Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0B069402.284ON1443144357200.0
SAKL0E07722g2.284ON79131512401e-152
KLLA0E08405g2.284ON77731612261e-150
TDEL0G021502.284ON66132112081e-149
Kwal_27.115422.284ON79131512061e-147
Suva_9.1042.284ON80533611981e-145
TPHA0C033802.284ON69732111891e-145
ADL217W2.284ON75031711931e-145
Ecym_33232.284ON74831511931e-145
KAFR0J013702.284ON78032311951e-145
ZYRO0A01848g2.284ON70433311831e-144
KLTH0G10318g2.284ON79031811891e-144
NCAS0B062602.284ON72332511801e-144
NDAI0B035602.284ON75631911781e-143
NCAS0G038102.284ON66131311621e-142
YIL095W (PRK1)2.284ON81032111731e-142
Smik_9.842.284ON80832211721e-141
Skud_9.782.284ON80932211631e-140
Skud_14.3092.284ON63931311471e-140
NDAI0G006402.284ON62131511451e-140
YNL020C (ARK1)2.284ON63831511431e-140
Kpol_1003.352.284ON71331611491e-139
KAFR0H033302.284ON36934311121e-139
CAGL0G02607g2.284ON68831711361e-138
TBLA0B059302.284ON71732911331e-137
Kpol_1039.332.284ON70133411311e-137
Smik_14.3112.284ON63730811241e-137
Suva_14.3272.284ON63231011181e-136
CAGL0J03432g2.284ON62232711091e-135
KNAG0H020202.284ON59234010761e-130
KNAG0A054302.284ON78832410581e-126
TPHA0D015402.284ON70731510511e-125
KNAG0H012203.273ON9133208154e-91
KAFR0C004303.273ON9493188141e-90
KAFR0A010403.273ON9123438093e-90
CAGL0H10208g3.273ON10273188049e-89
KLTH0C07260g3.273ON9013147891e-87
Kwal_27.109453.273ON9353147911e-87
Kpol_251.43.273ON8383337823e-87
SAKL0D03234g3.273ON8583137833e-87
ZYRO0E06864g3.273ON11153177947e-87
NCAS0A105903.273ON10953167929e-87
Kpol_1052.223.273ON11013117921e-86
Smik_2.1913.273ON11083177884e-86
KNAG0J008203.273ON10913407874e-86
Suva_4.2973.273ON11073177866e-86
NDAI0A057003.273ON11573267861e-85
YBR059C (AKL1)3.273ON11083177832e-85
Skud_2.1793.273ON10903177812e-85
TDEL0D035203.273ON10493147783e-85
TPHA0A040303.273ON10543207757e-85
Ecym_26503.273ON8943097678e-85
TBLA0E025903.273ON10613137741e-84
TBLA0I019303.273ON13613147823e-84
CAGL0K11990g3.273ON9913227674e-84
KLLA0F18612g3.273ON8143007512e-83
TPHA0M011203.273ON7883137387e-82
AGR027C3.273ON9613087265e-79
Kwal_33.131121.24ON5052762522e-21
SAKL0H06754g8.668ON8842052535e-21
Kpol_1037.206.31ON7042952481e-20
TDEL0G043806.31ON7222952463e-20
ZYRO0C07480g6.31ON7743302437e-20
TDEL0A067506.262ON3723462349e-20
KNAG0F001701.24ON5432942381e-19
KNAG0E008506.31ON7112772373e-19
TBLA0B004906.31ON7872962383e-19
KAFR0A050906.31ON6682412364e-19
Suva_13.1636.31ON7052772365e-19
KLTH0H03080g6.262ON3463322276e-19
Skud_13.1546.31ON7052772346e-19
YMR001C (CDC5)6.31ON7052772347e-19
Suva_16.1608.668ON9182002357e-19
TBLA0A047207.86ON12622352358e-19
Kwal_47.183075.591ON6212782338e-19
Smik_13.1596.31ON7052772338e-19
KLLA0E21693g5.406ON10163012341e-18
CAGL0J11638g6.31ON7462782321e-18
Kpol_2002.241.24ON4873302282e-18
TPHA0J004206.31ON7072952302e-18
ZYRO0D05500g7.86ON12621792322e-18
TPHA0E038501.24ON4822772263e-18
NDAI0C026806.31ON7502872293e-18
KAFR0G026906.31ON7132772284e-18
Kwal_55.215455.406ON8653282294e-18
CAGL0M02299g8.668ON8932982294e-18
NCAS0D021006.31ON7262772266e-18
Kwal_26.87518.668ON8481992276e-18
KLTH0F00946g1.24ON5121932247e-18
ABL034W2.479ON14253262277e-18
TBLA0A035705.406ON9752682268e-18
NCAS0C016708.668ON8962022269e-18
Kwal_56.242746.262ON3463302171e-17
SAKL0C00946g1.24ON5642192231e-17
ZYRO0F07194g8.668ON9382872251e-17
NCAS0C041208.140ON9152652241e-17
TPHA0G016308.668ON8712052232e-17
Kpol_1072.198.668ON8961972232e-17
Suva_16.706.262ON3643362162e-17
CAGL0K02167g8.140ON11622772242e-17
KLTH0F16676g5.406ON8782302232e-17
TBLA0B038608.668ON9882292232e-17
Ecym_73922.479ON14343072233e-17
Skud_16.1328.668ON9241992223e-17
TBLA0H016605.406ON9962912214e-17
ACL006W6.31ON7082772194e-17
Suva_6.1691.271ON14843162214e-17
CAGL0L03520g1.271ON14473062214e-17
KAFR0G012001.24ON5072322174e-17
YPL236C (ENV7)6.262ON3643252134e-17
Skud_16.426.262ON3643222126e-17
TPHA0F024306.31ON7982782186e-17
KNAG0D048107.86ON14401772197e-17
Smik_6.4416.262ON3643222117e-17
ZYRO0D06776g8.279ON12042152188e-17
ACR133C8.668ON8512292178e-17
TPHA0I009201.271ON14342622189e-17
Smik_10.1471.271ON14783162181e-16
YJL095W (BCK1)1.271ON14782842171e-16
Kpol_463.81.271ON14472852171e-16
CAGL0L11550g5.406ON10723282161e-16
KLTH0D11044g8.668ON8492022151e-16
TDEL0C067801.24ON4682412121e-16
KLTH0G05214g5.591ON6532852141e-16
Kpol_1031.105.406ON11272292161e-16
Skud_10.1191.271ON14812292162e-16
NCAS0A002801.24ON5352842132e-16
TPHA0H016305.406ON10363352152e-16
KLLA0C06138g6.31ON7082772142e-16
SAKL0A03344g6.262ON3641522082e-16
KLLA0F11319g8.668ON8431982142e-16
Ecym_30356.31ON7402772142e-16
Suva_11.1232.479ON15262282152e-16
TDEL0H036407.86ON12371842142e-16
CAGL0G04609g3.92ON9652052143e-16
ZYRO0F18062g1.24ON4713052103e-16
ZYRO0G19052g8.140ON11313342133e-16
AFR724C1.24ON4401952093e-16
NDAI0E023908.668ON8831972133e-16
TDEL0A045805.591ON6942842123e-16
SAKL0E01584g6.31ON6952952123e-16
Kpol_1023.266.31ON7392752123e-16
CAGL0F00913g7.86ON12061692133e-16
KNAG0F029006.31ON6492602113e-16
Ecym_10301.24ON4402822083e-16
Suva_15.2975.406ON10742682124e-16
TBLA0D022308.141ON11543132124e-16
TBLA0A071501.52ON13912982124e-16
YPL150W8.668ON9012012114e-16
KAFR0D012207.86ON10553112115e-16
Ecym_24058.668ON8552022115e-16
Smik_4.7673.92ON7582992105e-16
Smik_7.938.140ON5632152095e-16
TBLA0B082503.92ON13472012115e-16
KAFR0K007007.86ON13811912115e-16
Kwal_26.71547.86ON12131802115e-16
NCAS0A094701.271ON15152292116e-16
TBLA0A020506.222ON4342772067e-16
AFL101C6.222ON3672832047e-16
KLLA0F14190g1.271ON13382292107e-16
NDAI0F045201.24ON4892162068e-16
CAGL0K08514g2.479ON14892242099e-16
KLLA0F13552g2.479ON12672612099e-16
KAFR0B028008.279ON10952142081e-15
KLLA0F07623g7.86ON12291922081e-15
KAFR0C014403.92ON10952742081e-15
YDR490C (PKH1)3.92ON7662052071e-15
KLTH0C09548g3.92ON9932002072e-15
Ecym_21536.262ON3633282002e-15
CAGL0K05709g1.52ON11032012072e-15
Kwal_26.77882.479ON12672612062e-15
TBLA0C046008.279ON13152182062e-15
NDAI0G054701.271ON15552842062e-15
KAFR0D049505.406ON10082612052e-15
Skud_8.1635.406ON10762292053e-15
CAGL0M11396g8.279ON11922172053e-15
KLTH0D02486g7.86ON12231802053e-15
Smik_6.3478.668ON9172032053e-15
Skud_3.1656.371ON7162772043e-15
SAKL0H16632g8.279ON10622132053e-15
TBLA0A074601.24ON5162732023e-15
TDEL0F040608.279ON11262172043e-15
KLTH0D05566g2.479ON11282632043e-15
Skud_4.7831.52ON11353052043e-15
Smik_8.1805.406ON10732292043e-15
KAFR0D041001.52ON11172022044e-15
TDEL0D053203.92ON10572012044e-15
NDAI0H024707.86ON14112782044e-15
SAKL0G01848g5.406ON8852852034e-15
ZYRO0E07876g6.262ON3693341984e-15
Skud_7.928.140ON5632162014e-15
NCAS0A057702.479ON14612342044e-15
YKL101W (HSL1)2.479ON15182382044e-15
NCAS0B086001.52ON11172372035e-15
KNAG0B017801.271ON15802302045e-15
Kwal_56.226933.92ON9842002035e-15
YHR102W (KIC1)5.406ON10803212035e-15
KNAG0B043205.406ON10272792035e-15
TDEL0D014001.271ON14293122035e-15
Smik_11.1392.479ON15342662035e-15
Kpol_1072.298.654ON8932592026e-15
YGL179C (TOS3)8.140ON5601882006e-15
Ecym_42918.279ON11452152026e-15
KLLA0C01650g1.52ON11123022026e-15
KAFR0B021408.140ON8962782017e-15
TBLA0B039908.652ON7132312017e-15
Suva_7.838.140ON5692101997e-15
CAGL0B01925g8.279ON9442152017e-15
TBLA0I011502.479ON17452062028e-15
Kpol_1032.103.162ON7912912008e-15
KAFR0A014201.271ON13982292018e-15
TDEL0F009308.140ON11302322018e-15
Kwal_56.237178.279ON8582152008e-15
TDEL0A061408.668ON8612032009e-15
Kpol_431.92.479ON15522352019e-15
NDAI0C017005.406ON10202702009e-15
ACL104C5.406ON9473552009e-15
TPHA0H004208.140ON10382602009e-15
TBLA0C029401.271ON16432882011e-14
ZYRO0A06446g5.406ON9432841991e-14
NCAS0B037408.279ON10492151991e-14
NCAS0B050908.279ON12102181991e-14
SAKL0E02860g2.479ON13773011991e-14
TDEL0A025502.479ON13692071991e-14
Ecym_55055.406ON10032351991e-14
ZYRO0C06776g5.591ON8902881982e-14
ZYRO0G15290g1.271ON14872051992e-14
Ecym_26407.86ON13251771992e-14
Kwal_47.172638.140ON11272301982e-14
AFR696C1.52ON11422031982e-14
SAKL0H07084g8.654ON9193041982e-14
Skud_3.391.52ON10171961982e-14
KNAG0D002106.371ON8332051972e-14
CAGL0H06259g7.86ON13361771982e-14
NCAS0H019405.406ON10152721972e-14
Kwal_26.73551.271ON14462601982e-14
Skud_11.1262.479ON15182381982e-14
ACR281C7.86ON12591811972e-14
KNAG0F002901.52ON11252011972e-14
KLTH0F01672g1.52ON11641931972e-14
NDAI0G042903.92ON11132011972e-14
KLTH0G13288g8.279ON11422151972e-14
NDAI0B020708.279ON12582181973e-14
KNAG0C024401.182ON4011911923e-14
SAKL0G06402g5.591ON7842941963e-14
KNAG0G012408.140ON9092711963e-14
TBLA0C058301.182ON4262721923e-14
YAL017W (PSK1)7.86ON13561771963e-14
AGR058W8.279ON10712211963e-14
Smik_4.7891.52ON11362021963e-14
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0B06940
         (1443 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...  2207   0.0  
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...   482   e-152
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...   476   e-150
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...   469   e-149
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...   469   e-147
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...   466   e-145
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...   462   e-145
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...   464   e-145
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...   464   e-145
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...   464   e-145
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...   460   e-144
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...   462   e-144
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...   459   e-144
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...   458   e-143
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...   452   e-142
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...   456   e-142
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...   456   e-141
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...   452   e-140
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...   446   e-140
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284    445   e-140
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...   444   e-140
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....   447   e-139
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...   432   e-139
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...   442   e-138
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...   441   e-137
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...   440   e-137
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...   437   e-137
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...   435   e-136
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...   431   e-135
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...   419   e-130
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...   412   e-126
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...   409   e-125
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...   318   4e-91
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...   318   1e-90
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...   316   3e-90
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...   314   9e-89
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...   308   1e-87
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...   309   1e-87
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...   305   3e-87
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...   306   3e-87
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...   310   7e-87
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...   309   9e-87
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...   309   1e-86
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...   308   4e-86
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...   307   4e-86
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...   307   6e-86
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...   307   1e-85
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...   306   2e-85
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...   305   2e-85
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....   304   3e-85
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....   303   7e-85
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...   300   8e-85
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...   302   1e-84
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...   305   3e-84
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...   300   4e-84
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...   293   2e-83
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...   288   7e-82
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...   284   5e-79
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...   101   2e-21
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...   102   5e-21
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....   100   1e-20
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...    99   3e-20
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...    98   7e-20
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    95   9e-20
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...    96   1e-19
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...    96   3e-19
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...    96   3e-19
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}             96   4e-19
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...    96   5e-19
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    92   6e-19
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...    95   6e-19
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...    95   7e-19
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...    95   7e-19
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...    95   8e-19
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...    94   8e-19
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...    94   8e-19
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...    95   1e-18
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...    94   1e-18
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    92   2e-18
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...    93   2e-18
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...    94   2e-18
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    92   3e-18
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...    93   3e-18
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...    92   4e-18
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...    93   4e-18
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...    93   4e-18
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31      92   6e-18
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    92   6e-18
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...    91   7e-18
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...    92   7e-18
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...    92   8e-18
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...    92   9e-18
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    88   1e-17
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    91   1e-17
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...    91   1e-17
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...    91   1e-17
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...    91   2e-17
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....    91   2e-17
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    88   2e-17
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...    91   2e-17
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...    91   2e-17
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...    91   2e-17
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...    91   3e-17
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...    90   3e-17
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...    90   4e-17
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...    89   4e-17
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...    90   4e-17
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...    90   4e-17
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    88   4e-17
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    87   4e-17
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    86   6e-17
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    89   6e-17
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....    89   7e-17
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    86   7e-17
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...    89   8e-17
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...    88   8e-17
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....    89   9e-17
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...    89   1e-16
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...    88   1e-16
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...    88   1e-16
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...    88   1e-16
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...    87   1e-16
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    86   1e-16
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...    87   1e-16
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...    88   1e-16
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...    88   2e-16
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        87   2e-16
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....    87   2e-16
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...    87   2e-16
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    85   2e-16
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...    87   2e-16
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...    87   2e-16
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    87   2e-16
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...    87   2e-16
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...    87   3e-16
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    86   3e-16
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...    87   3e-16
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    85   3e-16
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...    87   3e-16
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...    86   3e-16
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...    86   3e-16
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....    86   3e-16
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    87   3e-16
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}               86   3e-16
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...    85   3e-16
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...    86   4e-16
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....    86   4e-16
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...    86   4e-16
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...    86   4e-16
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....    86   5e-16
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...    86   5e-16
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...    86   5e-16
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...    85   5e-16
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    86   5e-16
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    86   5e-16
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    86   5e-16
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...    86   6e-16
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}               84   7e-16
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...    83   7e-16
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...    86   7e-16
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    84   8e-16
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...    85   9e-16
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...    85   9e-16
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....    85   1e-15
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...    85   1e-15
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...    85   1e-15
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...    84   1e-15
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...    84   2e-15
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    82   2e-15
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...    84   2e-15
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...    84   2e-15
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...    84   2e-15
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...    84   2e-15
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....    84   2e-15
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...    84   3e-15
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...    84   3e-15
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    84   3e-15
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...    84   3e-15
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...    83   3e-15
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...    84   3e-15
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    82   3e-15
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....    83   3e-15
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...    83   3e-15
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...    83   3e-15
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...    83   3e-15
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...    83   4e-15
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...    83   4e-15
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...    83   4e-15
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...    83   4e-15
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    81   4e-15
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...    82   4e-15
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...    83   4e-15
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...    83   4e-15
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...    83   5e-15
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....    83   5e-15
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...    83   5e-15
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...    83   5e-15
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...    83   5e-15
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....    83   5e-15
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...    83   5e-15
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...    82   6e-15
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...    82   6e-15
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...    82   6e-15
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...    82   6e-15
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...    82   7e-15
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    82   7e-15
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...    81   7e-15
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...    82   7e-15
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...    82   8e-15
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    82   8e-15
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....    82   8e-15
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...    82   8e-15
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...    82   8e-15
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...    82   9e-15
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...    82   9e-15
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...    82   9e-15
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...    82   9e-15
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...    82   9e-15
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...    82   1e-14
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...    81   1e-14
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...    81   1e-14
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}              81   1e-14
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...    81   1e-14
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....    81   1e-14
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...    81   1e-14
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...    81   2e-14
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...    81   2e-14
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...    81   2e-14
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...    81   2e-14
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...    81   2e-14
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...    81   2e-14
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...    81   2e-14
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...    80   2e-14
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...    81   2e-14
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....    80   2e-14
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...    81   2e-14
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...    81   2e-14
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...    80   2e-14
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...    80   2e-14
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...    80   2e-14
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...    80   2e-14
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...    80   2e-14
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}              80   3e-14
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...    79   3e-14
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...    80   3e-14
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...    80   3e-14
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...    79   3e-14
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...    80   3e-14
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...    80   3e-14
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...    80   3e-14
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...    80   3e-14
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...    80   3e-14
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...    80   3e-14
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...    80   3e-14
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...    80   3e-14
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...    80   3e-14
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    78   3e-14
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...    78   4e-14
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...    80   4e-14
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....    80   4e-14
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...    80   4e-14
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...    79   4e-14
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...    80   4e-14
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...    80   4e-14
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...    80   4e-14
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...    79   4e-14
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...    80   4e-14
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...    80   4e-14
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....    80   5e-14
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    79   5e-14
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...    79   5e-14
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       79   5e-14
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...    77   5e-14
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    79   5e-14
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...    79   5e-14
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...    79   5e-14
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...    79   6e-14
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...    77   6e-14
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...    79   6e-14
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52     79   6e-14
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...    79   6e-14
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    79   7e-14
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...    79   7e-14
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...    79   7e-14
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...    79   7e-14
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...    79   7e-14
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...    79   7e-14
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...    79   8e-14
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...    79   8e-14
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...    79   8e-14
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...    79   9e-14
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...    79   9e-14
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...    78   9e-14
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...    77   9e-14
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...    78   1e-13
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    78   1e-13
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...    79   1e-13
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...    78   1e-13
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...    78   1e-13
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...    78   1e-13
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...    78   1e-13
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...    78   1e-13
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...    78   1e-13
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...    78   1e-13
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...    76   1e-13
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...    78   2e-13
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...    77   2e-13
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...    78   2e-13
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...    78   2e-13
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...    78   2e-13
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...    78   2e-13
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...    77   2e-13
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...    78   2e-13
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...    76   2e-13
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...    77   2e-13
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...    77   2e-13
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...    77   2e-13
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    77   2e-13
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...    77   2e-13
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...    77   2e-13
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141     77   2e-13
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...    77   3e-13
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...    77   3e-13
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    77   3e-13
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    75   3e-13
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...    77   3e-13
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    77   3e-13
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....    77   3e-13
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    77   3e-13
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...    75   3e-13
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...    77   3e-13
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....    77   3e-13
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496     77   3e-13
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...    77   4e-13
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...    77   4e-13
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    77   4e-13
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...    77   4e-13
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...    76   4e-13
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...    76   4e-13
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...    76   4e-13
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...    76   5e-13
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141     76   5e-13
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    76   5e-13
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...    76   5e-13
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...    76   5e-13
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...    76   5e-13
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...    76   5e-13
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    75   5e-13
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...    76   5e-13
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...    76   5e-13
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...    76   6e-13
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...    76   6e-13
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...    76   6e-13
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...    76   6e-13
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...    74   6e-13
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    74   6e-13
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...    76   6e-13
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141     74   6e-13
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...    76   6e-13
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...    76   8e-13
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...    75   8e-13
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...    75   8e-13
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...    75   8e-13
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...    74   8e-13
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...    75   8e-13
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...    75   9e-13
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...    75   9e-13
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    74   9e-13
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...    75   9e-13
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...    75   1e-12
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...    75   1e-12
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    75   1e-12
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    74   1e-12
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...    75   1e-12
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    74   1e-12
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...    74   1e-12
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...    75   1e-12
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...    75   1e-12
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...    75   1e-12
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...    74   1e-12
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...    74   1e-12
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...    75   1e-12
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    74   1e-12
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...    74   1e-12
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...    75   2e-12
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...    74   2e-12
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...    74   2e-12
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...    74   2e-12
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...    74   2e-12
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...    74   2e-12
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...    74   2e-12
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...    74   2e-12
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384     74   2e-12
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...    74   2e-12
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...    74   2e-12
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...    73   2e-12
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...    74   2e-12
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...    74   2e-12
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    74   2e-12
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...    74   2e-12
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...    74   2e-12
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    72   2e-12
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...    72   3e-12
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...    74   3e-12
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...    74   3e-12
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...    72   3e-12
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...    74   3e-12
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...    72   3e-12
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    74   3e-12
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...    72   3e-12
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...    74   3e-12
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...    74   3e-12
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...    73   3e-12
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    73   3e-12
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...    73   3e-12
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...    74   3e-12
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...    73   3e-12
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...    73   3e-12
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...    72   3e-12
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    73   4e-12
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....    73   4e-12
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...    73   4e-12
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182       72   4e-12
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...    73   4e-12
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...    73   4e-12
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...    73   4e-12
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...    73   4e-12
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...    73   4e-12
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...    73   4e-12
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    73   4e-12
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...    73   4e-12
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...    73   4e-12
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...    73   4e-12
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...    73   4e-12
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...    73   4e-12
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...    71   4e-12
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...    73   4e-12
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...    73   5e-12
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...    73   5e-12
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...    72   5e-12
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...    72   5e-12
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...    73   5e-12
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341      73   5e-12
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...    72   5e-12
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    72   6e-12
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...    72   6e-12
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...    73   6e-12
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...    72   6e-12
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...    73   6e-12
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162     72   6e-12
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    73   6e-12
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...    71   6e-12
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...    72   6e-12
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    72   6e-12
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....    72   7e-12
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...    72   7e-12
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...    72   7e-12
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...    72   7e-12
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...    72   7e-12
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...    72   7e-12
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...    71   7e-12
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...    72   7e-12
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    72   7e-12
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...    72   7e-12
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    70   7e-12
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    72   7e-12
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    72   8e-12
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...    72   8e-12
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...    72   8e-12
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...    70   8e-12
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    72   8e-12
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...    72   8e-12
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...    72   8e-12
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    71   8e-12
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...    72   8e-12
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    71   9e-12
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...    72   9e-12
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...    72   1e-11
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...    72   1e-11
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...    70   1e-11
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...    70   1e-11
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...    72   1e-11
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...    70   1e-11
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    72   1e-11
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...    72   1e-11
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...    72   1e-11
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...    70   1e-11
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    71   1e-11
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...    72   1e-11
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...    72   1e-11
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...    72   1e-11
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...    72   1e-11
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...    72   1e-11
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    71   1e-11
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...    72   1e-11
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...    70   1e-11
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    72   1e-11
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    70   1e-11
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....    72   1e-11
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    71   1e-11
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...    72   1e-11
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...    71   1e-11
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...    71   1e-11
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...    71   1e-11
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    70   1e-11
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...    71   2e-11
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...    71   2e-11
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    71   2e-11
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    71   2e-11
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    70   2e-11
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...    71   2e-11
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...    71   2e-11
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...    70   2e-11
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...    70   2e-11
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}               71   2e-11
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...    71   2e-11
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    70   2e-11
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...    71   2e-11
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...    71   2e-11
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...    71   2e-11
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...    71   2e-11
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...    70   2e-11
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...    70   2e-11
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...    70   2e-11
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    70   2e-11
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654     71   2e-11
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...    69   2e-11
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    71   2e-11
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...    70   2e-11
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...    69   2e-11
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...    70   3e-11
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    71   3e-11
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....    70   3e-11
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...    70   3e-11
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...    69   3e-11
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...    70   3e-11
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...    70   3e-11
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    70   3e-11
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...    70   3e-11
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...    70   3e-11
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...    70   3e-11
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...    70   3e-11
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...    70   3e-11
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...    70   3e-11
