDYLVSK--GK 210

Query: 391  LQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISE-NGDYKICDFGSACSVLRP 567
            L E E +     + +GV+  H     + HRD+K EN+L+ + N   KI DFG A   L P
Sbjct: 211  LPEREAIHYFKQIVEGVSYCHSFN--ICHRDLKPENLLLDKKNRRIKIADFGMAALEL-P 267

Query: 568  PKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYSGYPIDEKSDIWALGVFLYKLCYYTTP 741
             K  + +    H         Y SPE++    Y G P    SD+W+ G+ L+ L     P
Sbjct: 268  NKLLKTSCGSPH---------YASPEIVMGRPYHGGP----SDVWSCGIVLFALLTGHLP 314

Query: 742  FEKEGENAIL----NVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQ--VSKL 903
            F  +    +L    + K+Q P     S   R++I+ +L  DP KR    ++L+   + K 
Sbjct: 315  FNDDNIKKLLLKVQSGKYQMPM--NLSAEARDLISKILVIDPAKRITTQEILKHPLIKKY 372

Query: 904  QGVPCPIENFMLTRIKLQN-SRNNSNKSTSLNDTTNNS 1014
              +P    N +L ++K  N +R  SN    L +  + S
Sbjct: 373  DDLPV---NKILRKMKRDNMARGKSNSDLHLLNNVSPS 407

 Score = 39.7 bits (91), Expect = 0.080
 Identities = 64/297 (21%), Positives = 115/297 (38%), Gaps = 28/297 (9%)
 Frame = +1

Query: 2725 NKSSNFRNVSEPSTCDPQYTFSITMNPTTRISSVSRKSRYESDS-----------SVYFS 2871
            NKS +  N++  +T       S +      + S+S++S   +D            S + +
Sbjct: 647  NKSLSRNNIAPTATVRRTLQNSASKRSLYSLQSISKRSLNLNDLLVFDDPLPSKISTFEN 706

Query: 2872 ANSGSAFRRESVADSNI-----------DKVESLGKNSSQYNNNSLQRMESVVENAPSET 3018
            A+       ES +D  I           DK+  L +       N  QR    V N  S+T
Sbjct: 707  ASKSKPHSLESDSDFEILCDQILFGNALDKI--LEEEEDNERENDTQRQRRHVTNNSSDT 764

Query: 3019 SFKLNSSLPKMSSVTDNSQTVKETIDNNFTQ---RIGSVVEYPLSRAESAVNSTSLSNEL 3189
                ++SL K ++ + N   + +   N F +    I  +  +P+ + E+++NST L N+ 
Sbjct: 765  ITVSDASLNKENAGSKNPTKIGKNPSNMFREPLEEISRLSSFPIFQKENSINSTFLENQK 824

Query: 3190 REVSAAVNILQRIDHEISQPVNETEFIEED---DSKEHTNPFTRDYSAKRDSFNTIXXXX 3360
             + +A  +I    +       NE  F  +D   + + H     R  + +  SF  I    
Sbjct: 825  PKRTALSDITNSFNE-----TNEQFFKNKDLGMEKRTHKEQLQRK-NGRLSSFKPI---- 874

Query: 3361 XXXXXXXXTRKESVTANTSPEREIAPDIFLQKTESLVKNSDSLQTTNSIQFESLLSG 3531
                     + + +  N+ P ++  P      + SL    +  Q  NS + ESLL G
Sbjct: 875  ---------QSQELRINSLPNKQSKP------SPSLDPRRNVSQPLNS-KVESLLQG 915

>Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON}
           (163688..166192) [2505 nt, 835 aa]
          Length = 834

 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 68/294 (23%), Positives = 134/294 (45%), Gaps = 19/294 (6%)
 Frame = +1

Query: 58  HQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMK 237
           H  I ++ L  G ++ VY  + +D  N +       C KR I+ +   +  +  E + + 
Sbjct: 12  HDYIFKQELGHGSYSTVY--KAVDKKNLKKCFAIKVCSKRHIIKENK-VKYVTIEKNVLN 68