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    69   3e-11
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...    69   3e-11
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    70   3e-11
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...    70   3e-11
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    70   3e-11
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...    70   3e-11
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    69   3e-11
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...    70   3e-11
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...    69   3e-11
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...    70   3e-11
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...    70   3e-11
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...    70   4e-11
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...    70   4e-11
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...    70   4e-11
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    70   4e-11
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...    70   4e-11
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...    70   4e-11
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    70   4e-11
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    70   4e-11
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    70   4e-11
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...    69   5e-11
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...    69   5e-11
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...    69   5e-11
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...    69   6e-11
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...    69   6e-11
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    69   6e-11
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    69   6e-11
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...    68   6e-11
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...    69   6e-11
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...    68   7e-11
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    69   7e-11
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    69   7e-11
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...    69   7e-11
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...    69   7e-11
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...    69   7e-11
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...    69   7e-11
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     68   7e-11
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...    69   8e-11
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...    68   8e-11
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    67   8e-11
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654     69   9e-11
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...    69   9e-11
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    69   9e-11
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...    69   9e-11
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...    69   1e-10
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...    69   1e-10
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...    68   1e-10
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    69   1e-10
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...    69   1e-10
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...    69   1e-10
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    68   1e-10
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    68   1e-10
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...    68   1e-10
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...    69   1e-10
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    69   1e-10
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...    67   1e-10
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...    68   1e-10
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...    68   1e-10
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              69   1e-10
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    67   1e-10
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    67   1e-10
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    68   1e-10
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...    68   1e-10
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...    67   2e-10
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    67   2e-10
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...    68   2e-10
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    68   2e-10
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    68   2e-10
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...    67   2e-10
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    67   2e-10
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    68   2e-10
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    68   2e-10
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...    67   2e-10
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     67   2e-10
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    67   2e-10
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...    67   2e-10
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    67   2e-10
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...    68   2e-10
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...    66   2e-10
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    67   2e-10
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...    68   2e-10
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    67   2e-10
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    66   2e-10
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...    67   2e-10
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    66   3e-10
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...    67   3e-10
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...    67   3e-10
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    67   3e-10
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    67   3e-10
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...    67   3e-10
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    66   3e-10
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...    66   3e-10
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...    66   3e-10
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    67   3e-10
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...    67   3e-10
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    67   3e-10
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...    66   3e-10
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    67   3e-10
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    65   4e-10
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    67   4e-10
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...    67   4e-10
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     66   4e-10
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...    65   4e-10
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    66   5e-10
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    66   5e-10
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....    67   5e-10
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    65   5e-10
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...    66   5e-10
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    65   5e-10
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...    66   5e-10
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    66   5e-10
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    66   5e-10
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    66   5e-10
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    66   6e-10
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...    65   6e-10
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...    65   6e-10
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    66   7e-10
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    65   7e-10
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...    65   7e-10
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    66   7e-10
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...    65   7e-10
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...    65   7e-10
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    65   7e-10
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    66   8e-10
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    65   8e-10
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...    65   8e-10
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               65   8e-10
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    65   8e-10
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...    65   8e-10
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    65   8e-10
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    65   9e-10
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    65   9e-10
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...    65   1e-09
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    64   1e-09
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...    65   1e-09
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...    65   1e-09
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    65   1e-09
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...    65   1e-09
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...    65   1e-09
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...    65   1e-09
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    65   1e-09
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    64   1e-09
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...    65   1e-09
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...    64   1e-09
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    64   1e-09
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    64   1e-09
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    64   1e-09
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....    65   1e-09
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...    65   1e-09
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...    64   1e-09
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    64   1e-09
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    65   1e-09
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    64   1e-09
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...    65   1e-09
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...    65   2e-09
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    65   2e-09
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...    64   2e-09
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    64   2e-09
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....    65   2e-09
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    64   2e-09
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    64   2e-09
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    64   2e-09
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    64   2e-09
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...    64   2e-09
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    64   2e-09
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...    64   2e-09
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...    64   2e-09
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    64   2e-09
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    64   2e-09
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...    64   2e-09
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    64   2e-09
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...    64   2e-09
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    64   2e-09
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...    64   2e-09
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...    64   2e-09
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...    64   2e-09
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    64   2e-09
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    64   2e-09
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...    64   3e-09
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....    64   3e-09
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...    63   3e-09
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    64   3e-09
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...    63   3e-09
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...    64   3e-09
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...    64   3e-09
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...    64   3e-09
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...    64   3e-09
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...    64   3e-09
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...    64   3e-09
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...    63   3e-09
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    63   3e-09
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    64   4e-09
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    64   4e-09
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    63   4e-09
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...    63   4e-09
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...    63   4e-09
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    63   4e-09
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    63   4e-09
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...    62   5e-09
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...    63   5e-09
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    63   5e-09
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    62   5e-09
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     63   5e-09
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...    63   5e-09
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    62   5e-09
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...    63   5e-09
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}               63   5e-09
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...    63   5e-09
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    63   5e-09
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    63   5e-09
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    62   5e-09
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...    63   5e-09
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...    62   6e-09
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    62   6e-09
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...    63   6e-09
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    62   6e-09
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...    62   6e-09
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    62   7e-09
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...    62   7e-09
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    62   7e-09
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...    62   7e-09
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    62   8e-09
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    62   8e-09
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    62   8e-09
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...    61   8e-09
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...    62   8e-09
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    62   8e-09
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    62   9e-09
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    62   9e-09
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}              62   9e-09
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...    62   9e-09
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    62   1e-08
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    62   1e-08
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    62   1e-08
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             62   1e-08
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    61   1e-08
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...    62   1e-08
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    61   1e-08
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    62   1e-08
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...    61   1e-08
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     62   1e-08
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    62   1e-08
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    62   1e-08
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    62   1e-08
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    62   1e-08
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...    62   1e-08
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...    61   1e-08
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    61   1e-08
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    61   1e-08
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    62   1e-08
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...    61   1e-08
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    61   1e-08
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    61   1e-08
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...    61   1e-08
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    61   2e-08
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...    61   2e-08
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...    61   2e-08
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    61   2e-08
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...    61   2e-08
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    60   2e-08
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    61   2e-08
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    61   2e-08
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    61   2e-08
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    61   2e-08
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    59   2e-08
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    61   2e-08
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...    61   2e-08
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    61   2e-08
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    59   2e-08
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...    61   2e-08
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    60   2e-08
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    61   2e-08
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    61   2e-08
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              61   2e-08
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192     60   2e-08
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    60   2e-08
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...    60   2e-08
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    60   3e-08
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    60   3e-08
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...    60   3e-08
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    58   3e-08
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...    60   3e-08
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...    60   3e-08
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...    60   3e-08
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    59   3e-08
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...    60   3e-08
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    60   3e-08
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    60   3e-08
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    60   3e-08
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...    60   3e-08
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    60   3e-08
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    60   3e-08
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    60   3e-08
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    59   3e-08
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    60   3e-08
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...    60   3e-08
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    60   3e-08
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...    60   3e-08
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...    59   3e-08
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    60   3e-08
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...    60   3e-08
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    60   3e-08
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    60   3e-08
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    60   4e-08
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    60   4e-08
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    60   4e-08
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    60   4e-08
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    60   4e-08
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    59   4e-08
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...    60   4e-08
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    60   4e-08
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)    60   4e-08
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    59   4e-08
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...    59   4e-08
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...    60   4e-08
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    59   4e-08
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    59   4e-08
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    59   4e-08
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...    60   4e-08
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...    60   5e-08
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    60   5e-08
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    58   5e-08
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    60   5e-08
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    58   5e-08
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    60   5e-08
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...    59   5e-08
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    59   5e-08
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     59   5e-08
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...    60   5e-08
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    60   5e-08
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...    59   6e-08
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...    59   6e-08
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    59   6e-08
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    58   6e-08
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              58   6e-08
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...    59   6e-08
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    59   6e-08
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    59   7e-08
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    59   7e-08
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....    59   7e-08
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...    59   7e-08
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...    58   7e-08
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    59   7e-08
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    59   7e-08
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    59   7e-08
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...    58   8e-08
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    59   8e-08
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    59   8e-08
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    59   8e-08
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    59   8e-08
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192     58   8e-08
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    59   8e-08
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    58   9e-08
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...    59   9e-08
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...    59   9e-08
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    57   9e-08
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    59   9e-08
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              59   9e-08
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...    59   9e-08
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...    59   1e-07
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...    59   1e-07
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    59   1e-07
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    57   1e-07
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...    58   1e-07
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...    58   1e-07
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...    59   1e-07
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    59   1e-07
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    59   1e-07
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    58   1e-07
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...    58   1e-07
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    57   1e-07
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...    59   1e-07
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...    59   1e-07
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...    59   1e-07
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    57   1e-07
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...    59   1e-07
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    58   1e-07
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    59   1e-07
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...    58   1e-07
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...    58   1e-07
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}               58   1e-07
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    58   1e-07
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...    58   1e-07
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    58   1e-07
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...    58   1e-07
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    58   1e-07
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...    58   1e-07
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    57   1e-07
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...    58   1e-07
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    57   2e-07
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    58   2e-07
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...    57   2e-07
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...    58   2e-07
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...    57   2e-07
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...    58   2e-07
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    57   2e-07
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    58   2e-07
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    57   2e-07
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...    58   2e-07
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     57   2e-07
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...    57   2e-07
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    58   2e-07
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    58   2e-07
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...    58   2e-07
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...    57   2e-07
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    57   2e-07
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    57   2e-07
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    58   2e-07
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...    57   2e-07
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    58   2e-07
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...    57   2e-07
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...    58   2e-07
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...    57   2e-07
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    57   2e-07
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...    57   2e-07
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    56   2e-07
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    57   2e-07
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...    57   2e-07
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    57   2e-07
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}               57   3e-07
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    57   3e-07
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...    57   3e-07
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...    57   3e-07
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214     56   3e-07
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    56   3e-07
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    56   3e-07
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    57   3e-07
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...    57   3e-07
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...    57   3e-07
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...    57   3e-07
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...    57   3e-07
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...    57   3e-07
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...    57   3e-07
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...    57   3e-07
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...    56   3e-07
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...    57   3e-07
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...    57   4e-07
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    57   4e-07
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    57   4e-07
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    57   4e-07
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...    57   4e-07
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    57   4e-07
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...    57   4e-07
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    57   4e-07
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    55   4e-07
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    57   4e-07
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...    57   4e-07
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...    56   4e-07
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    55   4e-07
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...    57   4e-07
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    55   4e-07
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    55   4e-07
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...    56   4e-07
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...    56   4e-07
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    56   4e-07
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...    56   4e-07
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    57   4e-07
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    56   4e-07
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...    56   5e-07
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...    56   5e-07
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...    56   5e-07
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    56   5e-07
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    56   5e-07
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    56   5e-07
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    56   5e-07
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    56   5e-07
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...    56   5e-07
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...    55   5e-07
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    56   5e-07
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...    56   5e-07
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    55   5e-07
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...    56   5e-07
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...    56   6e-07
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    56   6e-07
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    56   6e-07
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...    56   6e-07
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...    56   6e-07
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    56   6e-07
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...    56   6e-07
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    56   6e-07
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    56   6e-07
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...    56   6e-07
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...    56   6e-07
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    55   6e-07
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}               56   6e-07
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    55   7e-07
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    56   7e-07
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...    55   7e-07
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    56   7e-07
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    55   7e-07
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...    56   7e-07
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...    56   7e-07
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    56   7e-07
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    55   7e-07
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446     56   7e-07
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    55   8e-07
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    55   8e-07
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    55   9e-07
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    55   9e-07
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    55   9e-07
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...    55   9e-07
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    55   9e-07
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...    55   9e-07
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}               55   9e-07
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              55   1e-06
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...    55   1e-06
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    55   1e-06
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}              55   1e-06
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...    55   1e-06
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...    55   1e-06
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...    55   1e-06
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    55   1e-06
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...    55   1e-06
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    55   1e-06
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    55   1e-06
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...    55   1e-06
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...    55   1e-06
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    55   1e-06
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    55   1e-06
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...    55   1e-06
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...    55   1e-06
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    55   1e-06
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....    55   1e-06
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    55   1e-06
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    55   1e-06
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...    55   1e-06
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    55   1e-06
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    55   1e-06
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    55   1e-06
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...    55   1e-06
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    55   1e-06
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...    55   1e-06
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...    54   1e-06
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...    55   1e-06
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...    55   1e-06
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    55   1e-06
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    55   2e-06
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...    55   2e-06
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}              55   2e-06
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...    54   2e-06
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...    54   2e-06
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    55   2e-06
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...    54   2e-06
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    55   2e-06
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    54   2e-06
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...    55   2e-06
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    55   2e-06
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...    55   2e-06
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....    55   2e-06
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...    54   2e-06
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     54   2e-06
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    55   2e-06
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     54   2e-06
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    54   2e-06
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...    54   2e-06
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    54   2e-06
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    54   2e-06
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...    54   2e-06
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...    54   2e-06
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...    54   2e-06
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...    54   2e-06
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    54   3e-06
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...    54   3e-06
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    54   3e-06
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    54   3e-06
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    54   3e-06
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...    54   3e-06
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...    54   3e-06
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    54   3e-06
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...    54   3e-06
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    54   3e-06
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    54   3e-06
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    54   3e-06
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    54   3e-06
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...    54   3e-06
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...    53   3e-06
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      54   3e-06
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}               53   3e-06
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    53   3e-06
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    53   3e-06
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...    54   3e-06
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    53   3e-06
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    54   3e-06
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...    54   3e-06
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    53   3e-06
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    53   3e-06
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    54   3e-06
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...    53   3e-06
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    53   4e-06
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...    54   4e-06
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...    54   4e-06
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...    53   4e-06
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    54   4e-06
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    54   4e-06
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...    54   4e-06
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...    53   4e-06
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...    54   4e-06
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    54   4e-06
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...    53   4e-06
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    54   4e-06
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    54   4e-06
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    54   4e-06
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    53   4e-06
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...    52   5e-06
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...    53   5e-06
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...    52   5e-06
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...    53   5e-06
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    53   5e-06
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...    53   5e-06
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    53   5e-06
ZYRO0A08448g Chr1 complement(677122..678225) [1104 bp, 367 aa] {...    52   5e-06
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    53   5e-06
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    53   5e-06
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    53   5e-06
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...    53   5e-06
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...    52   5e-06
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    53   5e-06
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...    53   5e-06
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    53   5e-06
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    52   5e-06
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    53   5e-06
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    53   6e-06
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    53   6e-06
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    53   6e-06
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...    53   6e-06
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    53   6e-06
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    53   6e-06
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     53   6e-06
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    52   6e-06
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    53   6e-06
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    53   6e-06
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...    53   6e-06
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...    52   6e-06
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    52   6e-06
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...    53   6e-06
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....    53   6e-06
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    52   6e-06
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    52   6e-06
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...    52   6e-06
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...    52   6e-06
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    53   7e-06
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    53   7e-06
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               53   7e-06
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    53   7e-06
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    53   7e-06
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    52   7e-06
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...    52   7e-06
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    52   7e-06
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...    52   7e-06
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    53   7e-06
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...    52   7e-06
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    52   7e-06
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    52   7e-06
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    52   7e-06
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    52   7e-06
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       52   8e-06
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    52   8e-06
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     52   8e-06
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    52   8e-06
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    52   8e-06
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    52   8e-06
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    53   8e-06
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    52   8e-06
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    52   8e-06
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...    52   8e-06
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    53   8e-06
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...    52   8e-06
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...    52   8e-06
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...    52   9e-06
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    52   9e-06
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    52   9e-06
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    51   9e-06
TDEL0G03220 Chr7 complement(600259..601350) [1092 bp, 363 aa] {O...    52   9e-06
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    52   9e-06
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...    52   9e-06
KLTH0E09658g Chr5 (869857..870957) [1101 bp, 366 aa] {ON} highly...    52   9e-06
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...    52   1e-05
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    52   1e-05
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...    52   1e-05
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    52   1e-05
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    51   1e-05
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...    52   1e-05
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    52   1e-05
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    52   1e-05
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...    52   1e-05
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...    52   1e-05
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       52   1e-05
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    51   1e-05
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    51   1e-05
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    52   1e-05
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    52   1e-05
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    52   1e-05
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    51   1e-05
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    52   1e-05
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....    52   1e-05
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    52   1e-05
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...    52   1e-05
TBLA0B08810 Chr2 (2094401..2095375) [975 bp, 324 aa] {ON} Anc_2....    51   1e-05
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    52   1e-05
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    51   1e-05
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    52   1e-05
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...    52   1e-05
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    51   1e-05
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    52   1e-05
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    52   1e-05
Smik_13.338 Chr13 (528578..529690) [1113 bp, 370 aa] {ON} YMR139...    51   1e-05
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    52   1e-05
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    51   1e-05
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...    52   1e-05
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    52   1e-05
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    52   1e-05
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...    51   1e-05
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    51   1e-05
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....    52   1e-05
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    52   1e-05
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    50   1e-05
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...    51   1e-05
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...    52   1e-05
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    51   2e-05
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    52   2e-05
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    52   2e-05
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...    52   2e-05
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    51   2e-05
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    51   2e-05
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    51   2e-05
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    51   2e-05
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...    51   2e-05
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...    51   2e-05
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    51   2e-05
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    51   2e-05
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    51   2e-05
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    51   2e-05
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    51   2e-05
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    51   2e-05
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    52   2e-05
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               51   2e-05
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    51   2e-05
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    50   2e-05
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    51   2e-05
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    50   2e-05
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    51   2e-05
KAFR0F02710 Chr6 (528336..529493) [1158 bp, 385 aa] {ON} Anc_2.3...    50   2e-05
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    51   2e-05
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    50   2e-05
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...    51   2e-05
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    51   2e-05
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    51   2e-05
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               50   2e-05
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    51   2e-05
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    51   2e-05
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    51   2e-05
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    51   2e-05
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    51   2e-05
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    51   2e-05
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    50   2e-05
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    50   2e-05
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    51   2e-05
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...    50   2e-05
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...    50   2e-05
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    50   2e-05
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...    51   2e-05
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    51   2e-05
Kwal_47.17868 s47 (587449..588546) [1098 bp, 365 aa] {ON} YMR139...    50   3e-05
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    51   3e-05
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    50   3e-05
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...    50   3e-05
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    50   3e-05
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...    50   3e-05
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    50   3e-05
CAGL0L06820g Chr12 (769035..770135) [1101 bp, 366 aa] {ON} highl...    50   3e-05
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    50   3e-05
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    50   3e-05
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    50   3e-05
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    50   3e-05
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...    50   3e-05
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    50   3e-05
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...    50   3e-05
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    50   3e-05
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    51   3e-05
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    50   3e-05
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    51   3e-05
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    50   3e-05
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...    50   3e-05
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    50   3e-05
Suva_13.319 Chr13 (525309..526421) [1113 bp, 370 aa] {ON} YMR139...    50   3e-05
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...    50   3e-05
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    50   3e-05
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    50   3e-05
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    50   3e-05
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    50   3e-05
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    50   3e-05
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    50   4e-05
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...    50   4e-05
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    50   4e-05
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...    50   4e-05
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    50   4e-05
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    50   4e-05
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    50   4e-05
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    50   4e-05
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    50   4e-05
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    50   4e-05
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    50   4e-05
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    49   4e-05
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...    50   4e-05
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    49   4e-05
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    49   4e-05
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    50   4e-05
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     50   4e-05
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    49   4e-05
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    50   4e-05
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    50   4e-05
YMR139W Chr13 (546125..547237) [1113 bp, 370 aa] {ON}  RIM11Prot...    49   5e-05
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    49   5e-05
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    50   5e-05
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     49   5e-05
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    50   5e-05
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    50   5e-05
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    50   5e-05
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    50   5e-05
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    50   5e-05
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    50   5e-05
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    50   5e-05
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    49   5e-05
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    50   5e-05
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    50   5e-05
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    49   5e-05
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    50   6e-05
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    50   6e-05
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    49   6e-05
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    50   6e-05
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    49   6e-05
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...    49   6e-05
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    50   6e-05
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              49   6e-05
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    49   6e-05
Skud_16.391 Chr16 (704392..705723) [1332 bp, 443 aa] {ON} YPR106...    49   6e-05
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    49   6e-05
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    49   6e-05
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    50   6e-05
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    49   7e-05
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    49   7e-05
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    49   7e-05
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    48   7e-05
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    49   7e-05
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    49   7e-05
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    49   7e-05
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    49   8e-05
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    49   8e-05
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    49   8e-05
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    49   8e-05
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     49   8e-05
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    49   8e-05
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    49   8e-05
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    48   9e-05
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    49   9e-05
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    49   9e-05
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    49   9e-05
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    49   9e-05
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    49   9e-05
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    49   9e-05
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    49   9e-05
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    49   9e-05
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    49   1e-04
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    48   1e-04
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    48   1e-04
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    49   1e-04
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    49   1e-04
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    48   1e-04
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    48   1e-04
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    48   1e-04
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    49   1e-04
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     49   1e-04
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    49   1e-04
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    49   1e-04
KNAG0A05920 Chr1 complement(883522..884742) [1221 bp, 406 aa] {O...    48   1e-04
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    49   1e-04
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    48   1e-04
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    49   1e-04
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    49   1e-04
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    49   1e-04
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    48   1e-04
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    48   1e-04
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...    49   1e-04
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...    49   1e-04
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    49   1e-04
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    49   1e-04
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    48   1e-04
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    48   1e-04
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    49   1e-04
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    48   1e-04
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...    48   1e-04
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    48   1e-04
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...    48   1e-04
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    48   1e-04
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    49   1e-04
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    49   1e-04
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    49   1e-04
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    48   1e-04
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    48   1e-04
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    48   1e-04
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...    48   1e-04
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    48   2e-04
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...    48   2e-04
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...    48   2e-04
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    48   2e-04
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    48   2e-04
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    47   2e-04
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    48   2e-04
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    48   2e-04
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    47   2e-04
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    48   2e-04
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    48   2e-04
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    48   2e-04
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    47   2e-04
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    48   2e-04
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    48   2e-04
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    48   2e-04
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    47   2e-04
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    48   2e-04
Ecym_2302 Chr2 (587299..588951) [1653 bp, 550 aa] {ON} similar t...    48   2e-04
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...    47   2e-04
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    47   2e-04
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    47   2e-04
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    48   2e-04
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    47   2e-04
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...    47   2e-04
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    47   2e-04
SAKL0E04950g Chr5 (401903..402994) [1092 bp, 363 aa] {ON} highly...    47   3e-04
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...    48   3e-04
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    47   3e-04
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...    47   3e-04
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    47   3e-04
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    47   3e-04
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    48   3e-04
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     47   3e-04
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    47   3e-04
Smik_16.346 Chr16 (617471..618802) [1332 bp, 443 aa] {ON} YPR106...    47   3e-04
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    47   3e-04
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    47   3e-04
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    47   3e-04
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...    47   3e-04
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    47   3e-04
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    47   3e-04
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...    47   3e-04
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    46   3e-04
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    47   3e-04
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    47   3e-04
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    47   3e-04
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    47   3e-04
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    47   3e-04
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    47   3e-04
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    47   4e-04
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...    47   4e-04
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    47   4e-04
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...    46   4e-04
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    47   4e-04
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...    47   4e-04
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    47   4e-04
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    47   4e-04
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    47   4e-04
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    47   4e-04
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    47   4e-04
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    47   4e-04
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    47   4e-04
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...    44   4e-04
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    46   4e-04
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    47   4e-04
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...    47   5e-04
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    47   5e-04
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....    46   5e-04
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    46   5e-04
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    46   5e-04
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    46   5e-04
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      47   5e-04
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    46   5e-04
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    46   5e-04
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    46   5e-04
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    47   5e-04
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    45   5e-04
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    46   6e-04
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    46   6e-04
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    46   6e-04
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    46   6e-04
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    46   6e-04
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    46   6e-04
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    46   6e-04
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    46   6e-04
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    46   6e-04
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    46   6e-04
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...    46   6e-04
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    46   6e-04
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...    46   7e-04
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    46   7e-04
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...    46   7e-04
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      46   7e-04
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    45   7e-04
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    46   7e-04
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      46   7e-04
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               46   7e-04
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    46   7e-04
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    46   7e-04
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    45   8e-04
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    46   8e-04
KAFR0B04630 Chr2 (964764..966302) [1539 bp, 512 aa] {ON} Anc_1.3...    46   8e-04
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    45   8e-04
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...    46   8e-04
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...    46   8e-04
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    46   8e-04
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    45   8e-04
TBLA0D05210 Chr4 (1279846..1282323) [2478 bp, 825 aa] {ON} Anc_1...    46   8e-04
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...    45   8e-04
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    45   8e-04
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    45   8e-04
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    45   9e-04
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    45   0.001
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    46   0.001
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    46   0.001
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    45   0.001
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    45   0.001
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...    45   0.001
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    45   0.001
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    45   0.001
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    45   0.001
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    45   0.001
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...    45   0.001
TPHA0J02290 Chr10 (508389..510779) [2391 bp, 796 aa] {ON} Anc_6....    45   0.001
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    45   0.001
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    45   0.001
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    45   0.001
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               45   0.001
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    45   0.001
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    45   0.001
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    45   0.001
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    45   0.001
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    45   0.001
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...    44   0.001
TPHA0C01810 Chr3 complement(413495..414790) [1296 bp, 431 aa] {O...    45   0.001
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    45   0.001
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    45   0.001
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    45   0.001
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    45   0.001
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    45   0.001
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    44   0.001
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...    44   0.001
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...    45   0.001
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...    45   0.002
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...    44   0.002
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             45   0.002
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    45   0.002
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    45   0.002
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    45   0.002
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    44   0.002
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...    44   0.002
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    45   0.002
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    45   0.002
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    45   0.002
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    45   0.002
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    45   0.002
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    44   0.002
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...    45   0.002
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    45   0.002
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    44   0.002
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    44   0.002
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    44   0.002
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    45   0.002
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    44   0.002
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...    44   0.002
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    45   0.002
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    45   0.002
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    45   0.002
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    44   0.002
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    45   0.002
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    44   0.002
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    45   0.002
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    44   0.002
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    44   0.002
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...    44   0.002
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...    44   0.002
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...    44   0.002
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...    44   0.002
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    44   0.003
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    44   0.003
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    44   0.003
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    44   0.003
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    44   0.003
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    44   0.003
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    44   0.003
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    44   0.003
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    44   0.003
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    44   0.003
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    44   0.003
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...    43   0.003
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...    43   0.003
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...    44   0.003
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    44   0.004
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    44   0.004
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...    44   0.004
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    44   0.004
TPHA0I02660 Chr9 (582108..584219) [2112 bp, 703 aa] {ON} Anc_1.3...    44   0.004
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    43   0.004
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    44   0.004
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    43   0.004
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    44   0.004
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    43   0.004
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    43   0.004
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    44   0.004
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...    44   0.004
TDEL0H02380 Chr8 complement(399810..400931) [1122 bp, 373 aa] {O...    43   0.004
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    44   0.004
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    44   0.004
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    44   0.004
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    43   0.004
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    43   0.004
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    44   0.004
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    44   0.005
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    43   0.005
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    43   0.005
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    43   0.005
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    44   0.005
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    43   0.005
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    43   0.005
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    43   0.005
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    43   0.005
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    43   0.005
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...    43   0.005
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    43   0.006
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    43   0.006
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...    42   0.006
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    43   0.006
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...    43   0.006
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    43   0.006
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    43   0.006
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}               43   0.006
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    43   0.007
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    43   0.007
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    42   0.007
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...    43   0.007
TDEL0G01540 Chr7 complement(303940..306300) [2361 bp, 786 aa] {O...    43   0.007
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    43   0.008
KLTH0A03542g Chr1 (306667..307803) [1137 bp, 378 aa] {ON} highly...    42   0.008
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...    43   0.008
TBLA0B05130 Chr2 complement(1207884..1210484) [2601 bp, 866 aa] ...    43   0.008
Skud_10.153 Chr10 (288733..290742) [2010 bp, 669 aa] {ON} YJL057...    42   0.008
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    43   0.009
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    42   0.009
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...    42   0.010
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...    42   0.011
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...    42   0.011
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               42   0.011
Kwal_47.18098 s47 (685497..686621) [1125 bp, 374 aa] {ON} YIL035...    42   0.011
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    41   0.011
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    41   0.011
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    42   0.011
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    42   0.012
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    41   0.012
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    42   0.013
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    42   0.013
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    42   0.013
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    42   0.014
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    42   0.014
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...    42   0.014
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    42   0.014
Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...    42   0.015
TBLA0E02460 Chr5 (620609..621745) [1137 bp, 378 aa] {ON} Anc_7.2...    41   0.015
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    41   0.015
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    42   0.016
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    41   0.017
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    41   0.017
TDEL0B02610 Chr2 complement(470263..471282) [1020 bp, 339 aa] {O...    41   0.017
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...    41   0.018
Smik_7.269 Chr7 (446854..449094) [2241 bp, 746 aa] {ON} YGL021W ...    42   0.018
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    41   0.019
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    41   0.019
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    41   0.019
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...    41   0.020
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    41   0.021
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    41   0.022
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...    41   0.024
TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1....    41   0.025
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    41   0.026
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...    40   0.026
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    40   0.030
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...    40   0.032
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    40   0.034
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...    40   0.036
TPHA0B02780 Chr2 complement(633307..634449) [1143 bp, 380 aa] {O...    40   0.036
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    40   0.040
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    40   0.041
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    40   0.041
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...    40   0.041
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...    40   0.042
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    40   0.044
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    40   0.047
Kpol_1063.4 s1063 complement(10790..11932) [1143 bp, 380 aa] {ON...    40   0.048
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    40   0.050
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    40   0.056
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...    40   0.056
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    40   0.063
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    39   0.064
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    40   0.065
TBLA0F01730 Chr6 complement(431961..433004) [1044 bp, 347 aa] {O...    39   0.065
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    40   0.066
SAKL0A05038g Chr1 complement(458190..460628) [2439 bp, 812 aa] {...    40   0.067
KNAG0D02790 Chr4 (507235..508848) [1614 bp, 537 aa] {ON} Anc_5.3...    39   0.068
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    40   0.078
Skud_11.54 Chr11 (113775..116570) [2796 bp, 931 aa] {ON} YKL171W...    39   0.079
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    39   0.084
Suva_6.133 Chr6 (221952..223955) [2004 bp, 667 aa] {ON} YJL057C ...    39   0.095
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...    39   0.098
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    39   0.100
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    39   0.10 
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    39   0.11 
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                 39   0.11 
KAFR0A07320 Chr1 complement(1478564..1480033) [1470 bp, 489 aa] ...    39   0.11 
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    39   0.12 
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    39   0.12 
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    39   0.13 
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    39   0.13 
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    39   0.13 
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    39   0.13 
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    38   0.14 
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    39   0.14 
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    39   0.14 
YGL021W Chr7 (454785..457067) [2283 bp, 760 aa] {ON}  ALK1Protei...    39   0.15 
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    38   0.15 
CAGL0M08316g Chr13 (829069..831963) [2895 bp, 964 aa] {ON} weakl...    39   0.15 
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    38   0.16 
KLLA0F16467g Chr6 (1519800..1520822) [1023 bp, 340 aa] {ON} high...    38   0.16 
KLTH0B09042g Chr2 (736520..738112) [1593 bp, 530 aa] {ON} simila...    38   0.16 
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    39   0.17 
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...    38   0.18 
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    38   0.20 
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    38   0.21 
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      38   0.21 
ZYRO0B16038g Chr2 (1300484..1301515) [1032 bp, 343 aa] {ON} high...    38   0.21 
KLTH0H04686g Chr8 complement(419384..421726) [2343 bp, 780 aa] {...    38   0.22 
ZYRO0G08316g Chr7 (677123..679465) [2343 bp, 780 aa] {ON} simila...    38   0.22 
KNAG0F01490 Chr6 (270931..272604) [1674 bp, 557 aa] {ON} Anc_2.1...    38   0.22 
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...    38   0.22 
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    38   0.23 
TPHA0I01240 Chr9 (283537..285210) [1674 bp, 557 aa] {ON} Anc_2.1...    38   0.24 
NCAS0A08770 Chr1 complement(1733181..1734890) [1710 bp, 569 aa] ...    38   0.24 
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    38   0.24 
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    37   0.25 
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    37   0.25 
SAKL0F07854g Chr6 (600324..601442) [1119 bp, 372 aa] {ON} highly...    37   0.26 
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    38   0.27 
NCAS0B07200 Chr2 complement(1363351..1364940) [1590 bp, 529 aa] ...    37   0.33 
Suva_15.332 Chr15 complement(575263..575547,575959..576084,57614...    37   0.34 
CAGL0G06138g Chr7 complement(585585..587204) [1620 bp, 539 aa] {...    37   0.34 
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    37   0.37 
NDAI0E03210 Chr5 complement(686073..687317) [1245 bp, 414 aa] {O...    37   0.38 
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...    37   0.39 
NDAI0B04530 Chr2 complement(1128472..1130094) [1623 bp, 540 aa] ...    37   0.39 
TBLA0D00250 Chr4 (61918..63618) [1701 bp, 566 aa] {ON} Anc_2.105...    37   0.40 
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    37   0.41 
SAKL0C05236g Chr3 (498347..501385) [3039 bp, 1012 aa] {ON} simil...    37   0.41 
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    37   0.42 
Smik_8.216 Chr8 complement(349478..351145) [1668 bp, 555 aa] {ON...    37   0.42 
YHR135C Chr8 complement(372694..374310) [1617 bp, 538 aa] {ON}  ...    37   0.43 
Skud_8.196 Chr8 complement(346056..346463,346494..347684) [1599 ...    37   0.44 
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    36   0.45 
Skud_7.199 Chr7 (356300..358714) [2415 bp, 804 aa] {ON} YGL083W ...    37   0.48 
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    37   0.49 
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    37   0.50 
Smik_11.58 Chr11 (112932..115715) [2784 bp, 927 aa] {ON} YKL171W...    37   0.52 
SAKL0G13882g Chr7 complement(1191656..1194604) [2949 bp, 982 aa]...    37   0.52 
TDEL0E04680 Chr5 complement(875878..878862) [2985 bp, 994 aa] {O...    37   0.53 
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    36   0.53 
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    37   0.53 
Ecym_2618 Chr2 (1196140..1197453) [1314 bp, 437 aa] {ON} similar...    37   0.54 
CAGL0H03245g Chr8 (303335..305686) [2352 bp, 783 aa] {ON} simila...    37   0.54 
Skud_7.266 Chr7 (458004..460217) [2214 bp, 737 aa] {ON} YGL021W ...    37   0.54 
CAGL0G02035g Chr7 (179911..180930) [1020 bp, 339 aa] {ON} highly...    36   0.55 
Kpol_1027.20 s1027 complement(43412..44974) [1563 bp, 520 aa] {O...    37   0.56 
Smik_14.174 Chr14 complement(323054..324709) [1656 bp, 551 aa] {...    36   0.63 
NCAS0G02120 Chr7 (381894..383465) [1572 bp, 523 aa] {ON} Anc_2.105     36   0.63 
TDEL0F00910 Chr6 (157379..159070) [1692 bp, 563 aa] {ON} Anc_2.1...    36   0.63 
Ecym_4056 Chr4 complement(119406..120428) [1023 bp, 340 aa] {ON}...    36   0.65 
Skud_14.179 Chr14 complement(334239..335924) [1686 bp, 561 aa] {...    36   0.65 
SAKL0E12100g Chr5 complement(1004036..1005622) [1587 bp, 528 aa]...    36   0.66 
YGL083W Chr7 (353058..355472) [2415 bp, 804 aa] {ON}  SCY1Putati...    36   0.67 
KNAG0H03710 Chr8 complement(687550..689184) [1635 bp, 544 aa] {O...    36   0.67 
KNAG0I03000 Chr9 (596789..598840) [2052 bp, 683 aa] {ON} Anc_4.4...    36   0.67 
CAGL0J05940g Chr10 (562687..564147) [1461 bp, 486 aa] {ON} simil...    36   0.68 
ZYRO0F03190g Chr6 complement(270262..271371) [1110 bp, 369 aa] {...    36   0.70 
ADR204W Chr4 (1062593..1063612) [1020 bp, 339 aa] {ON} Syntenic ...    36   0.70 
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    36   0.71 
Suva_14.185 Chr14 complement(340104..341789) [1686 bp, 561 aa] {...    36   0.71 
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    36   0.73 
NDAI0F03150 Chr6 complement(757283..758923) [1641 bp, 546 aa] {O...    36   0.73 
YNL154C Chr14 complement(343636..345276) [1641 bp, 546 aa] {ON} ...    36   0.73 
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    36   0.73 
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    36   0.75 
KLTH0B06204g Chr2 complement(502282..503778) [1497 bp, 498 aa] {...    36   0.76 
Kpol_1002.61 s1002 complement(167383..169851) [2469 bp, 822 aa] ...    36   0.84 
TPHA0L02180 Chr12 (453556..455538) [1983 bp, 660 aa] {ON} Anc_5....    36   0.84 
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    35   0.92 
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    35   0.92 
Kwal_33.14596 s33 (735962..737464) [1503 bp, 500 aa] {ON} YNL154...    36   0.93 
AFR040W Chr6 (505602..507245) [1644 bp, 547 aa] {ON} Syntenic ho...    36   0.97 
KAFR0K01310 Chr11 (270172..271191) [1020 bp, 339 aa] {ON} Anc_5....    35   0.99 
Kpol_489.20 s489 complement(59150..60178) [1029 bp, 342 aa] {ON}...    35   1.0  
Suva_7.258 Chr7 (445704..447911) [2208 bp, 735 aa] {ON} YGL021W ...    36   1.1  
KAFR0F00520 Chr6 (111106..112659) [1554 bp, 517 aa] {ON} Anc_2.1...    35   1.1  
SAKL0H24508g Chr8 (2123140..2124606) [1467 bp, 488 aa] {ON} unip...    35   1.2  
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    35   1.3  
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    35   1.3  
Skud_15.228 Chr15 (403382..404401) [1020 bp, 339 aa] {ON} YOR061...    35   1.3  
YOR061W Chr15 (441534..442553) [1020 bp, 339 aa] {ON}  CKA2Alpha...    35   1.3  
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    35   1.3  
Ecym_8100 Chr8 complement(214001..216547) [2547 bp, 848 aa] {ON}...    35   1.4  
TBLA0A09370 Chr1 complement(2310412..2311443) [1032 bp, 343 aa] ...    35   1.4  
Smik_15.241 Chr15 (407598..408617) [1020 bp, 339 aa] {ON} YOR061...    35   1.4  
TPHA0H01300 Chr8 (293254..294282) [1029 bp, 342 aa] {ON} Anc_5.6...    35   1.4  
Ecym_8380 Chr8 (772519..774573) [2055 bp, 684 aa] {ON} similar t...    35   1.5  
Suva_8.111 Chr8 (204414..205433) [1020 bp, 339 aa] {ON} YOR061W ...    35   1.8  
KNAG0L01860 Chr12 (336795..337817) [1023 bp, 340 aa] {ON} Anc_5....    35   1.8  
Kwal_55.21709 s55 (948619..949641) [1023 bp, 340 aa] {ON} YOR061...    34   2.1  
KLTH0D02970g Chr4 complement(284533..285945) [1413 bp, 470 aa] {...    34   2.3  
NCAS0C05490 Chr3 (1114733..1115755) [1023 bp, 340 aa] {ON} Anc_5...    34   2.6  
Ecym_8392 Chr8 (803292..804806) [1515 bp, 504 aa] {ON} similar t...    34   2.6  
CAGL0J08998g Chr10 (884779..888624) [3846 bp, 1281 aa] {ON} high...    34   2.8  
NDAI0B02430 Chr2 (608926..610590) [1665 bp, 554 aa] {ON} Anc_8.132     34   3.0  
KLTH0F17490g Chr6 (1413752..1414774) [1023 bp, 340 aa] {ON} high...    34   3.2  
NDAI0I01190 Chr9 complement(285713..288214) [2502 bp, 833 aa] {O...    34   3.3  
TBLA0A02040 Chr1 complement(493305..495056) [1752 bp, 583 aa] {O...    34   3.5  
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    34   4.0  
SAKL0G00990g Chr7 complement(89700..90824) [1125 bp, 374 aa] {ON...    33   4.1  
KAFR0D04250 Chr4 (837888..839207) [1320 bp, 439 aa] {ON} Anc_3.4...    33   4.3  
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    33   5.3  
Kwal_26.7237 s26 complement(276089..277318) [1230 bp, 409 aa] {O...    33   5.6  
CAGL0K12496g Chr11 (1219220..1220302) [1083 bp, 360 aa] {ON} sim...    33   6.4  
Smik_10.287 Chr10 (449576..450592) [1017 bp, 338 aa] {ON} YJR008...    33   7.1  
KAFR0C02170 Chr3 (431896..434289) [2394 bp, 797 aa] {ON} Anc_6.1...    33   8.5  

>TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_2.284
            YNL020C
          Length = 1443

 Score = 2207 bits (5720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1132/1443 (78%), Positives = 1132/1443 (78%)

Query: 1    MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 60
            MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV
Sbjct: 1    MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 60

Query: 61   IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 120
            IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI
Sbjct: 61   IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 120

Query: 121  DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 180
            DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF
Sbjct: 121  DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 180

Query: 181  GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 240
            GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK
Sbjct: 181  GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 240

Query: 241  LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 300
            LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK
Sbjct: 241  LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 300

Query: 301  LQGVPCPIENFMLTRIKLQNSRNNSNKSTSLNDTTNNSFNNELALDQCXXXXXXXXXXXX 360
            LQGVPCPIENFMLTRIKLQNSRNNSNKSTSLNDTTNNSFNNELALDQC            
Sbjct: 301  LQGVPCPIENFMLTRIKLQNSRNNSNKSTSLNDTTNNSFNNELALDQCNSLSPTNSSTRR 360

Query: 361  XXXXXDTKRKSLMEADTPYLKPPISNPRSGHCVSPSLKLNVDTSKFXXXXXXXXXXXXXX 420
                 DTKRKSLMEADTPYLKPPISNPRSGHCVSPSLKLNVDTSKF              
Sbjct: 361  NSTFSDTKRKSLMEADTPYLKPPISNPRSGHCVSPSLKLNVDTSKFIASASVSPNNINSS 420

Query: 421  XXXXXXXXXXXXXXXXXXXXXXXITLNSLPFSTSPLSLAPVPINGPNTKGQSPTNSYISP 480
                                   ITLNSLPFSTSPLSLAPVPINGPNTKGQSPTNSYISP
Sbjct: 421  SPISNSYIPSISSIPNLNLSESPITLNSLPFSTSPLSLAPVPINGPNTKGQSPTNSYISP 480

Query: 481  TLTPIXXXXXXXXXXXXXXXXXXXXXXXXXXIPEIKVSPLYNSASMPNTNLTKPMPFSLP 540
            TLTPI                          IPEIKVSPLYNSASMPNTNLTKPMPFSLP
Sbjct: 481  TLTPIPGTLTKNTLPLPLPNSPTLNLSLPQPIPEIKVSPLYNSASMPNTNLTKPMPFSLP 540

Query: 541  PNIDXXXXXXXXXXXXXXXXXXXXXXXXXXXXTVADTPYLANIGSASPTTSISNRLQFFT 600
            PNID                            TVADTPYLANIGSASPTTSISNRLQFFT
Sbjct: 541  PNIDLSSKNLNLPELPSLNSTLSSPSHSPQLSTVADTPYLANIGSASPTTSISNRLQFFT 600

Query: 601  TSRHGSISSKIAHHNNNTINTSHXXXXXXXXXXXXXXXXTYMXXXXXXXXXXXXXXXXXX 660
            TSRHGSISSKIAHHNNNTINTSH                TYM                  
Sbjct: 601  TSRHGSISSKIAHHNNNTINTSHLQPSPQMSPPLSPQLLTYMPLPLSPQISPQSIPPALP 660

Query: 661  XXXXXDNXXXXXXXXXXXXXXXXXXXXXXXPNVSDSVTIGHSGNLGKIFKDSLFDDNSAI 720
                 DN                       PNVSDSVTIGHSGNLGKIFKDSLFDDNSAI
Sbjct: 661  PKLPIDNTLTLQQQFHTYQQQKQAQKITKLPNVSDSVTIGHSGNLGKIFKDSLFDDNSAI 720

Query: 721  DDSITVENTIQKDFTEXXXXXXXXXXXXXXXXTPHLKLILTHDSLNNDSTIDDTFAKKHD 780
            DDSITVENTIQKDFTE                TPHLKLILTHDSLNNDSTIDDTFAKKHD
Sbjct: 721  DDSITVENTIQKDFTESCNSSNLINLDSNSASTPHLKLILTHDSLNNDSTIDDTFAKKHD 780

Query: 781  NLRKLRSKDSNTSITSMFSEITNSSTKNVFVTTPRNDDAISKSQSSLNLIQFXXXXXXXX 840
            NLRKLRSKDSNTSITSMFSEITNSSTKNVFVTTPRNDDAISKSQSSLNLIQF        
Sbjct: 781  NLRKLRSKDSNTSITSMFSEITNSSTKNVFVTTPRNDDAISKSQSSLNLIQFSSSEASAK 840

Query: 841  XXXXXLNYKNQNTKIKVSTDSFSSTASPLSSRQNTGDSIKSAFXXXXXXXXXXXXXXXXX 900
                 LNYKNQNTKIKVSTDSFSSTASPLSSRQNTGDSIKSAF                 
Sbjct: 841  VSSSKLNYKNQNTKIKVSTDSFSSTASPLSSRQNTGDSIKSAFSKLRRSLSSSNPSRIIS 900

Query: 901  XXXXXXXXNKSSNFRNVSEPSTCDPQYTFSITMNPTTRISSVSRKSRYESDSSVYFSANS 960
                    NKSSNFRNVSEPSTCDPQYTFSITMNPTTRISSVSRKSRYESDSSVYFSANS
Sbjct: 901  SDTSSTRKNKSSNFRNVSEPSTCDPQYTFSITMNPTTRISSVSRKSRYESDSSVYFSANS 960

Query: 961  GSAFRRESVADSNIDKVESLGKNSSQYNNNSLQRMESVVENAPSETSFKLNSSLPKMSSV 1020
            GSAFRRESVADSNIDKVESLGKNSSQYNNNSLQRMESVVENAPSETSFKLNSSLPKMSSV
Sbjct: 961  GSAFRRESVADSNIDKVESLGKNSSQYNNNSLQRMESVVENAPSETSFKLNSSLPKMSSV 1020

Query: 1021 TDNSQTVKETIDNNFTQRIGSVVEYPLSRAESAVNSTSLSNELREVSAAVNILQRIDHEI 1080
            TDNSQTVKETIDNNFTQRIGSVVEYPLSRAESAVNSTSLSNELREVSAAVNILQRIDHEI
Sbjct: 1021 TDNSQTVKETIDNNFTQRIGSVVEYPLSRAESAVNSTSLSNELREVSAAVNILQRIDHEI 1080

Query: 1081 SQPVNETEFIEEDDSKEHTNPFTRDYSAKRDSFNTIXXXXXXXXXXXXTRKESVTANTSP 1140
            SQPVNETEFIEEDDSKEHTNPFTRDYSAKRDSFNTI            TRKESVTANTSP
Sbjct: 1081 SQPVNETEFIEEDDSKEHTNPFTRDYSAKRDSFNTINSQRLSSLSSNSTRKESVTANTSP 1140

Query: 1141 EREIAPDIFLQKTESLVKNSDSLQTTNSIQFESLLSGFYXXXXXXXXXXXXXXXXXXLRL 1200
            EREIAPDIFLQKTESLVKNSDSLQTTNSIQFESLLSGFY                  LRL
Sbjct: 1141 EREIAPDIFLQKTESLVKNSDSLQTTNSIQFESLLSGFYSRDSIINNSNSSKGDISSLRL 1200

Query: 1201 VSNPDAKDLIKKRVMELLKNSETDNGVTRTAHGYGKYTDKPNTSQNKAPQRTISMDFFEK 1260
            VSNPDAKDLIKKRVMELLKNSETDNGVTRTAHGYGKYTDKPNTSQNKAPQRTISMDFFEK
Sbjct: 1201 VSNPDAKDLIKKRVMELLKNSETDNGVTRTAHGYGKYTDKPNTSQNKAPQRTISMDFFEK 1260

Query: 1261 QAVFAKDSNSKHDIRRNNVSIISNTIGGAETNGYHSFNDYNYREPARHTSVKIHTLKESS 1320
            QAVFAKDSNSKHDIRRNNVSIISNTIGGAETNGYHSFNDYNYREPARHTSVKIHTLKESS
Sbjct: 1261 QAVFAKDSNSKHDIRRNNVSIISNTIGGAETNGYHSFNDYNYREPARHTSVKIHTLKESS 1320

Query: 1321 KKHGSFKSPPPLPPRISIDEKVKDQKLKEDTPXXXXXXXXXXXXVGRLRXXXXXXXXXXX 1380
            KKHGSFKSPPPLPPRISIDEKVKDQKLKEDTP            VGRLR           
Sbjct: 1321 KKHGSFKSPPPLPPRISIDEKVKDQKLKEDTPKKHTHRTTRKLLVGRLRKSSQSESSKKK 1380

Query: 1381 XXXXXXXXXXXXXXXXXXXXXXXXIPEPLIELDRCSLEXXXXXXXXXXLRHKSKILSHIG 1440
                                    IPEPLIELDRCSLE          LRHKSKILSHIG
Sbjct: 1381 HSESSKESSKESSKKKHSEQSHKKIPEPLIELDRCSLEKPIPPPKPKKLRHKSKILSHIG 1440

Query: 1441 VSK 1443
            VSK
Sbjct: 1441 VSK 1443

>SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 791

 Score =  482 bits (1240), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 212/315 (67%), Positives = 259/315 (82%), Gaps = 3/315 (0%)

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 60
           M+QP +  Y  G VL +G+H+  I KYL  GGFA +YS  +   S       ++ACLKRV
Sbjct: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEI---SPPDPNSSSIACLKRV 57

Query: 61  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 120
           +VPDK  LN+LRAEVDAMKLLK +K++VSYIDSHA +S L  G YEVFLLMEYC+RGG+I
Sbjct: 58  LVPDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLI 117

Query: 121 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 180
           DF+NTRL +RL+EFE+LKIMS V QGVAAMH LQPPLIHRDIKIENVLISE+G++K+CDF
Sbjct: 118 DFMNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDF 177

Query: 181 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 240
           GS C V+RPPK PQE  ++ HDI+ NTTAQYRSPEMID Y G P+DEKSDIWALGVFLYK
Sbjct: 178 GSVCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYK 237

Query: 241 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 300
           LCYYTTPFEK GE AIL+ KFQFP+YPQYSD ++N+I+ +L ++P++RPNICQ+L +VS+
Sbjct: 238 LCYYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSR 297

Query: 301 LQGVPCPIENFMLTR 315
           +QGVPCP++NF L R
Sbjct: 298 IQGVPCPVKNFYLER 312

 Score = 35.8 bits (81), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 39/57 (68%), Gaps = 4/57 (7%)

Query: 1198 LRLVSNPDAKDLIKKRVMELLKNSETDNGVTRTAHGYGKYTDKPNTSQNKAPQRTIS 1254
            +++ +N ++++ I+KRV +LLKNS+ D+ V +TA  +G+++  P   Q+ A   TIS
Sbjct: 634  IKMSANRESRNSIQKRVHDLLKNSQ-DSPVRKTAPDFGEFSSFP---QDHAADHTIS 686

>KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 777

 Score =  476 bits (1226), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 212/316 (67%), Positives = 259/316 (81%), Gaps = 2/316 (0%)

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 60
           MNQP+I KY  G +LP+G+HQV + KYLA GGFA VYSV +        +   +ACLKRV
Sbjct: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPD--NVACLKRV 58

Query: 61  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 120
           +VPDK+ LNTLRAEVD+MK L+GNK+IVSYIDSHA +S +  G YEV+LLMEYCS GG+I
Sbjct: 59  VVPDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLI 118

Query: 121 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 180
           DF+NTRL +RLQEFEIL IMS V QGVAAMH LQPPLIHRDIKIENVL+S+N ++K+CDF
Sbjct: 119 DFMNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDF 178

Query: 181 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 240
           GS   V+R P+  +E  ++ +DIM NTTAQYR PEMID Y G PIDEKSDIWALGVFLYK
Sbjct: 179 GSVSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYK 238

Query: 241 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 300
            CYYTTPFEK GE+AIL  KF+FP+YP+YSD ++N+I++ML  DP+KRPNICQV+E+VS+
Sbjct: 239 TCYYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSR 298

Query: 301 LQGVPCPIENFMLTRI 316
           +QG+PCPI+NF L R+
Sbjct: 299 IQGIPCPIKNFYLLRM 314

>TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.284
           YNL020C
          Length = 661

 Score =  469 bits (1208), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 214/321 (66%), Positives = 251/321 (78%), Gaps = 14/321 (4%)

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRV------IDSSNARNELGTM 54
           MNQPEIP Y  G VL +G+H   +  YL  GGFAQVYS  +      IDS+        +
Sbjct: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSN--------V 52

Query: 55  ACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYC 114
           ACLKRVIVPDK  LNTLRAEVDAMKLL+ NK++VSYIDSHA +S    G YEVFLLMEYC
Sbjct: 53  ACLKRVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYC 112

Query: 115 SRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGD 174
           + GG+IDF+NTRL +RLQEFEIL IMS V QG+AAMH LQPPLIHRDIKIENVLIS  G 
Sbjct: 113 AGGGLIDFMNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQ 172

Query: 175 YKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWAL 234
           YK+CDFGS C V+RPP+ PQE A++ HD++ NTTAQYRSPEMID Y G+PIDEKSDIWAL
Sbjct: 173 YKVCDFGSVCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWAL 232

Query: 235 GVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQV 294
           GVFLYKLCYYTTPFEK GE AIL+ +FQFP+ P YSD ++ +I  ML ++P +RPN+CQV
Sbjct: 233 GVFLYKLCYYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQV 292

Query: 295 LEQVSKLQGVPCPIENFMLTR 315
           LE VS++QG+ CP+ NF L R
Sbjct: 293 LEDVSRMQGIQCPVRNFYLLR 313

>Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {ON}
           YIL095W (PRK1) - probable serine/threonine-protein
           kinase [contig 27] FULL
          Length = 791