Query: 238 LLKGNKY---IVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEI 408
            L    +   I  Y   H Q +        ++ ++ Y   G ++  L     H+++ F  
Sbjct: 69  SLGRENHPGIIKLYYTFHDQDN--------LYFVLSYAINGELLQLL-----HKMKTFNE 115

Query: 409 LKIMSDVCQGVAAMHYLQPP-LIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQE 585
           +  +    Q + A+ ++    +IHRD+K EN+L+ +N +  I DFG+A   ++     +E
Sbjct: 116 VWSIHFCAQIIDALEFIHSKGIIHRDLKPENILLDKNSNLMITDFGAA--YIQKNNDNKE 173

Query: 586 AAFI----HHDIMINT------TAQYRSPE-MIDKYSGYPIDEKSDIWALGVFLYKLCYY 732
                    H  ++NT      TA+Y SPE ++  +SGY     SDIWALG  +++    
Sbjct: 174 NITTKSNGSHPCLVNTNSSFVGTAEYVSPELLLYNHSGY----GSDIWALGCMIFQFLEG 229

Query: 733 TTPFEKEGE----NAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQV 882
             PF  E E      I+ +++++    + S  +++++  +L  +P  R  + ++
Sbjct: 230 LPPFRGENELKTFEKIVALEYKWSDQFKISSLVKDLVRKILTVNPQDRITLSEI 283

>TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {ON}
           Anc_6.222 YPL209C
          Length = 384

 Score = 72.8 bits (177), Expect = 2e-12
 Identities = 80/284 (28%), Positives = 119/284 (41%), Gaps = 11/284 (3%)
 Frame = +1

Query: 70  IEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNT------LRAEVDA 231
           I K L  G F +VY  R I +       G +  +K   + DKS + T       R E++ 
Sbjct: 128 IGKKLGKGKFGKVYCCRHIKT-------GFICAIK---IMDKSEILTYNVTKQFRNEIEI 177

Query: 232 MKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEIL 411
              L        Y   H  +         V+L+MEY   G +   L          F  +
Sbjct: 178 QSNLNHENLTKLYGFFHDSK--------RVYLIMEYIYNGELYSILKKN-----GPFNDI 224

Query: 412 KIMSDVCQGVAAMHYLQPP-LIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEA 588
              + V Q   A+ YL    +IHRD+K EN+LI  N   KI DFG   SV       ++ 
Sbjct: 225 VASNFVFQLTNAIRYLHKKRIIHRDLKPENILIDFNNVIKITDFG--WSVYNEAGNKRKT 282

Query: 589 AFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE--- 759
                   +  T  Y SPE+I+       D   D+WALG+  Y+L   T PFE++ +   
Sbjct: 283 --------LCGTIDYLSPELINSKE---YDGLIDVWALGIIAYELIVGTPPFEEDTKELT 331

Query: 760 -NAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLE 888
              I N    FP++   S   +N+I+ +L  +P +R  +  VL+
Sbjct: 332 YKRIKNCDLNFPAH--VSQDAKNLISSLLKLNPSERITLTDVLK 373

>Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {ON}
           YDR490C (PKH1) - Ser/Thr protein kinase [contig 184]
           FULL
          Length = 984

 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 56/197 (28%), Positives = 97/197 (49%), Gaps = 4/197 (2%)
 Frame = +1

Query: 304 QGEYEVFLLMEYCSRGGVIDFLNT-RLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHR 480
           Q E  ++ L+EY   G   DFL+  + +  L +   +   + +   +  +H+    ++HR
Sbjct: 227 QDEASLYFLLEYAPNG---DFLSVIKKFGSLSQECAVYYSAQILDAIDYLHH--KGIVHR 281

Query: 481 DIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI-DK 657
           DIK EN+L+ ++   K+ DFG+A  +L   +T Q    +        TA+Y SPE++ D 
Sbjct: 282 DIKPENILLDKDMKVKLTDFGTA-RILEKDETTQTFNLLERSKSFVGTAEYVSPELLNDN 340

Query: 658 YSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILN--VKFQFPSYPQYSDHIRNII 831
           Y    +D K DIWA G  L+++     PF+   E       +K Q+     +   IR++I
Sbjct: 341 Y----VDYKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLVIRDLI 396

Query: 832 TIMLNKDPIKRPNICQV 882
             +L K P +R +  Q+
Sbjct: 397 KKILVKSPEQRLDASQI 413

>KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {ON}
            Anc_1.52 YDR507C
          Length = 1117

 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 70/279 (25%), Positives = 127/279 (45%), Gaps = 11/279 (3%)
 Frame = +1

Query: 211  LRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHR 390
            +  E+  MKLL     +  Y        ++ +    +++++EY  +G + + L  +    
Sbjct: 74   IEREIIIMKLLNHPNVLRLY--------DVWETNSNLYMVLEYAEKGELFNLLVEK--GP 123

Query: 391  LQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPP 570
            LQE E ++    +  G++  H L   ++HRD+K EN+L+    + KI DFG         
Sbjct: 124  LQEQEAIRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKYNIKIADFGM-------- 173

Query: 571  KTPQEAAFIHHDIMINTTA---QYRSPEMID--KYSGYPIDEKSDIWALGVFLYKLCYYT 735
                 AA    D ++ T+     Y +PE++    Y G+     SD+W+ GV L+ L    
Sbjct: 174  -----AALETEDKLLETSCGSPHYAAPEIVSGIPYHGF----ASDVWSCGVILFALLTGR 224

Query: 736  TPFEKEG---ENAILNV---KFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVS 897
             PF++E     N +L V   +F+ PS  + S   ++++  +L  DP KR     +L+   
Sbjct: 225  LPFDEEDGNIRNLLLKVQSGEFEMPSDDEISHEAQDLLAKILTVDPEKRIRARDILKH-P 283

Query: 898  KLQGVPCPIENFMLTRIKLQNSRNNSNKSTSLNDTTNNS 1014
             LQ  P   ++        ++ RN   + T LN  ++N+
Sbjct: 284  LLQKYPSIKDS--------KSIRNLPREDTYLNPLSDNN 314

>Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON}
           similar to Ashbya gossypii AGR058W
          Length = 1145

 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 61/221 (27%), Positives = 108/221 (48%), Gaps = 4/221 (1%)
 Frame = +1

Query: 322 FLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENV 501
           ++L EY S G ++D++    +  L+E    K    +   +  +H     ++HRD+KIEN+
Sbjct: 217 YMLFEYVSGGQLLDYIIQ--HGSLRERHARKFARGIASALQYLHMNN--IVHRDLKIENI 272

Query: 502 LISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYSGYPI 675
           +IS +G+ +I DFG   S L  PK       +H       +  + +PE++    Y+G  +
Sbjct: 273 MISSSGEIRIIDFG--LSNLYDPKKQ-----LH---TFCGSLYFAAPELLKAHPYTGPEV 322

Query: 676 DEKSDIWALGVFLYKLCYYTTPFEKEGENAI-LNVKFQFPSYPQY-SDHIRNIITIMLNK 849
               DIW+ GV LY L     PF+ E  + +   +K     YPQ+ S  + ++++ ML  
Sbjct: 323 ----DIWSFGVVLYVLVCGKVPFDDENASVLHEKIKQGKVEYPQHLSIDVISLLSKMLVV 378

Query: 850 DPIKRPNICQVLEQVSKLQGVPCPIENFMLTRIKLQNSRNN 972
           DP+KR  + QV+      +G   P  +++   + L +   N
Sbjct: 379 DPLKRATLKQVVNHQWMQKGYDFPPPSYLPQSVPLTSDLIN 419

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 75/262 (28%), Positives = 121/262 (46%), Gaps = 16/262 (6%)
 Frame = +1

Query: 148 ELGTMACLKRVIVPDKSGLNT------LRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQG 309
           E G +A +K  IVP      T      +  E+  MKL+     +  Y        E+ + 
Sbjct: 79  ETGKLAAIK--IVPKTKSSRTGSLPYGIEREIIIMKLISHPNVMGLY--------EVWEN 128

Query: 310 EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIK 489
           + E+FL++EY   G + D+L +R   RL E E +     + +G A  H     + HRD+K
Sbjct: 129 KLELFLVLEYVDGGELFDYLVSR--GRLPEKEAIHYFRQIIEGTAYCHGFN--ICHRDLK 184