 Score =  469 bits (1206), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 208/315 (66%), Positives = 256/315 (81%), Gaps = 2/315 (0%)

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 60
           MNQP    Y +G  L +G+HQ  I KYL  GGFA +YS  +  S    N +G +ACLKRV
Sbjct: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEI--SPADPNSIGNVACLKRV 58

Query: 61  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 120
           +VPDK  LN LRAEVDAMKLL+GNK++VSYIDSHA +S  + G YEVFLLMEYCS GG+I
Sbjct: 59  LVPDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLI 118

Query: 121 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 180
           DF+NTRL +RL E E+LKIMSD+ QG+AAMH L PPLIHRDIKIENVLIS++  +K+CDF
Sbjct: 119 DFMNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDF 178

Query: 181 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 240
           GS C V+RPPK  QE +++ +DI+ NTTAQYRSPEMID Y G+PI+EKSDIWALGVFLYK
Sbjct: 179 GSVCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYK 238

Query: 241 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 300
           LCYYTTPFEK G+ AIL+ +FQFP+YPQYSD ++N+I++ML+++P +RPNICQVLE+VS+
Sbjct: 239 LCYYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSR 298

Query: 301 LQGVPCPIENFMLTR 315
           +Q VPCP+ NF L R
Sbjct: 299 IQNVPCPLRNFYLLR 313

 Score = 40.4 bits (93), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 40/68 (58%), Gaps = 13/68 (19%)

Query: 1198 LRLVSNPDAKDLIKKRVMELLKNSETDNGVTRTAHGYG------------KYTDKPNTSQ 1245
            ++L  + DA+  I+KRV  LLK+S+ D+ V ++AHGYG            ++T KP  ++
Sbjct: 640  VKLSGSSDARSSIQKRVQNLLKSSQ-DSPVKKSAHGYGEVSEKEDKESPEQFTGKPAVAE 698

Query: 1246 NKAPQRTI 1253
             +  +RT+
Sbjct: 699  ARPIKRTV 706

>Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W
           (REAL)
          Length = 805

 Score =  466 bits (1198), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 220/336 (65%), Positives = 260/336 (77%), Gaps = 8/336 (2%)

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVI--DSSNARNELGTMACLK 58
           MN P+I  YE G +L +G+H   I KYL  GGFAQVYS  +   D  ++ N    +ACLK
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYSAEISPPDPYSSAN----IACLK 56

Query: 59  RVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGG 118
           RVIVPDK GLNTLRAEVDAMKLLK NK++VSYIDSHA +S +    YEVF+LMEYC RGG
Sbjct: 57  RVIVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGVAYEVFVLMEYCERGG 115

Query: 119 VIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKIC 178
           +IDF+NTRL +RLQE EIL IM    QG+AAMH LQPPLIHRDIKIENVLIS  G YK+C
Sbjct: 116 LIDFMNTRLKNRLQESEILDIMGQTVQGIAAMHALQPPLIHRDIKIENVLISHEGLYKVC 175

Query: 179 DFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFL 238
           DFGS   V+RPPK PQE  ++ HDI+ NTTAQYRSPEMID Y G PIDEKSDIWALGVFL
Sbjct: 176 DFGSVSGVIRPPKNPQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFL 235

Query: 239 YKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 298
           YK+CYYTTPFEK GE AIL+ ++Q+PS+PQYSD ++N+I +ML + P +RPNICQVLE+V
Sbjct: 236 YKICYYTTPFEKTGEAAILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEV 295

Query: 299 SKLQGVPCPIENFMLTRIKLQNSRNNSNKSTSLNDT 334
           S+LQ  PCPI NF L R   QN++  S +STS+  T
Sbjct: 296 SRLQNRPCPIRNFYLLRAMNQNAQFGS-ESTSMTYT 330

 Score = 36.2 bits (82), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 28/43 (65%), Gaps = 1/43 (2%)

Query: 1205 DAKDLIKKRVMELLKNSETDNGVTRTAHGYGKYTDKPNTSQNK 1247
            + K+ I++RV  LL NSE D+   ++A GYGKYTD    S N+
Sbjct: 666  EKKESIQRRVHNLLNNSE-DSLSYKSASGYGKYTDTEAESTNR 707

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 21/31 (67%)

Query: 853 TKIKVSTDSFSSTASPLSSRQNTGDSIKSAF 883
           +K+K      S   SP+ SRQNTGDSI+SAF
Sbjct: 513 SKLKRVITGESRNGSPIKSRQNTGDSIRSAF 543

>TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.284
           YNL020C
          Length = 697

 Score =  462 bits (1189), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 212/321 (66%), Positives = 253/321 (78%), Gaps = 10/321 (3%)

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRV--IDSSNARNELGTMACLK 58
           MNQPEIP Y  G +LP+G+HQ  I KYL  GGFAQVY V +   D  +  N    +ACLK
Sbjct: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSN----IACLK 56

Query: 59  RVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSE----LKQGEYEVFLLMEYC 114
           RVIVPDK+ LN  RAEV+AMKLL+ NKY+VSYIDSHA +S     +  G YEVFLLMEYC
Sbjct: 57  RVIVPDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYC 116

Query: 115 SRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGD 174
           S  G+IDF+NTRL +RL+EFEIL IMS V QGVAAMH LQPPL+HRDIKIENVLIS   +
Sbjct: 117 SGKGLIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNE 176

Query: 175 YKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWAL 234
           +K+CDFGS C V+RPP    E  F+ HDI+ NTTAQYRSPEM+      PI+EKSDIWAL
Sbjct: 177 FKLCDFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWAL 236

Query: 235 GVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQV 294
           GVFLYK+CYYTTPFEKEGENAIL+ ++Q+P+YPQYSD+++N+I +ML  DP KRPNICQV
Sbjct: 237 GVFLYKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQV 296

Query: 295 LEQVSKLQGVPCPIENFMLTR 315
           +E+VS+LQGVPCP++NF L R
Sbjct: 297 VEEVSRLQGVPCPLKNFYLER 317

>ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL095W (PRK1) and
           YNL020C (ARK1)
          Length = 750

 Score =  464 bits (1193), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 204/317 (64%), Positives = 253/317 (79%), Gaps = 3/317 (0%)

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 60
           MNQ      + G +L +G+H+V I +YL  GGFAQ+YS  V+     +   G++ACLKRV
Sbjct: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQ---GSLACLKRV 57

Query: 61  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 120
            VPDK  LNTLRAEVDAMK+LKG++++VSYIDSHA +S    G YEV+LLMEYC RGG+I
Sbjct: 58  HVPDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLI 117

Query: 121 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 180
           DF+N+RL  RL EFE+LKIMS V QG+ AMH L PPLIHRDIKIENVLIS +GD+K+CDF
Sbjct: 118 DFMNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDF 177

Query: 181 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 240
           GS   V+RPPK   E  ++ HDI+ NTTAQYR+PEMID Y   P+DEKSDIWALGVFLYK
Sbjct: 178 GSVSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYK 237

Query: 241 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 300
           +CY+TTPFEK GENAIL  KFQFPSYPQY+D ++N+I++ML++ P++RPNICQVLE+VS+
Sbjct: 238 VCYFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSR 297

Query: 301 LQGVPCPIENFMLTRIK 317
           +QGVPCP+ NF L R+K
Sbjct: 298 IQGVPCPLPNFYLERMK 314

>Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar to
           Ashbya gossypii ADL217W
          Length = 748

 Score =  464 bits (1193), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 208/315 (66%), Positives = 251/315 (79%), Gaps = 3/315 (0%)

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 60
           MNQ     ++ G VL +G+H+V + KYL  GGFAQ+Y   VI   +   ++  +ACLKRV
Sbjct: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDS---KVKDVACLKRV 57

Query: 61  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 120
            VPDK  LNTLRAEVDAMKLL+GNK+IVSYIDSHA +S L  G YEV LLMEYCSRGG+I
Sbjct: 58  HVPDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLI 117

Query: 121 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 180
            F+NTRL  RL+EFE+L+IM+ V QG+ AMH LQPPLIHRDIKIENVLI+ENGD K+CDF
Sbjct: 118 SFMNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDF 177

Query: 181 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 240
           GS C V+RPPK   E +++ HDI+ NTTAQYR+PEMID Y G+ +DEKSDIWALGVFLYK
Sbjct: 178 GSVCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYK 237

Query: 241 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 300
           LCYYTTPFEK GE AIL   FQFPSYPQYS+ ++N+IT+ML ++PI RPN CQVLE+V +
Sbjct: 238 LCYYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCR 297

Query: 301 LQGVPCPIENFMLTR 315
           +QG PCP++NF L R
Sbjct: 298 IQGQPCPVKNFYLER 312

>KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {ON}
           Anc_2.284 YNL020C
          Length = 780

 Score =  464 bits (1195), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 208/323 (64%), Positives = 251/323 (77%), Gaps = 3/323 (0%)

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 60
           MN P+I  +  G++L +G+H   + KYL  GG+AQVY V +  S    N    +ACLKRV
Sbjct: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYIN--SNIACLKRV 58

Query: 61  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 120
           IVPDK  LNTLRAEVDAMKLLK N+++VSYIDSHA +S +  G YEVF+LME+C RGG+I
Sbjct: 59  IVPDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLI 118

Query: 121 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 180
           DF+N+RL HRL E EIL IMS   QG+AAMH LQP L+HRDIKIENVLIS+N +YK+CDF
Sbjct: 119 DFMNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDF 178

Query: 181 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 240
           GS C ++RPPK  QE  F++HDIM NTTAQYRSPEM+D   G PI+EKSDIWALGVFLYK
Sbjct: 179 GSVCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYK 238

Query: 241 LCYYTTPFEKE-GENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVS 299
           LCYYTTPFEK  GE AIL  +FQ+PSYP YSD ++N+I +ML+K+P  RPN+CQVLE+VS
Sbjct: 239 LCYYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVS 298

Query: 300 KLQGVPCPIENFMLTRIKLQNSR 322
           +LQG+PCPI NF L R    N R
Sbjct: 299 RLQGIPCPIRNFYLLRAMENNKR 321

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 41/75 (54%), Gaps = 1/75 (1%)

Query: 1198 LRLVSNPDAKDLIKKRVMELLKNSETDNGVT-RTAHGYGKYTDKPNTSQNKAPQRTISMD 1256
            +R+  N + K+ I+KRV +LLKN+E +   T RTA GYGKYTD        +P ++    
Sbjct: 644  VRMSVNREMKNSIQKRVQDLLKNAEENTTATVRTASGYGKYTDYNKNKDEISPTKSRVAQ 703

Query: 1257 FFEKQAVFAKDSNSK 1271
            F +  A  A  S  +
Sbjct: 704  FNQSTAALASLSGKR 718

>ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 704

 Score =  460 bits (1183), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 210/333 (63%), Positives = 261/333 (78%), Gaps = 11/333 (3%)

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVI--DSSNARNELGTMACLK 58
           MN PEIP Y  G VL +GTH   I KY+A GGFAQVYS  +   D+    N++    CLK
Sbjct: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKV----CLK 56

Query: 59  RVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGG 118
           RVI+P+K+GLN LRAEV+AMKLLKG+K++V YIDSHA RS L+ G YEVFLLME+C+ GG
Sbjct: 57  RVIIPEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGG 116

Query: 119 VIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKIC 178
           +IDF+NTRL +RL+E+EIL IMS V QG+AAMH LQPPLIHRDIKIENVLIS +G+YK+C
Sbjct: 117 LIDFMNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVC 176

Query: 179 DFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFL 238
           DFGS    +RPP+ PQE AF+ HDI+ NTTAQYRSPEMID Y    IDEKSDIWALG+FL
Sbjct: 177 DFGSVSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFL 236

Query: 239 YKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 298
           YKLCYYTTPFEK G+ AIL+ ++QF ++P YSD ++N+I+ ML++ P++RPNICQVLE+V
Sbjct: 237 YKLCYYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEV 296

Query: 299 SKLQGVPCPIENFMLTRIKLQNSRNNSNKSTSL 331
           S++QGV  P+ NF L R     +  ++N STS 
Sbjct: 297 SRMQGVSSPMRNFYLLR-----AMQHTNTSTSF 324

>KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p- Sla1p-End3p
           protein complex
          Length = 790

 Score =  462 bits (1189), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 208/318 (65%), Positives = 256/318 (80%), Gaps = 8/318 (2%)

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVID---SSNARNELGTMACL 57
           MNQ     Y+ G  L +G+H+  I KYL  GGFA +Y+  +     SS A+     +ACL
Sbjct: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAK-----IACL 55

Query: 58  KRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRG 117
           KRV+VPDK  LN LRAEVDAMKLL+GN+++VSYIDSHA +S +  G YEVFLLMEYCS G
Sbjct: 56  KRVLVPDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGG 115

Query: 118 GVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKI 177
           G+IDF+NTRL +RLQE E+LKI SD+ QG+AAMH LQPPLIHRDIKIENVLIS++  +K+
Sbjct: 116 GLIDFMNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKV 175

Query: 178 CDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVF 237
           CDFGS C V+RPPK PQE  ++ HDI+ NTTAQYR+PEMID Y GYPI+EKSDIWALGVF
Sbjct: 176 CDFGSVCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVF 235

Query: 238 LYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQ 297
           LYKLCYYTTPFEK GE AIL+ +FQFPSYPQYSD ++++I+ ML+++P +RPNICQVLE+
Sbjct: 236 LYKLCYYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEE 295

Query: 298 VSKLQGVPCPIENFMLTR 315
           VS++QG PCP+ NF +TR
Sbjct: 296 VSRIQGTPCPLRNFYVTR 313

 Score = 36.2 bits (82), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 22/26 (84%), Gaps = 1/26 (3%)

Query: 1210 IKKRVMELLKNSETDNGVTRTAHGYG 1235
            I+KRV +LLKNS+ D+ V +TAHGYG
Sbjct: 647  IQKRVQDLLKNSQ-DSPVKKTAHGYG 671

 Score = 33.9 bits (76), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 22/30 (73%), Gaps = 1/30 (3%)

Query: 854 KIKVSTDSFSSTASPLSSRQNTGDSIKSAF 883
           K+KV T    S  SP+ SRQNTGDS++SAF
Sbjct: 518 KLKVFTGERRSI-SPIKSRQNTGDSVRSAF 546

>NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa]
           {ON} Anc_2.284
          Length = 723

 Score =  459 bits (1180), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 211/325 (64%), Positives = 256/325 (78%), Gaps = 3/325 (0%)

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 60
           MNQP IP Y  G +L +G+H   I KYL  GGFAQ+Y+   I   N  N   T ACLKRV
Sbjct: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTE-ISPINPYNNSQT-ACLKRV 58

Query: 61  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 120
           IVPDK+GLNTLRAEVDAMKLLK N+++VSYIDSHA RS +  G YEVFLLMEYC  GG+I
Sbjct: 59  IVPDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLI 118

Query: 121 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 180
           DF+NTRL +RL E EIL I+S   QGV+AMH LQP LIHRDIKIENVLIS  G++KICDF
Sbjct: 119 DFMNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDF 178

Query: 181 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 240
           GS CS +RPP+ PQE A++ HD++ NTTAQYR+PEM+D Y G PI+EKSDIWALGVFLYK
Sbjct: 179 GSVCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYK 238

Query: 241 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 300
           LCYYTTPFEK GE AIL+ ++Q+P++P Y+D ++N+I   L +DP KRPNICQ+LE++S+
Sbjct: 239 LCYYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISR 298

Query: 301 LQGVPCPIENFMLTR-IKLQNSRNN 324
           +QG+PCPI NF L+R I +Q S  N
Sbjct: 299 IQGIPCPINNFYLSRTINVQASLMN 323

 Score = 33.9 bits (76), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 25/42 (59%)

Query: 1198 LRLVSNPDAKDLIKKRVMELLKNSETDNGVTRTAHGYGKYTD 1239
            ++L S    ++ I+ RV  LL+  E +    +TA GYGKYTD
Sbjct: 586  VKLKSLSTQRESIQNRVKALLETFEEEPSTIKTASGYGKYTD 627

>NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {ON}
           Anc_2.284
          Length = 756

 Score =  458 bits (1178), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 204/319 (63%), Positives = 255/319 (79%), Gaps = 6/319 (1%)

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRV--IDSSNARNELGTMACLK 58
           MNQP IP Y  G +L +GTH+ +I+KYL  GGFAQ+Y+V +  +D+ +  N    +ACLK
Sbjct: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSN----VACLK 56

Query: 59  RVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGG 118
           RVIVP KSGLNTLRAEVDAMKLLK N+++VSYIDS+A +S    G YEV LLMEYC  GG
Sbjct: 57  RVIVPTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGG 116

Query: 119 VIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKIC 178
           +IDF+N+RL +RL E EIL I+S   QGVA MH LQP L+HRDIKIENVL S NG++K+C
Sbjct: 117 LIDFMNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLC 176

Query: 179 DFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFL 238
           DFGS C  +RPP+  QE +++ HDI+ NTTAQYR PEM+D Y G PIDEKSDIWALGVFL
Sbjct: 177 DFGSVCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFL 236

Query: 239 YKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 298
           YKLCYYTTPFEK GENAIL+ KFQ+P++P YSD ++N+I +ML+++P KRPNIC++LE++
Sbjct: 237 YKLCYYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEI 296

Query: 299 SKLQGVPCPIENFMLTRIK 317
           S +QGVPCPI+NF L R +
Sbjct: 297 SSIQGVPCPIQNFYLIRAQ 315

>NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {ON} 
          Length = 661

 Score =  452 bits (1162), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 202/313 (64%), Positives = 243/313 (77%), Gaps = 2/313 (0%)

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 60
           MNQP+IP Y+ G +L +G+H+V + KYL  GGFAQ+Y+V++       N    +ACLKRV
Sbjct: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTN--TNVACLKRV 58

Query: 61  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 120
           IVPDK  LNTLRAEVD MKLL+ N ++VSYIDSHA +    +G YEVFLLMEYC  GG+I
Sbjct: 59  IVPDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLI 118

Query: 121 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 180
           DF+NTRL  RL+E EIL IMS V QG+AAMH L PPL+HRDIKIENVL++  G+YK+CDF
Sbjct: 119 DFMNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDF 178

Query: 181 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 240
           GS C ++RPP   QE +++ HDIM NTTAQYR+PEMID Y G PIDEKSDIWALGVFLYK
Sbjct: 179 GSVCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYK 238

Query: 241 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 300
           LCYYTTPFEK GE AIL+  FQFP+YPQYSD ++ +IT ML + P +RPN  QVLE+VS 
Sbjct: 239 LCYYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSS 298

Query: 301 LQGVPCPIENFML 313
           +Q V CPI NF L
Sbjct: 299 MQNVQCPIPNFYL 311

>YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protein
           serine/threonine kinase; regulates the organization and
           function of the actin cytoskeleton and reduces endocytic
           ability of cell through the phosphorylation of the
           Pan1p-Sla1p-End3p protein complex
          Length = 810

 Score =  456 bits (1173), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 208/321 (64%), Positives = 248/321 (77%), Gaps = 3/321 (0%)

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 60
           MN P+I  YE G +L +G+H   I KYL  GGFAQVY+  +       N    +ACLKRV
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSN--ANIACLKRV 58

Query: 61  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 120
           IVP K GLNTLRAEVDAMKLL+ NK++VSYIDSHA RS +    YEVF+LME+C RGG+I
Sbjct: 59  IVPHKQGLNTLRAEVDAMKLLRNNKHVVSYIDSHAARS-VNGIAYEVFVLMEFCERGGLI 117

Query: 121 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 180
           DF+NTRL +RLQE EIL+IMS   QG+ AMH LQPPLIHRDIKIENVLIS +G YK+CDF
Sbjct: 118 DFMNTRLQNRLQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHDGLYKVCDF 177

Query: 181 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 240
           GS   V+RPP+  QE  ++ HDI+ NTTAQYRSPEMID Y G PIDEKSDIWALGVFLYK
Sbjct: 178 GSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYK 237