Query: 490 IENVLI-SENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTA---QYRSPEMI-- 651
            EN+L+  +N   KI DFG              AA    + ++ T+     Y SPE++  
Sbjct: 185 PENLLLDKKNKRIKIADFGM-------------AALQTSNKLLETSCGSPHYASPEIVMG 231

Query: 652 DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEG-ENAILNV---KFQFPSYPQYSDHI 819
             Y+G P    SD+W+ G+ L+ L     PF  +  +  +L V   K+Q P     S   
Sbjct: 232 KNYNGGP----SDVWSCGIILFALLTGHLPFNDDNIKRLLLKVQAGKYQMPQ--SVSSGA 285

Query: 820 RNIITIMLNKDPIKRPNICQVL 885
           +++I+ +L  DP KR +I ++L
Sbjct: 286 QDLISRILVVDPDKRISINEIL 307

>NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON}
           Anc_2.479
          Length = 1461

 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 70/234 (29%), Positives = 109/234 (46%), Gaps = 9/234 (3%)
 Frame = +1

Query: 211 LRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHR 390
           +  E+  MKL+     +  Y        E+ + + E++L++EY   G + D+L ++   +
Sbjct: 183 IEREIVIMKLISHPNVMALY--------EVWENKSELYLVLEYVDGGELFDYLVSK--GK 232

Query: 391 LQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISE-NGDYKICDFGSACSVLRP 567
           L E E +     + QGV+  H     + HRD+K EN+L+ + N   KI DFG A   L P
Sbjct: 233 LSEKEAVHYFKQIIQGVSYCHSFN--ICHRDLKPENLLLDKKNKSIKIADFGMAALEL-P 289

Query: 568 PKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYSGYPIDEKSDIWALGVFLYKLCYYTTP 741
            K  Q +    H         Y SPE++    Y G P    SD+W+ G+ L+ L     P
Sbjct: 290 NKLLQTSCGSPH---------YASPEIVMGKSYHGGP----SDVWSCGIILFALLTGHLP 336

Query: 742 FEKEG-ENAILNV---KFQFPS--YPQYSDHIRNIITIMLNKDPIKRPNICQVL 885
           F  +  +  +L V   KF+ PS   P+  D I  I+ I    DP KR    ++L
Sbjct: 337 FNDDNIKKLLLKVQAGKFRMPSTLSPEAQDLISRILVI----DPSKRITTDRIL 386

>Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON}
            (24479..26854) [2376 nt, 792 aa]
          Length = 791

 Score = 73.9 bits (180), Expect = 2e-12
 Identities = 78/291 (26%), Positives = 137/291 (47%), Gaps = 22/291 (7%)
 Frame = +1

Query: 82   LACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVP--DKSGLNTLRAEVDAMKLLKGNK 255
            L  GG ++VY V+ + ++        +  LKRV+    D+S +++ + E++ +K L+  K
Sbjct: 475  LGRGGSSKVYKVKNVHNNK-------IFALKRVMFDEFDESSIDSFKGEIELLKKLENEK 527

Query: 256  YIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMS-DVC 432
             +V+ I          Q E  V LL+  C    +   LN R+   L + E ++  + ++ 
Sbjct: 528  RVVTLIQH--------QMESGVLLLIMECGDHDLSQILNQRMNMPL-DIEFIRFHAREML 578

Query: 433  QGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIM 612
            + V  +H     ++H D+K  N +  + G  KI DFG A +V      P     I+ +  
Sbjct: 579  KCVKVVH--DAGIVHSDLKPANFVFVK-GILKIIDFGIANAV------PDHTVNIYRETQ 629

Query: 613  INTTAQYRSPEMI---------DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEK-EGEN 762
            I T   Y +PE +         D+ + + + + SDIW+ G  LY++ Y   P+   +G+N
Sbjct: 630  IGTP-NYMAPEALVAMNSQQDSDQQNKWKVGKPSDIWSCGCILYQMFYGRPPYGSFQGQN 688

Query: 763  AIL-----NVKFQFPSYPQYSDHI-RNIITIM---LNKDPIKRPNICQVLE 888
             +L     NVK  F      ++ I R+ +  M   L ++P KR  + QVLE
Sbjct: 689  RLLAIMNPNVKIVFSEKTSNNERIPRSALETMKACLIRNPDKRWAVDQVLE 739

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score = 74.3 bits (181), Expect = 2e-12
 Identities = 65/232 (28%), Positives = 105/232 (45%), Gaps = 7/232 (3%)
 Frame = +1

Query: 211 LRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHR 390
           +  E+  MKLL     +  Y        E+ +   E++L++EY   G + D+L ++   +
Sbjct: 182 IEREIVIMKLLSHPNVMALY--------EVWENNNELYLVLEYVDGGELFDYLVSK--GK 231

Query: 391 LQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDY-KICDFGSACSVLRP 567
           L E E +     +  G++  H     + HRD+K EN+L+ +     KI DFG A   +  
Sbjct: 232 LTESEAVHYFKQIINGISYCHSFN--ICHRDLKPENLLLDKKRRIIKIADFGMAALQVSN 289

Query: 568 PKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYSGYPIDEKSDIWALGVFLYKLCYYTTP 741
                     H          Y SPE++    Y+G P    SDIW+ G+ L+ L     P
Sbjct: 290 RLLQTSCGSPH----------YASPEIVMGKCYNGAP----SDIWSCGIILFALLTGHLP 335

Query: 742 FEKEGENAIL----NVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVL 885
           F  +    +L    N ++Q PSY   S   +N+I+ +L  DP KR +  Q+L
Sbjct: 336 FNDDNIKKLLIKVQNGRYQMPSY--ISQEAKNLISRILVVDPSKRISTEQIL 385

>KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {ON}
            Anc_3.60 YNL298W
          Length = 883

 Score = 73.9 bits (180), Expect = 2e-12
 Identities = 57/217 (26%), Positives = 106/217 (48%), Gaps = 5/217 (2%)
 Frame = +1

Query: 118  RVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSE 297
            R  +S     ++G    +K++I+  +     +  E+  MK  K +K IV++I+S+ +  +
Sbjct: 617  RQAESDGENMKVGDKVAIKQMILSKQPRKELIVNEIHVMKDSK-HKNIVNFIESYLKTED 675

Query: 298  LKQGEYEVFLLMEYCSRGGVIDFL-----NTRLYHRLQEFEILKIMSDVCQGVAAMHYLQ 462
                  +++++MEY   G + D +     N   +  L E +I  I+ + CQG+  +H   
Sbjct: 676  ------DLWVVMEYMEGGSLTDIIENSPTNGSTHSPLTEPQIAYIVRETCQGLKFLH--D 727

Query: 463  PPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSP 642
              +IHRDIK +NVL+  +   KI DFG  C+ L   +  +         M+  T  + +P
Sbjct: 728  KHIIHRDIKSDNVLLDTHARVKITDFG-FCAKLTDQRNKRAT-------MVG-TPYWMAP 778

Query: 643  EMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKE 753
            E++ +      DEK D+W+LG+   ++     P+  E
Sbjct: 779  EVVKQRE---YDEKVDVWSLGIMAIEMLESEPPYLNE 812

>AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR096W (KIN2) and
           YDR122W (KIN1)
          Length = 1071

 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 62/228 (27%), Positives = 110/228 (48%), Gaps = 4/228 (1%)
 Frame = +1

Query: 322 FLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENV 501
           ++L EY S G ++D++    +  L+E    K    +   +  +H     ++HRD+KIEN+
Sbjct: 156 YMLFEYVSGGQLLDYIIQ--HGSLRERHARKFARGIASALQYLHLNN--IVHRDLKIENI 211

Query: 502 LISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYSGYPI 675
           +IS +G+ +I DFG   S +  PK       +H       +  + +PE++    Y+G  +
Sbjct: 212 MISSSGEIRIIDFG--LSNMYDPKKQ-----LH---TFCGSLYFAAPELLKAHPYTGPEV 261