Query: 241 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 300
           +CYYTTPFEK GE  IL+ ++Q+PS+PQYSD ++N+I +ML + P +RPNICQVLE+VS+
Sbjct: 238 ICYYTTPFEKSGEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSR 297

Query: 301 LQGVPCPIENFMLTRIKLQNS 321
           LQ  PCPI NF L R   QN+
Sbjct: 298 LQNKPCPIRNFYLLRAMNQNA 318

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 31/46 (67%), Gaps = 3/46 (6%)

Query: 1203 NPDAKDLIKKRVMELLKNSETDNGVT-RTAHGYGKYTDKPNTSQNK 1247
            N + K+ I++RV  LLK+S  D+ VT ++A GYGKYTD    + N+
Sbjct: 669  NQEKKESIQRRVHNLLKSS--DDPVTYKSASGYGKYTDIGTETSNR 712

 Score = 33.9 bits (76), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 21/31 (67%)

Query: 853 TKIKVSTDSFSSTASPLSSRQNTGDSIKSAF 883
           +K+K      S   SP+ SRQNTGDSI+SAF
Sbjct: 515 SKLKKVITGESRGNSPIKSRQNTGDSIRSAF 545

>Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W
           (REAL)
          Length = 808

 Score =  456 bits (1172), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 208/322 (64%), Positives = 249/322 (77%), Gaps = 3/322 (0%)

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 60
           MN P+I  YE G +L +G+H   I KYL  GGFAQVY+  +       N    +ACLKRV
Sbjct: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTN--ANIACLKRV 58

Query: 61  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 120
           IVPDK GLNTLRAEVDAMKLLK NK++VSYIDSHA +S +    YEVF+LME+C RGG+I
Sbjct: 59  IVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGVAYEVFVLMEFCERGGLI 117

Query: 121 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 180
           DF+NTRL +RL+E EIL+IMS   QG+AAMH LQPPLIHRDIKIENVLIS NG YK+CDF
Sbjct: 118 DFMNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDF 177

Query: 181 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 240
           GS   V+RPP+  QE  ++ HDI+ NTTAQYRSPEMID Y G PIDEKSDIWALG+FLYK
Sbjct: 178 GSVSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYK 237

Query: 241 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 300
           +CYYTTPFEK GE  IL+ ++Q+P +PQYSD ++N+I +ML + P KRPNICQVLE+VS+
Sbjct: 238 ICYYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSR 297

Query: 301 LQGVPCPIENFMLTRIKLQNSR 322
           LQ  PCPI NF L R   Q ++
Sbjct: 298 LQIKPCPIRNFYLLRAMSQTAQ 319

 Score = 36.6 bits (83), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 29/45 (64%), Gaps = 1/45 (2%)

Query: 1203 NPDAKDLIKKRVMELLKNSETDNGVTRTAHGYGKYTDKPNTSQNK 1247
            N + K+ I++RV  LLK+SE D    ++A GYGKYTD    + N+
Sbjct: 667  NQEKKESIQRRVHNLLKSSE-DPLTYKSASGYGKYTDTDTETSNR 710

>Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W
           (REAL)
          Length = 809

 Score =  452 bits (1163), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 208/322 (64%), Positives = 248/322 (77%), Gaps = 3/322 (0%)

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 60
           MN P+I  Y+ G VL +G+H   I KYL  GGFAQVY+  +       N     ACLKRV
Sbjct: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSN--ANTACLKRV 58

Query: 61  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 120
           IVPDK GLNTLRAEVDAMKLLK NK++VSYIDSHA +S +    YEVF+LME+C RGG+I
Sbjct: 59  IVPDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKS-VNGIAYEVFVLMEFCERGGLI 117

Query: 121 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 180
           DF+NTRL  RL+E EIL+IMS   QG+AAMH LQPPLIHRDIKIENVLIS +G YK+CDF
Sbjct: 118 DFMNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDF 177

Query: 181 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 240
           GS   V+RPP+  QE  ++ HDI+ NTTAQYRSPEMID Y   PIDEKSDIWALGVFLYK
Sbjct: 178 GSVSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYK 237

Query: 241 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 300
           +CYYTTPFEK GE AIL+ ++Q+PS+PQYSD ++ +I +ML + P +RPNICQVLE+VS+
Sbjct: 238 ICYYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSR 297

Query: 301 LQGVPCPIENFMLTRIKLQNSR 322
           LQ  PCPI NF L R   QN++
Sbjct: 298 LQNEPCPIRNFYLLRAMGQNAQ 319

 Score = 35.8 bits (81), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 23/31 (74%)

Query: 853 TKIKVSTDSFSSTASPLSSRQNTGDSIKSAF 883
           +K+K      S ++SP+ SRQNTGDSI+SAF
Sbjct: 515 SKLKKVITGESRSSSPIKSRQNTGDSIRSAF 545

 Score = 34.7 bits (78), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 1207 KDLIKKRVMELLKNSETDNGVTRTAHGYGKYTD 1239
            K+ I++RV  LL NSE D    ++A GYGKYTD
Sbjct: 672  KESIQRRVHNLLNNSE-DPLAHKSASGYGKYTD 703

>Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {ON}
           YNL020C (REAL)
          Length = 639

 Score =  446 bits (1147), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 201/313 (64%), Positives = 246/313 (78%), Gaps = 2/313 (0%)

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 60
           MNQP+I  Y  G  L +G+HQV I KYL  GGFAQVYS  +  S    +    +ACLKRV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIVKYLTSGGFAQVYSALI--SPPDPHSHSNIACLKRV 58

Query: 61  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 120
           IVPDK  LNTLRAEVDAM+LL+ N+Y+VSYIDSHA ++ L  G YEVF+LMEYC RGG+I
Sbjct: 59  IVPDKPSLNTLRAEVDAMRLLRNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLI 118

Query: 121 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 180
           DF+NTRL +RL EFEIL+IMS V QGVAAMH LQPPLIHRDIKIENVLIS N +YK+CDF
Sbjct: 119 DFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDF 178

Query: 181 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 240
           GS C V+RPP+ PQE +++  DI  NTTAQYRSPEM+D + G PIDEKSDIWALG+FLYK
Sbjct: 179 GSVCGVIRPPRNPQELSYVQQDIFKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYK 238

Query: 241 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 300
           LCYYTTPFEK GE AIL+  F+FP YP YS+ +R++I  +L ++P +RPN+ Q+L+++S 
Sbjct: 239 LCYYTTPFEKGGEPAILSGHFEFPPYPDYSEQLRDLIRDILVQNPCQRPNVYQLLKRISI 298

Query: 301 LQGVPCPIENFML 313
           +Q VPCPI +  +
Sbjct: 299 MQNVPCPISDIQV 311

>NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284
          Length = 621

 Score =  445 bits (1145), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 204/315 (64%), Positives = 243/315 (77%), Gaps = 2/315 (0%)

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 60
           MNQP++  Y  G +L +G+HQ  I KYL  GGFAQVY+  +       N   ++ CLKRV
Sbjct: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFIN--SSIVCLKRV 58

Query: 61  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 120
           IVPDK  LNTLRAEVDAMKLL+ N ++VSYIDSHA + +   G YEVFLLMEYC RGG+I
Sbjct: 59  IVPDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLI 118

Query: 121 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 180
           DF+NTRL +RL E EIL IMS V QGVAAMH LQPPL+HRDIKIENVL++  G YK+CDF
Sbjct: 119 DFMNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDF 178

Query: 181 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 240
           GS C ++RPP  PQE  ++ HDIM NTTAQYRSPEMI+   G PI+EKSDIWALGVFLYK
Sbjct: 179 GSVCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYK 238

Query: 241 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 300
           LCYYTTPFEK GENAIL+  FQFP++P YSD ++++I I LN  P +RPNI Q+LE+VSK
Sbjct: 239 LCYYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSK 298

Query: 301 LQGVPCPIENFMLTR 315
           +Q VPCPI +F L R
Sbjct: 299 IQNVPCPIPDFYLQR 313

>YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON}
           ARK1Serine/threonine protein kinase involved in
           regulation of the cortical actin cytoskeleton; involved
           in control of endocytosis
          Length = 638

 Score =  444 bits (1143), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 201/315 (63%), Positives = 246/315 (78%), Gaps = 2/315 (0%)

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 60
           MNQP+I  Y  G  L +G+HQV I KYL  GGFAQVYS  +       N   ++ACLKRV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSN--SSVACLKRV 58

Query: 61  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 120
           IVPDK  LNTLRAEVDAM+LLK N+Y+VSYIDSHA ++ L  G YEVF+LMEYC RGG+I
Sbjct: 59  IVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLI 118

Query: 121 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 180
           DF+NTRL +RL EFEIL+IMS V QGVAAMH LQPPLIHRDIKIENVLIS N +YK+CDF
Sbjct: 119 DFMNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDF 178

Query: 181 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 240
           GS C ++RPP+  QE +++  DI+ NTTAQYRSPEMID + G PIDEKSDIWALG+FLYK
Sbjct: 179 GSVCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYK 238

Query: 241 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 300
           LCYYTTPFEK G+ AIL+ KF+FP YP YS+ ++ +I  +L +DP  RPN+ Q+L+++S 
Sbjct: 239 LCYYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISI 298

Query: 301 LQGVPCPIENFMLTR 315
           +Q VPCPI +  + +
Sbjct: 299 MQNVPCPINDIQVVQ 313

>Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON}
           (89266..91407) [2142 nt, 714 aa]
          Length = 713

 Score =  447 bits (1149), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 202/316 (63%), Positives = 249/316 (78%), Gaps = 4/316 (1%)

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGT-MACLKR 59
           MNQP+IP Y +G  L +G H   I KYL  GG+AQVY  ++   S   +  G+ + CLKR
Sbjct: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKI---SPPDSRTGSDIVCLKR 57

Query: 60  VIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGV 119
           +IVPDK+ LNT RAEVDAMKLL+   ++VSYIDS+A +S L  G YEV LLME+C+ GG+
Sbjct: 58  LIVPDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGL 117

Query: 120 IDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICD 179
           IDF+NTRL +RLQEFEIL IMS V QGVAAMH L+PPL+HRDIKIENVLIS +G+YK+CD
Sbjct: 118 IDFMNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCD 177

Query: 180 FGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLY 239
           FGS C V+RPP + QE  F+ HDI+ NTTAQYR+PEMID     PIDEKSDIWALGVFLY
Sbjct: 178 FGSVCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLY 237

Query: 240 KLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVS 299
           KLCYYTTPFEK GE AIL+ ++++ +YP YSD+++N+I +ML   P +RPNICQVLE+VS
Sbjct: 238 KLCYYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVS 297

Query: 300 KLQGVPCPIENFMLTR 315
           +LQG+PCPI+NF L R
Sbjct: 298 RLQGIPCPIKNFYLER 313

>KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {ON}
           Anc_2.284 YNL020C
          Length = 369

 Score =  432 bits (1112), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 206/343 (60%), Positives = 257/343 (74%), Gaps = 13/343 (3%)

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVI--DSSNARNELGTMACLK 58
           MNQP+I  Y  G +LP+G+HQV I KY+  GGFAQ+Y+V +   DS    N    +ACLK
Sbjct: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSN----IACLK 56

Query: 59  RVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGG 118
           RVIVPDK  LNTLRAEVDAMKLL+ NK++VSYIDSHA +S    G YEVFLLMEYC RGG
Sbjct: 57  RVIVPDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGG 116

Query: 119 VIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKIC 178
           +IDF+NTRL +RL E E+L I S V QG+AAMH LQPPL+HRDIKIENVLIS++  YKIC
Sbjct: 117 LIDFMNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKIC 176

Query: 179 DFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFL 238
           DFGS   ++RPP  PQE  ++ HD++ NTTAQYRSPEMID Y G PIDEKSDIWA+GVFL
Sbjct: 177 DFGSVSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFL 236

Query: 239 YKLCYYTTPFEKE-GENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQ 297
           YKLCYYTTPFEK  GE AIL+ ++++P++P YS+ ++++I  ML ++P +RPNI QV+E+
Sbjct: 237 YKLCYYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEE 296

Query: 298 VSKLQGVPCPIENFMLTRIKLQNSRNNSNKSTSLNDTTNNSFN 340
           +SK+Q VPCPI NF L       ++   +K   L     N+ N
Sbjct: 297 ISKMQNVPCPIVNFYLV------TQQQKHKMVQLQPIPVNTLN 333

>CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095w PRK1
          Length = 688

 Score =  442 bits (1136), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 204/317 (64%), Positives = 239/317 (75%), Gaps = 6/317 (1%)

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSS--NARNELGTMACLK 58
           MNQPE+ +   G  L +GTH V I KYL  GGFAQ+Y+V ++     N  N    +ACLK
Sbjct: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSN----VACLK 56

Query: 59  RVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGG 118
           RV VPDK  LN LRAEVDAMKLL  NK++VSYIDSHA RS    G YEVFLLMEYC  GG
Sbjct: 57  RVKVPDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGG 116

Query: 119 VIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKIC 178
           +IDF+NTRL +RL E EIL IMS   QG+A MH L PPL+HRDIKIENVL+S+ G YK+C
Sbjct: 117 LIDFMNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVC 176

Query: 179 DFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFL 238
           DFGS   V+RPP+  QE  ++ HDIM NTTAQYR PEM+D Y G PIDEK+DIWALGVFL
Sbjct: 177 DFGSVSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFL 236

Query: 239 YKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 298
           YKLCYYTTPFEK GE AIL+ +FQFPS+P YSD ++N+I  ML + P  RPN+CQVLE+V
Sbjct: 237 YKLCYYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEV 296

Query: 299 SKLQGVPCPIENFMLTR 315
           S++Q VPCPI NF L R
Sbjct: 297 SRMQNVPCPIRNFYLLR 313

 Score = 35.8 bits (81), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 34/57 (59%), Gaps = 3/57 (5%)

Query: 1198 LRLVSNPDA--KDLIKKRVMELLKNSETDNGVTRTAHGYGKYTDKPNTSQNKAPQRT 1252
             RL  NP++  +  I+ RV  LL N  + N V ++A GYGKYTD+ +++    P+ T
Sbjct: 539  FRLPLNPNSEKRKSIQLRVQHLLDNMSS-NEVKKSAQGYGKYTDELSSTGTNIPKVT 594

>TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON}
           Anc_2.284 YNL020C
          Length = 717

 Score =  441 bits (1133), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 203/329 (61%), Positives = 250/329 (75%), Gaps = 3/329 (0%)

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 60
           MNQP I  Y+ G  L +G HQV I KYL  GGFAQ+Y V+V +  N  N +  +ACLKRV
Sbjct: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQV-NPPNPINGM-NLACLKRV 58

Query: 61  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 120
           IVP+KSGLNTLRAEV+AM+LLKG  ++V YIDS+A RS    G YEV  LME+C  GG+I
Sbjct: 59  IVPEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLI 118

Query: 121 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 180
           DF+NTRL +RL+EFE+L IM+ V QG+ AMH L PPLIHRDIKIENVLIS NG+YK+CDF
Sbjct: 119 DFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDF 178

Query: 181 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 240
           GS   ++RPPK  +E  F+  DIM NTTAQYR PEM+D Y G PI+EKSDIWALGVFLYK
Sbjct: 179 GSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYK 238

Query: 241 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 300
           +CYYTTPFE  GE AIL+ ++Q+P YP YS  ++N+I +ML + P +RPN+CQVLE+VS 
Sbjct: 239 ICYYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSS 298

Query: 301 LQGVPCPIENFMLTRIKL-QNSRNNSNKS 328
           +QG+PCP+ NF L R +  Q   NN+N S
Sbjct: 299 MQGIPCPLPNFYLQRQQATQLMMNNTNGS 327

>Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa]
           {ON} complement(102096..104201) [2106 nt, 702 aa]
          Length = 701

 Score =  440 bits (1131), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 206/334 (61%), Positives = 256/334 (76%), Gaps = 11/334 (3%)

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRV--IDSSNARNELGTMACLK 58
           MNQ ++P Y    V+ +G+H   I KYLA GG+AQVYS  V  +D S A N    +ACLK
Sbjct: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATN----IACLK 56

Query: 59  RVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGG 118
           RV+VPDK  LN LRAEVDA+K+L+  KY+VSYIDSHA +     G YEVF+LMEYCS G 
Sbjct: 57  RVVVPDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGS 116

Query: 119 VIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKIC 178
           +IDFLNTRL +RL+E EIL IM+ V  GVA MH LQP LIHRDIKIEN+LISENG+YK+C
Sbjct: 117 LIDFLNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVC 176

Query: 179 DFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFL 238
           DFGS C V+RPP++ +E  +I HDIM NTTAQYRSPEM+D   GY I+EKSDIWALGVFL
Sbjct: 177 DFGSVCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFL 236

Query: 239 YKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 298
           +KLCYYTTPFEKEGE AIL  +FQ+P+YP YSD ++N+I ++L+ DP KRPNICQ++E++
Sbjct: 237 FKLCYYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEEL 296

Query: 299 SKLQGVPCPIENFMLTRI-----KLQNSRNNSNK 327
           S+LQG+  P++NF L+R       +Q  +NNS K
Sbjct: 297 SRLQGIVPPMKNFYLSRALETSSLMQPLQNNSYK 330

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 29/42 (69%), Gaps = 1/42 (2%)

Query: 1198 LRLVSNPDAKDLIKKRVMELLKNSETDNGVTRTAHGYGKYTD 1239
            ++L +  +AKD IK+RV ELL  SE D    RTA GYGKYTD
Sbjct: 602  IKLKTTREAKDSIKRRVRELLLVSE-DEQYHRTASGYGKYTD 642

>Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {ON}
           YNL020C (REAL)
          Length = 637

 Score =  437 bits (1124), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 199/308 (64%), Positives = 244/308 (79%), Gaps = 2/308 (0%)

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 60
           MNQP+I  Y  G  L +G+HQV I KYL  GGFAQVYSV +       N    +ACLKRV
Sbjct: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNT--NVACLKRV 58

Query: 61  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 120
           IVPDK  LNTLRAEVDAM+LLK N+Y+VSYIDSHA ++ L+ G YEVF+LMEYC RGG+I
Sbjct: 59  IVPDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLI 118

Query: 121 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 180
           DF+NTRL +RL EFEIL+I+S V QGVAAMH LQPPLIHRDIKIENVLIS N +YK+CDF
Sbjct: 119 DFMNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDF 178

Query: 181 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 240
           GS C ++R P+  QE +++  DI+ NTTAQYRSPEMID + G PIDEKSDIWALG+FLYK
Sbjct: 179 GSVCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYK 238

Query: 241 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 300
           LCYYTTPFEK GE AIL+ KF+FP YP YS+ ++++I  +L ++P  RP++ Q+L+++S 
Sbjct: 239 LCYYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISI 298

Query: 301 LQGVPCPI 308
           +Q VPCPI
Sbjct: 299 MQNVPCPI 306

>Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {ON}
           YNL020C (REAL)
          Length = 632

 Score =  435 bits (1118), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 197/310 (63%), Positives = 241/310 (77%), Gaps = 2/310 (0%)

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 60
           MNQP+I  Y  G  L +G+HQV I KYL  GGFAQVYS  +       N    +ACLKRV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTN--SNVACLKRV 58

Query: 61  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 120
           IVPDK+ LNTLRAEVDAMKLL+ N+Y+VSYIDSHA ++ L  G YEVF+LMEYC RGG+I
Sbjct: 59  IVPDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLI 118

Query: 121 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 180
           DF+NTRL +RL E EIL+IM  V QGVAAMH LQPPLIHRDIKIENVLIS   +YK+CDF
Sbjct: 119 DFMNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDF 178

Query: 181 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 240
           GS C V+RPP+ PQE +++  D++ NTTAQYRSPEM+D + G PIDEKSDIWALG+FLYK
Sbjct: 179 GSVCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYK 238

Query: 241 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 300
           LCYYTTPFEK GE AILN +F+F  YP YS+ +RN+I  +L ++P +RPN+ Q+L+Q++ 
Sbjct: 239 LCYYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITN 298

Query: 301 LQGVPCPIEN 310
           +Q  P PI +
Sbjct: 299 MQNAPYPIRD 308

>CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} similar
           to uniprot|P53974 Saccharomyces cerevisiae YNL020c ARK1
           or uniprot|P40494 Saccharomyces cerevisiae YIL095w PRK1
          Length = 622

 Score =  431 bits (1109), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 205/327 (62%), Positives = 248/327 (75%), Gaps = 5/327 (1%)

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGT-MACLKR 59
           MN P IPKYE G  + +G+H V I KYL  GG+AQ+YS +++    A   LGT MA LKR
Sbjct: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMP---ADQFLGTNMAVLKR 57

Query: 60  VIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGV 119
           VIVPDKS LNTLRAEVDAMK LK +KYIVSYIDSHA +S+   G YEVFL+MEYCSRGG+
Sbjct: 58  VIVPDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGL 117

Query: 120 IDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICD 179
           IDF+NTRL +RL E EIL I   + QGVAAMH LQPPLIHRDIKIENVLIS +  YK+CD
Sbjct: 118 IDFMNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCD 177

Query: 180 FGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLY 239
           FGS    +RPPKTP+E A++ HDIM++TTAQYR+PEM+D   G+ +++KSDIWALGVFLY
Sbjct: 178 FGSVSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLY 237

Query: 240 KLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVS 299
           KLCYYTTPFE+ GE  ILN   +FP YP YSD ++ +I  ML K+P+ RPNI Q+++ VS
Sbjct: 238 KLCYYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVS 297

Query: 300 KLQGVPCPIENFML-TRIKLQNSRNNS 325
           KL  V CPI N  + T I +  S NN+
Sbjct: 298 KLLNVNCPIPNIHVPTDISIAVSNNNT 324

>KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {ON}
           Anc_2.284 YNL020C
          Length = 592

 Score =  419 bits (1076), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 197/340 (57%), Positives = 250/340 (73%), Gaps = 7/340 (2%)

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRV--IDSSNARNELGTMACLK 58
           MNQP I  Y +G  L +G+HQV I KYL  GGFAQ+Y   +  ID  +  N    +ACLK
Sbjct: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTN----IACLK 56

Query: 59  RVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGG 118
           RVIVPDK  LN LRAEVDAMKLL+ N+ +VSYIDSHA +S  + G YEVFLLMEYC  GG
Sbjct: 57  RVIVPDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGG 116

Query: 119 VIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKIC 178
           +I+FLN+RL +RL+E E++ IM  V QGVAAMH LQPPL+HRDIKIENVL+S+N ++K+C
Sbjct: 117 LINFLNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLC 176

Query: 179 DFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFL 238
           DFGS    +RPP  PQE A + +DIM NTTAQYRSPEMID   G+PIDEKSDIWALGVFL
Sbjct: 177 DFGSVSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFL 236

Query: 239 YKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 298
           YK+CYYTTPFEK GE  IL  +++FP++P YSD +R++I+ +L   P  RPNI  V++++
Sbjct: 237 YKICYYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKEL 296

Query: 299 SKLQGVPCPIENFMLTRIKLQNSRNNSNKSTSLNDTTNNS 338
           S ++ + CPI NF L +  + ++ NN     S+ + TN S
Sbjct: 297 SDMKNISCPIINFYL-KPNMTDASNNIQHLHSIMNNTNTS 335

>KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {ON}
           Anc_2.284 YNL020C
          Length = 788

 Score =  412 bits (1058), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 186/324 (57%), Positives = 242/324 (74%), Gaps = 8/324 (2%)

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 60
           MNQP IP Y  G V+ +G+HQ  I KYL  GGFAQ+YSV +       N    +ACLKRV
Sbjct: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTN--SNIACLKRV 58

Query: 61  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 120
           IVP+KSGLN LR EVDAMKLLK N+++VSYIDS+A +SE   G YEVFLLMEYC RG ++
Sbjct: 59  IVPNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLL 118

Query: 121 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 180
           DF+NT+L  RLQE E+L IM+ VCQG+AAMH L PPLIHRDIKIENVLIS +G +K+CDF
Sbjct: 119 DFMNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDF 178

Query: 181 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEK---SDIWALGVF 237
           GS C ++RPP+ PQE  ++ HD+M NTTAQYRSPEMID   G+PI+ K      W + + 
Sbjct: 179 GSVCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERKIRHLGSWCVALQ 238

Query: 238 LYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQ 297
           +  L +YT  F ++ E AILN ++Q+P+YP YSD ++N++ ++L+  P+KRPNICQ+LE+
Sbjct: 239 IM-LLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEE 295

Query: 298 VSKLQGVPCPIENFMLTRIKLQNS 321
           +SK+Q +PCPI+NF L R + Q +
Sbjct: 296 ISKIQNIPCPIDNFYLERSRHQGA 319

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 1/35 (2%)

Query: 1207 KDLIKKRVMELLKNSETDNGVTRTAHGYGKYTDKP 1241
            K  I+KRV+ LLKN+E D+ V +TA GYGKYT +P
Sbjct: 635  KASIEKRVLNLLKNAE-DSPVKKTAAGYGKYTKRP 668

>TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {ON}
           Anc_2.284 YNL020C
          Length = 707

 Score =  409 bits (1051), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 185/315 (58%), Positives = 240/315 (76%), Gaps = 2/315 (0%)

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 60
           M+Q    KY+KG  L + +H+VIIE YL  GGFAQVY+ R+  +S  +N    + CLKRV
Sbjct: 1   MSQIFEDKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARI--TSEHKNLYPELTCLKRV 58

Query: 61  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 120
           IVP+K  LN LRAEVDAMK+LK NKYIVSYIDSHA R +  +  Y V LLMEYCS  G++
Sbjct: 59  IVPNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLL 118

Query: 121 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 180
           DF+N RL  RL+E EILKIM+DV QGV  MH LQPPL+HRDIKIENVL+S +G++K+CDF
Sbjct: 119 DFMNLRLKERLKEEEILKIMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDF 178

Query: 181 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 240
           GS   VLR P + +E  ++ +DI+ NTTAQYRSPEM++   G+PI+EKSDIWALG+ LYK
Sbjct: 179 GSVSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYK 238

Query: 241 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 300
           LCYYTTPFE+ G  AI+  KF +P+YPQY+D ++NII ++L+ +PI+RPNICQ+LE++ +
Sbjct: 239 LCYYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFR 298

Query: 301 LQGVPCPIENFMLTR 315
           +Q    P+ NF + R
Sbjct: 299 IQHKSSPLPNFYVQR 313

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 62/120 (51%), Gaps = 8/120 (6%)

Query: 764 SLNNDSTIDDTFAKKHDNLRKLRSKDSNTSITSMFSEITNSSTKNVFVTTPRNDDAISKS 823
           S+N++ST+++  + KH++    R    +   +     IT++   N+   TPR+ D+   S
Sbjct: 432 SINDNSTLNNMTSLKHEHSFNSREAYIHPDFSGSKHFITSNDALNLNCRTPRSRDSSINS 491

Query: 824 QSSLNLIQFXXXXXXXXXXXXXLNYKNQNTKIKVSTDSFSSTASPLSSRQNTGDSIKSAF 883
            SS++ I                  K+  TKIK++T     + SP+ SRQNTGDSI+SAF
Sbjct: 492 NSSVDSISRNSTGGSLI--------KSLGTKIKLTTTGGKRSQSPIKSRQNTGDSIRSAF 543

 Score = 45.8 bits (107), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/40 (57%), Positives = 30/40 (75%), Gaps = 1/40 (2%)

Query: 1200 LVSNPDAKDLIKKRVMELLKNSETDNGVTRTAHGYGKYTD 1239
            L++N +AK  IK RV  L+K+S +DN V  +AHGYGKYTD
Sbjct: 622  LITNLEAKKSIKDRVQALMKSS-SDNHVIISAHGYGKYTD 660

>KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.273
           YBR059C
          Length = 913

 Score =  318 bits (815), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 156/320 (48%), Positives = 220/320 (68%), Gaps = 18/320 (5%)

Query: 6   IPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARN-----------ELGTM 54
           + KY+ G+V+ +G+H+V I +Y+A GGFAQ+YSV+ ++ +N  +           ++G +
Sbjct: 15  VEKYQPGKVIVVGSHRVEILQYIAEGGFAQIYSVKFLEYANEFDREESPGSKDQLQVGDL 74

Query: 55  ACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQR------SELKQGEYEVF 108
           ACLKRVIV D++GLN LR EV+ MK L G   IV Y DS+A R      S+ ++ ++EV 
Sbjct: 75  ACLKRVIVQDQNGLNELRNEVNVMKKLVGAPNIVQYYDSNASRLRNGTDSQPQENKFEVL 134

Query: 109 LLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVL 168
           LLME C    ++D++N RL  +L E EIL++M DV   +A MHYL+ PLIHRDIKIENVL
Sbjct: 135 LLMELCPNKSLLDYMNLRLATKLSEQEILEVMYDVSLAIAQMHYLRKPLIHRDIKIENVL 194

Query: 169 ISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEK 228
           + +   +K+CDFGS  +      T ++ A++  +I ++TT QYRSPEMID Y   PIDEK
Sbjct: 195 VDQKNRFKLCDFGSTSTCFPMVVTHRDIAYLTQNIYVHTTPQYRSPEMIDLYRCLPIDEK 254

Query: 229 SDIWALGVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKR 288
           SDIWALG+FLYKL ++TTPFE+ G+ AIL+ KF+FP    YS  + N+I +ML+++P  R
Sbjct: 255 SDIWALGIFLYKLLFFTTPFERTGQFAILHSKFEFPQN-NYSFKLINLIIVMLSENPNLR 313

Query: 289 PNICQVLEQVSKLQGVPCPI 308
           PNI QVL Q+ +L+ VP PI
Sbjct: 314 PNIYQVLHQICQLKQVPIPI 333

>KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}
           Anc_3.273 YBR059C
          Length = 949

 Score =  318 bits (814), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 162/318 (50%), Positives = 211/318 (66%), Gaps = 16/318 (5%)

Query: 6   IPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVID----------SSNAR-----NE 50
           I K+EKG+ L +GTH+V I  YL  GGFAQ+Y V+ I+           SN R      +
Sbjct: 28  IEKFEKGQNLAVGTHKVEIVDYLTEGGFAQIYVVKFIEVLNEFDNEDNGSNVRISNYSLK 87

Query: 51  LGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLL 110
           LG +ACLKRV+V D+ GLN +R EV+ MK L+G   IV Y DS+A RS      YEV LL
Sbjct: 88  LGDVACLKRVLVYDEVGLNEMRNEVNVMKKLRGCPNIVQYYDSNATRSHNGNPGYEVLLL 147

Query: 111 MEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLIS 170
           ME CS   +++++N RL  +L E E+LKIM DV  GVA MHYL+ PLIHRDIKIENVL+ 
Sbjct: 148 MELCSNNSLLNYMNQRLATQLSEKEVLKIMYDVTSGVAQMHYLKTPLIHRDIKIENVLVD 207

Query: 171 ENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSD 230
            N ++K+CDFGSA +      T Q+ A +  ++ ++TT QYRSPEMID Y   PI+EKSD
Sbjct: 208 SNNNFKLCDFGSATTCPPVATTHQDIALLGQNVYVHTTPQYRSPEMIDLYRYLPINEKSD 267

Query: 231 IWALGVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPN 290
           IWALGVFLYKL +YTTPFE  G+ A+L+ KF  P+  +YS  I N++ IML+++   RPN
Sbjct: 268 IWALGVFLYKLLFYTTPFETTGQFAMLHSKFDIPA-NKYSSKIINLVIIMLSENLNLRPN 326

Query: 291 ICQVLEQVSKLQGVPCPI 308
           I QV+  + +L  V  PI
Sbjct: 327 IYQVMHYICQLIQVDTPI 344

>KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {ON}
           Anc_3.273 YBR059C
          Length = 912

 Score =  316 bits (809), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 169/343 (49%), Positives = 214/343 (62%), Gaps = 31/343 (9%)

Query: 8   KYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVI----------DSSNARN-------- 49
           K+  G V+ +G H+V I KYLA GGFAQ+YSV  I          DS+   N        
Sbjct: 18  KFNPGAVVAVGRHKVEIIKYLAEGGFAQIYSVNFIEYLNEFSNEPDSTEDSNIDEFQQFK 77

Query: 50  -ELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVF 108
            E G +ACLKRV+VPD++GLN LR EV+ M+ LKG   IV Y DS+A R       +EV 
Sbjct: 78  LEPGNLACLKRVMVPDENGLNELRNEVNVMRKLKGTPNIVQYYDSNASRRHDGNPGFEVL 137

Query: 109 LLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVL 168
           LLME C    ++D++N RL  +L E EILKIM DV  G++ MHYLQ PLIHRDIKIENVL
Sbjct: 138 LLMELCPNNSLLDYMNQRLTTKLSEKEILKIMYDVTLGISQMHYLQKPLIHRDIKIENVL 197

Query: 169 ISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEK 228
           +  + ++K+CDFGS  +      + QE A +  +I ++TT QYRSPEMID Y   PIDEK
Sbjct: 198 VDSSNNFKLCDFGSTSACFPIVTSHQEIAVLTQNIYVHTTPQYRSPEMIDLYRNLPIDEK 257

Query: 229 SDIWALGVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKR 288
           SDIWALGVFLYKL +YTTPFE  G+ AIL+ K++ P    YS  + N+I IML ++P  R
Sbjct: 258 SDIWALGVFLYKLLFYTTPFEMTGQFAILHSKYEIPPN-NYSSRLINLIIIMLAENPNLR 316

Query: 289 PNICQVLEQVSKLQGVPCPI-----------ENFMLTRIKLQN 320
           PNI QV+ QV    G+  PI           EN+   + KLQN
Sbjct: 317 PNIYQVMHQVCITIGIEPPIKDKYEMGPYDFENYTHFQNKLQN 359

>CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa]
           {ON} similar to uniprot|P38080 Saccharomyces cerevisiae
           YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 1027

 Score =  314 bits (804), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 156/318 (49%), Positives = 208/318 (65%), Gaps = 9/318 (2%)

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGT------- 53
           +N P   KY  G+++ +G H+V I  YLA GGFAQ+Y V+ ++  N    LG+       
Sbjct: 12  LNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVG 71

Query: 54  -MACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLME 112
            +ACLKRVIV D+ GLN +R EV+ MK LK +  IV Y DS+A R    +  +EV LLME
Sbjct: 72  DIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLME 131

Query: 113 YCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISEN 172
            C    ++D++N RL  +L E EILKIM DV  G++ MHYL  PLIHRDIKIENVL+  N
Sbjct: 132 LCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDAN 191

Query: 173 GDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIW 232
            ++K+CD GS      P  + Q+ A +  +I ++TT QYR+PEMID Y   PI+EKSDIW
Sbjct: 192 NNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIW 251

Query: 233 ALGVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNIC 292
           ALG+FLYKL +YTTPFE  G+ AIL+ K+ FP   +YS  I N+I IML ++P  RPNI 
Sbjct: 252 ALGIFLYKLLFYTTPFEITGQMAILHSKYDFPPN-KYSSKIINLIIIMLAENPNLRPNIF 310

Query: 293 QVLEQVSKLQGVPCPIEN 310
           QV+  +  +  +P PIE+
Sbjct: 311 QVVYHICSIMNLPVPIED 328

>KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} similar
           to uniprot|P38080 Saccharomyces cerevisiae YBR059C AKL1
           Ser-Thr protein kinase
          Length = 901

 Score =  308 bits (789), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 155/314 (49%), Positives = 207/314 (65%), Gaps = 8/314 (2%)

Query: 4   PEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNE-------LGTMAC 56
           P + + + G  + +G H+V I KYLA GGFA +Y V+ ++ +N   +       +G  AC
Sbjct: 24  PVLERLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVKFVEYANELEQAPSITLKVGETAC 83

Query: 57  LKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSR 116
           LKRV+V D++GLN +R EV  MK L G   IV Y DSHA RS      +EV LLME C  
Sbjct: 84  LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRSRDGVPGFEVMLLMELCPN 143

Query: 117 GGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYK 176
             ++D++N RL  +L E EILKIM DV + +A MHYL  PLIHRD+KIENVL+  + ++K
Sbjct: 144 NSLLDYMNQRLTTKLSEQEILKIMFDVTRALAQMHYLPIPLIHRDVKIENVLVDGDNNFK 203

Query: 177 ICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGV 236
           +CDFGS  + L    T QE A + ++I I+TT QYRSPEMID Y   PIDEKSDIWALG+
Sbjct: 204 LCDFGSTSTCLPVANTHQEIAVLTNNIYIHTTPQYRSPEMIDLYRCLPIDEKSDIWALGI 263

Query: 237 FLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLE 296
           FLYKL +YTTPFE  G+ AIL+ K++FP    YS  + N+I IML ++P  RPNI Q+++
Sbjct: 264 FLYKLLFYTTPFELTGQFAILHSKYEFP-INNYSSKLINLIIIMLAENPNLRPNIYQIMD 322

Query: 297 QVSKLQGVPCPIEN 310
            +  +  V  PIE+
Sbjct: 323 NLCSIMKVENPIED 336

>Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059C
           (AKL1) - Serine-threonine protein kinase [contig 32]
           FULL
          Length = 935

 Score =  309 bits (791), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 155/314 (49%), Positives = 208/314 (66%), Gaps = 8/314 (2%)

Query: 4   PEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNA-------RNELGTMAC 56
           P + + + G  + +G H+V I KYLA GGFA +Y VR I+ +N        + E+G +AC
Sbjct: 66  PVLEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLAC 125

Query: 57  LKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSR 116
           LKRV+V D++GLN +R EV  MK L G   IV Y DSHA R+      +EV LLME C  
Sbjct: 126 LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPN 185

Query: 117 GGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYK 176
             ++D++N RL  +L E EILKIM DV + +A MHYL  PLIHRD+KIENVL+  N ++K
Sbjct: 186 NSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFK 245

Query: 177 ICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGV 236
           +CDFGS  +      T QE A + ++I ++TT QYRSPEMID Y   PI+EKSDIWALG+
Sbjct: 246 LCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGI 305

Query: 237 FLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLE 296
           FLYKL +YTTPFE  G+ AIL+ K++FP    YS  + N+I IML ++P  RPNI QV++
Sbjct: 306 FLYKLLFYTTPFELTGQFAILHSKYEFP-VNNYSSKLINLIIIMLAENPNLRPNIYQVMD 364

Query: 297 QVSKLQGVPCPIEN 310
            +  +  V  P+E+
Sbjct: 365 NLCSILKVKNPLED 378

>Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)
           [2517 nt, 839 aa]
          Length = 838

 Score =  305 bits (782), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 157/333 (47%), Positives = 211/333 (63%), Gaps = 19/333 (5%)

Query: 9   YEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVID-----SSNARNEL--GTMACLKRVI 61
           Y  G ++ +G H+V + KYLA GGFA++Y V+ ++       N +  L  G   CLKRV+
Sbjct: 29  YVPGTIVIVGIHKVEVVKYLAEGGFAKIYVVKFLEYLSTVDPNGKEVLQNGDQLCLKRVL 88

Query: 62  VPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVID 121
           V D +GLN +R EV+ M+ LKG   +V Y DS+A R       YEV LLME CS   ++D
Sbjct: 89  VQDDNGLNEMRNEVEVMRKLKGAPCVVQYYDSNASRRIDGAPGYEVLLLMELCSNNSLLD 148

Query: 122 FLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFG 181
           ++N RL  +L E EILKIM DV   VA MHYL  PLIHRDIKIENVL+    ++K+CDFG
Sbjct: 149 YMNQRLATKLSEDEILKIMFDVTLAVAQMHYLPSPLIHRDIKIENVLVDSKNNFKLCDFG 208

Query: 182 SACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKL 241
           S  + L    + Q+ A +  +I ++TT QYRSPEMID Y   P++EKSDIWALGVFLYKL
Sbjct: 209 STSTCLPIVSSHQDIAILTQNIYVHTTPQYRSPEMIDLYRCLPVNEKSDIWALGVFLYKL 268