Query: 676 DEKSDIWALGVFLYKLCYYTTPFEKEGENAI-LNVKFQFPSYPQY-SDHIRNIITIMLNK 849
               DIW+ GV LY L     PF+ E  + +   +K     YPQ+ S  + ++++ ML  
Sbjct: 262 ----DIWSFGVVLYVLVCGKVPFDDENASVLHEKIKQGKVEYPQHLSIDVISLLSKMLVV 317

Query: 850 DPIKRPNICQVLEQVSKLQGVPCPIENFMLTRIKLQNSRNNSNKSTSL 993
           DP KR  + QV+      +G   P  +++   + L   R N +  T +
Sbjct: 318 DPYKRATLKQVVHHQWMQKGYDFPPPSYLPPCVPLTPDRINMDIITEM 365

>Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL045W
            (REAL)
          Length = 1101

 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 67/236 (28%), Positives = 105/236 (44%), Gaps = 7/236 (2%)
 Frame = +1

Query: 202  LNTLRAEVDAMKLLKGN--KYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRG--GVIDFL 369
            L T+ +E+  M  L  N  K I+  +D           E + +  +E    G  G ID  
Sbjct: 888  LGTIPSEIQIMATLNKNSQKNILKLLDFF---------EDDDYYYIETPVHGETGSIDLF 938

Query: 370  NTRLYHR-LQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGS 546
            +   + + + E E   +   V   +  +H     ++HRDIK ENV++  +G  K+ DFGS
Sbjct: 939  DVIEFKKDMVEHEAKLVFKQVVASIKHLH--NQGIVHRDIKDENVIVDSHGFVKLIDFGS 996

Query: 547  ACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYSGYPIDEKSDIWALGVFLYK 720
            A  V   P           D+ +  T  Y +PE++    Y G P     DIWALGV LY 
Sbjct: 997  AAYVKSGP----------FDVFVG-TMDYAAPEVLGGSSYKGKP----QDIWALGVLLYT 1041

Query: 721  LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLE 888
            + Y   P+    E  IL  + +F    + S+    +I  +L ++  KRP I ++ E
Sbjct: 1042 IIYKENPYYNIDE--ILEGELRFDKAEKVSEGCIGLIKRILTREVDKRPTIDEIYE 1095

>YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One of
            two (see also PSK1) PAS domain containing S/T protein
            kinases; regulates sugar flux and translation in response
            to an unknown metabolite by phosphorylating Ugp1p and
            Gsy2p (sugar flux) and Caf20p, Tif11p and Sro9p
            (translation)
          Length = 1101

 Score = 73.9 bits (180), Expect = 3e-12
 Identities = 54/182 (29%), Positives = 85/182 (46%), Gaps = 3/182 (1%)
 Frame = +1

Query: 352  GVIDFLNTRLYHR-LQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYK 528
            G ID  +   + + + E E   +   V   +  +H     ++HRDIK ENV++  +G  K
Sbjct: 933  GSIDLFDVIEFKKDMVEHEAKLVFKQVVASIKHLH--DQGIVHRDIKDENVIVDSHGFVK 990

Query: 529  ICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYSGYPIDEKSDIWAL 702
            + DFGSA  +   P           D+ +  T  Y +PE++    Y G P     DIWAL
Sbjct: 991  LIDFGSAAYIKSGP----------FDVFVG-TMDYAAPEVLGGSSYKGKP----QDIWAL 1035

Query: 703  GVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQV 882
            GV LY + Y   P+    E  IL  + +F      S+   ++I  +L ++  KRP I ++
Sbjct: 1036 GVLLYTIIYKENPYYNIDE--ILEGELRFDKSEHVSEECISLIKRILTREVDKRPTIDEI 1093

Query: 883  LE 888
             E
Sbjct: 1094 YE 1095

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.129    0.361 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 351,908,244
Number of extensions: 7341726
Number of successful extensions: 35962
Number of sequences better than 10.0: 1985
Number of HSP's gapped: 32794
Number of HSP's successfully gapped: 2076
Length of query: 1444
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1322
Effective length of database: 39,492,147
Effective search space: 52208618334
Effective search space used: 52208618334
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.5 bits)
S2: 35 (18.1 bits)