Query: 242 CYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSKL 301
            +YTTPFE+ G+ AIL+ K++FP    YS  + N+I +ML ++P  RPNI QVL Q+  +
Sbjct: 269 MFYTTPFERTGQFAILHSKYEFP-LNNYSSKLINLIIVMLAENPNLRPNIYQVLNQICYI 327

Query: 302 QGVPCPI-----------ENFMLTRIKLQNSRN 323
            G+  P+           E +   + KLQN +N
Sbjct: 328 SGIKNPMDDAYGLGAYSFEKYTEYQSKLQNYQN 360

>SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 858

 Score =  306 bits (783), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 155/313 (49%), Positives = 205/313 (65%), Gaps = 7/313 (2%)

Query: 4   PEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARN------ELGTMACL 57
           P + K   G ++ +G+H+V I KYLA GGFA +Y V+ ++ SN         + G +ACL
Sbjct: 27  PTLEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACL 86

Query: 58  KRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRG 117
           KRV+V D++GLN LR EV+ MK LK +  IV Y DS+A R       YEV LLME C   
Sbjct: 87  KRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNK 146

Query: 118 GVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKI 177
            ++D++N RL  +L E E+LKIM DV + VA MH+L  PLIHRDIKIENVL+    ++K+
Sbjct: 147 SLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKL 206

Query: 178 CDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVF 237
           CDFGS  S      T Q+ A + ++I ++TT QYR+PEMID Y   PIDEKSDIWALG+F
Sbjct: 207 CDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIF 266

Query: 238 LYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQ 297
           LYKL +YTTPFE  G+ AIL+ K+  P+   YS  + N+I IML ++P  RPNI QV+ Q
Sbjct: 267 LYKLLFYTTPFELTGQFAILHSKYDIPAN-NYSSKLINLIIIMLAENPNLRPNIYQVIYQ 325

Query: 298 VSKLQGVPCPIEN 310
           V  +  V  P E+
Sbjct: 326 VCAIMKVDVPFED 338

>ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 1115

 Score =  310 bits (794), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 152/317 (47%), Positives = 208/317 (65%), Gaps = 8/317 (2%)

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVI-------DSSNARNELGT 53
           + +P +  Y  G V+ +G  QV I  ++A GGFAQ+YSV+ I       + S A  + G 
Sbjct: 14  VTKPVVDGYAPGTVVAVGNQQVEIISFIAEGGFAQIYSVKYIKFLGEFNNGSKAPLQPGD 73

Query: 54  MACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEY 113
           +ACLKRV+VPD++GL+ +R EV+ MK L+G K I+ Y DS+A R    Q  YEV LLME 
Sbjct: 74  IACLKRVLVPDENGLSEMRNEVEVMKQLRGAKAIIQYYDSNASRRTSGQVGYEVLLLMEL 133

Query: 114 CSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENG 173
           C    ++D++N RL  RL E EILK+M D    ++ MHYL  PLIHRDIKIENVL+    
Sbjct: 134 CPNNSLLDYMNQRLATRLTEKEILKVMYDTTLAISQMHYLPIPLIHRDIKIENVLVDAQN 193

Query: 174 DYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWA 233
           ++K+CDFGS  +      T Q+ A +  +I +NTT QYRSPEMID Y   PI+EKSDIWA
Sbjct: 194 NFKLCDFGSTSTCFPLVTTHQDIAILTQNIYVNTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 234 LGVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQ 293
           LG+FLYKL ++ TPFE  G+ +IL+ K++FP+  +YS  + N+I IML ++P  RPNI Q
Sbjct: 254 LGIFLYKLLFFITPFEMTGQFSILHSKYEFPAN-KYSSKLINLIIIMLAENPYVRPNIYQ 312

Query: 294 VLEQVSKLQGVPCPIEN 310
           V+  +  + G   PIE+
Sbjct: 313 VMHHICSVIGCEVPIED 329

>NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]
           {ON} Anc_3.273
          Length = 1095

 Score =  309 bits (792), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 153/316 (48%), Positives = 207/316 (65%), Gaps = 9/316 (2%)

Query: 3   QPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNA--------RNELGTM 54
           +P   +Y  G  + +G H+V I KY+A GGFAQ+Y+V+ I+  N         + ++G +
Sbjct: 16  KPNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDV 75

Query: 55  ACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYC 114
           ACLKRV+V D++GLN +R EV+ MK L+G   IV Y DS+A R       +EV LLME C
Sbjct: 76  ACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELC 135

Query: 115 SRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGD 174
               ++D++N RL  +L E EILKIM DV   V+ MHYL  PL+HRDIKIENVL+    +
Sbjct: 136 PNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNN 195

Query: 175 YKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWAL 234
           +K+CDFGS  +      T Q+ A +  +I ++TT QYRSPEMID Y   PIDEKSDIWAL
Sbjct: 196 FKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWAL 255

Query: 235 GVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQV 294
           G+FLYKL ++TTPFE  G+ AIL+ K++FP    YS  + N+I IML ++P  RPNI QV
Sbjct: 256 GIFLYKLLFFTTPFELTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPNLRPNIYQV 314

Query: 295 LEQVSKLQGVPCPIEN 310
           L  +  + G+  PIE+
Sbjct: 315 LHNICSISGMKVPIED 330

>Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON}
           (72364..75669) [3306 nt, 1102 aa]
          Length = 1101

 Score =  309 bits (792), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 152/311 (48%), Positives = 198/311 (63%), Gaps = 9/311 (2%)

Query: 6   IPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARN--------ELGTMACL 57
           + K+  G  + +G  +V I KYL  GGFAQ+Y V+ +++SN  +        ++G +ACL
Sbjct: 22  VEKFANGSTVVVGNKKVEIVKYLTEGGFAQIYIVKFLENSNEFDSNNSNIPLKIGDLACL 81

Query: 58  KRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRG 117
           KRV+V D++GLN +R EV+ MKLLKG   IV Y DS+A R +     +EV LLME C   
Sbjct: 82  KRVLVQDENGLNEMRNEVEVMKLLKGAPNIVQYFDSNASRRKDGTNGFEVLLLMELCPNK 141

Query: 118 GVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKI 177
            ++DF+N RL  +L E EIL IM DV   VA MH L PPLIHRDIKIENVL+     +K+
Sbjct: 142 SLLDFMNQRLTTKLSEKEILTIMHDVTLAVAQMHTLSPPLIHRDIKIENVLVDSQNGFKL 201

Query: 178 CDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVF 237
            DFGS           Q+ A +  DI ++TT QYRSPEMID Y   PIDEKSDIWALG+F
Sbjct: 202 ADFGSTSKCFPAVSAHQDIAILSQDIFMHTTPQYRSPEMIDLYKCLPIDEKSDIWALGIF 261

Query: 238 LYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQ 297
           LYKL +Y TPFE  G+ AIL+ K+ FP    YS  + N+I IML+++P  RPNI QVL +
Sbjct: 262 LYKLLFYITPFEMTGQFAILHSKYDFPQT-NYSSRLINLIIIMLSENPNLRPNIYQVLHE 320

Query: 298 VSKLQGVPCPI 308
           +  + G    I
Sbjct: 321 ICSISGTRLEI 331

>Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {ON}
           YBR059C (REAL)
          Length = 1108

 Score =  308 bits (788), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 149/317 (47%), Positives = 209/317 (65%), Gaps = 8/317 (2%)

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARN-------ELGT 53
           M  P + ++  G ++ +GTH+V +  YLA GGFAQ+Y V+ ++  N  +       ++G 
Sbjct: 14  MGHPAVERFTPGHIVCVGTHKVEVINYLAEGGFAQIYMVKFVEYLNEFDNAASVPLKIGD 73

Query: 54  MACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEY 113
           +ACLKRV+V D++GLN +R EV+ MK LKG   +V Y DS+A R       +EV LLME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 114 CSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENG 173
           C    ++D++N RL  +L E EI+KIM DV   ++ MHYL  PLIHRDIKIENVL+  N 
Sbjct: 134 CPNKSLLDYMNQRLSTKLTESEIVKIMYDVVLSISQMHYLPVPLIHRDIKIENVLVDANN 193

Query: 174 DYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWA 233
           ++K+ DFGS  +      T Q+ A +  +I ++TT QYRSPEMID Y   PI+EKSDIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 234 LGVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQ 293
           LG+FLYKL ++TTPFE  G+ AIL+ K++FP   +YS  + N+I IML ++P  RPNI Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 294 VLEQVSKLQGVPCPIEN 310
           VL  + ++  +  PIE+
Sbjct: 313 VLYHLCEILNIEVPIED 329

>KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa]
           {ON} Anc_3.273 YBR059C
          Length = 1091

 Score =  307 bits (787), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 156/340 (45%), Positives = 216/340 (63%), Gaps = 29/340 (8%)

Query: 6   IPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRV---------IDSSNARNE----LG 52
           I K+  G  + +G+H V I KYL  GGFAQ+Y V++         ID  N R +    +G
Sbjct: 26  IEKFSAGESVAVGSHGVEIVKYLTEGGFAQIYLVKLTEYLNEFDAIDIQNQRQQQELKIG 85

Query: 53  TMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLME 112
            + CLKRV+V D++GL+ ++ EV+ MK L+G   +V Y DS+A R+    G +EVFLLME
Sbjct: 86  DLVCLKRVMVYDEAGLSEMKNEVNVMKQLRGKPNVVQYYDSNATRNRGANGGFEVFLLME 145

Query: 113 YCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISEN 172
           YC    ++D++N RL  +L E EIL IM D+  GV+ +H+L  PLIHRDIKIENVL+  N
Sbjct: 146 YCPNKSLLDYMNQRLTTKLTESEILNIMYDITLGVSQLHFLDNPLIHRDIKIENVLVDHN 205

Query: 173 GDYKICDFGSACSVLRPP--KTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSD 230
             +K+CDFGS    + PP   T Q+ + + HDI ++TT QYRSPEMID +   P++EK+D
Sbjct: 206 NRFKLCDFGSTN--ICPPIATTNQDISVLTHDIYVHTTPQYRSPEMIDLFRCLPVNEKAD 263

Query: 231 IWALGVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPN 290
           IWALGVFLYKL +YTTPFE  G+ AIL+ K++ P    YS+ + N+I +ML ++P  RPN
Sbjct: 264 IWALGVFLYKLLFYTTPFELTGQFAILHSKYEIPQS-HYSERLLNLIVVMLAENPNLRPN 322

Query: 291 ICQVLEQVSKLQGVPCPI-----------ENFMLTRIKLQ 319
           I QVL ++  +  V  PI            NF L + K+Q
Sbjct: 323 IYQVLSEICSILNVEVPIPDIYGAGVFNFNNFALFQKKVQ 362

>Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {ON}
           YBR059C (REAL)
          Length = 1107

 Score =  307 bits (786), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 150/317 (47%), Positives = 208/317 (65%), Gaps = 8/317 (2%)

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARN-------ELGT 53
           M  P + +Y  G+++ +GTH+V I  YLA GGFAQ+Y+V+ ++  N  +       ++G 
Sbjct: 14  MGHPAVERYTPGKIVCVGTHKVEIVNYLAEGGFAQIYAVKFLEYLNEFDNTASLPLKIGD 73

Query: 54  MACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEY 113
           +ACLKRV+V D++GLN +R EV+ MK LKG   +V Y DS+A R       +EV LLME 
Sbjct: 74  VACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 114 CSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENG 173
           C    ++D++N RL  +L E EI+KIM DV   ++ MHYL  PLIHRDIKIENVL+    
Sbjct: 134 CPNKSLLDYMNQRLSTKLSESEIVKIMYDVALSISEMHYLPVPLIHRDIKIENVLVDAEN 193

Query: 174 DYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWA 233
           ++K+ DFGS  +      T Q+ A +  +I ++TT QYRSPEMID Y   PI+EKSDIWA
Sbjct: 194 NFKLADFGSTSTSFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 234 LGVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQ 293
           LG+FLYKL ++TTPFE  G+ AIL+ K++FP   +YS  + N+I IML ++P  RPNI Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 294 VLEQVSKLQGVPCPIEN 310
           VL  +  +     PIE+
Sbjct: 313 VLYHICDILNAEVPIED 329

>NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON}
           Anc_3.273
          Length = 1157

 Score =  307 bits (786), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 152/326 (46%), Positives = 207/326 (63%), Gaps = 23/326 (7%)

Query: 8   KYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNE----------------- 50
           K+  G  + +G+H+V I KY+A GGFAQ+Y+V+ ++S N   +                 
Sbjct: 23  KFPAGTQVAVGSHKVEIIKYIAEGGFAQIYAVKYVESLNEFEDSNTDENAHLSGDRQAPN 82

Query: 51  -----LGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEY 105
                LG +ACLKRV+V D++GLN +R EV+ MK LKG   +V Y DS+A R       +
Sbjct: 83  PMILKLGDIACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRHNGASGF 142

Query: 106 EVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIE 165
           EV LLME C    ++D++N RL  +L E EILKIM D+   V+ MHYL+ PL+HRDIKIE
Sbjct: 143 EVLLLMELCPNKSLLDYMNQRLTTKLTEHEILKIMYDITFAVSHMHYLKIPLLHRDIKIE 202

Query: 166 NVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPI 225
           NVL+    ++K+CDFGS  + L    T Q+ A +  +I ++TT QYRSPEMID Y   PI
Sbjct: 203 NVLVDAQNNFKLCDFGSTSTRLPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPI 262

Query: 226 DEKSDIWALGVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDP 285
           DEKSDIWALG+FLYKL ++ TPFE  G+ AIL+ K++FP    YS  + N+I IML ++P
Sbjct: 263 DEKSDIWALGIFLYKLLFFITPFEMTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENP 321

Query: 286 IKRPNICQVLEQVSKLQGVPCPIENF 311
             RPNI QVL+ +  +  V  PIE+ 
Sbjct: 322 NLRPNIYQVLDNICSMMNVEVPIEDI 347

>YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON}
           AKL1Ser-Thr protein kinase, member (with Ark1p and
           Prk1p) of the Ark kinase family; involved in endocytosis
           and actin cytoskeleton organization
          Length = 1108

 Score =  306 bits (783), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 151/317 (47%), Positives = 207/317 (65%), Gaps = 8/317 (2%)

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARN-------ELGT 53
           M  P + +Y  G ++ +GTH+V +  YLA GGFAQ+Y V+ ++  N  +       ++G 
Sbjct: 14  MGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGD 73

Query: 54  MACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEY 113
           +ACLKRV+V D++GLN +R EV+ MK LKG   IV Y DS+A R       +EV LLME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 114 CSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENG 173
           C    ++D++N RL  +L E EI+KIM DV   ++ MHYL   LIHRDIKIENVL+    
Sbjct: 134 CPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN 193

Query: 174 DYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWA 233
           ++K+ DFGS  +      T Q+ A +  +I ++TT QYRSPEMID Y   PI+EKSDIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 234 LGVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQ 293
           LGVFLYKL ++TTPFE  G+ AIL+ K++FP   +YS  + N+I IML ++P  RPNI Q
Sbjct: 254 LGVFLYKLLFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 294 VLEQVSKLQGVPCPIEN 310
           VL  + ++  V  PIE+
Sbjct: 313 VLYHLCEILNVEVPIED 329

>Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {ON}
           YBR059C (REAL)
          Length = 1090

 Score =  305 bits (781), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 151/317 (47%), Positives = 206/317 (64%), Gaps = 8/317 (2%)

Query: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARN-------ELGT 53
           M  P + +Y  G ++ +GTH+V I  YLA GGFAQ+Y V+ ++  N  +       ++G 
Sbjct: 14  MGHPAVERYTPGDIVCVGTHKVEIVNYLAEGGFAQIYVVKFLEYLNEFDNAASVPLKIGD 73

Query: 54  MACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEY 113
           +ACLKRV+V D++GLN +R EV+ MK LKG   +V Y DS+A R       +EV LLME 
Sbjct: 74  LACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 114 CSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENG 173
           C    ++D++N RL  +L E EI+KIM DV   ++ MHYL  PLIHRDIKIENVL+    
Sbjct: 134 CPNKSLLDYMNQRLSTKLTETEIVKIMYDVALSISQMHYLPVPLIHRDIKIENVLVDAKD 193

Query: 174 DYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWA 233
            +K+ DFGS  +      T Q+ A +  +I ++TT QYRSPEMID Y   PI+EKSDIWA
Sbjct: 194 SFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 234 LGVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQ 293
           LG+FLYKL ++TTPFE  G+ AIL+ K++FP   +YS  + N+I IML ++P  RPNI Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 294 VLEQVSKLQGVPCPIEN 310
           VL  +  +  V  PIE+
Sbjct: 313 VLCHLCDILNVEVPIED 329

>TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3.273
           YBR059C
          Length = 1049

 Score =  304 bits (778), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 151/314 (48%), Positives = 203/314 (64%), Gaps = 8/314 (2%)

Query: 4   PEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVID-------SSNARNELGTMAC 56
           P + ++  G V+ +GTH+V +  YLA GGFAQ+Y V+ ++        S    ++G +AC
Sbjct: 17  PTMERFLPGAVVAVGTHRVEVVNYLAEGGFAQIYVVKFLEYLNEFENKSKVPMKVGDVAC 76

Query: 57  LKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSR 116
           LKRV+V D++GL+ +R EV+ MK L G + IV Y DS+A R       +EV LLME C  
Sbjct: 77  LKRVLVQDENGLSEMRNEVEVMKQLMGAQNIVQYYDSNACRRHNGNAGFEVLLLMELCPN 136

Query: 117 GGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYK 176
             ++D++N RL  +L E EILKIM DV   V+ MHYL+ PLIHRDIKIENVL+     +K
Sbjct: 137 KSLLDYMNQRLATKLTEKEILKIMYDVSLAVSQMHYLKNPLIHRDIKIENVLVDAQNSFK 196

Query: 177 ICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGV 236
           +CDFGS         T QE A +  +I ++TT QYR PEMID Y   PI+EKSDIWALG+
Sbjct: 197 LCDFGSTSQCFPVVTTHQEIAILTQNIYVHTTPQYRCPEMIDLYRCLPINEKSDIWALGI 256

Query: 237 FLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLE 296
           FLYKL ++ TPFE  G+ AIL+ K++FP    YS  + N+I IML ++P  RPNI QVL 
Sbjct: 257 FLYKLLFFITPFEMTGQFAILHSKYEFPPN-HYSSQLINLIIIMLAENPFVRPNIYQVLN 315

Query: 297 QVSKLQGVPCPIEN 310
            +  + GV  PIE+
Sbjct: 316 HICTMIGVEVPIED 329

>TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3.273
           YBR059C
          Length = 1054

 Score =  303 bits (775), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 157/320 (49%), Positives = 204/320 (63%), Gaps = 33/320 (10%)

Query: 6   IPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSN------------ARN-ELG 52
           I KY++G +L +G  ++ I KYL  GGFAQ+Y+VR I+  N            +RN ++G
Sbjct: 37  IEKYKQGTILTVGIRRIEILKYLTEGGFAQIYTVRFIEYLNEFDNDDAENDNNSRNLKIG 96

Query: 53  TMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGE-------- 104
            +ACLKRV+VPD++GL+ +R EVD MK L     IV Y DS+A  S++K           
Sbjct: 97  DVACLKRVLVPDENGLSEMRNEVDVMKKLVNCPNIVQYYDSNA--SKIKDNSNIDTTNNN 154

Query: 105 ---------YEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQP 155
                    +E+ LLMEYC    ++DF+N RL  +L E EILK M+D+   V  MHYL  
Sbjct: 155 DNNKNTDLGFEILLLMEYCPNKSLLDFMNQRLTTKLTENEILKAMTDITTAVLQMHYLAQ 214

Query: 156 PLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPE 215
           PLIHRDIKIENVL+  N ++K+ DFGS   +  P  T Q+ A ++ DI +NTT QYRSPE
Sbjct: 215 PLIHRDIKIENVLVDSNNNFKLADFGSTTKIQPPITTHQDIAILNKDIYMNTTPQYRSPE 274

Query: 216 MIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRN 275
           MID Y   PIDEKSDIWALGV LYKL +YTTPFE  G+ AIL+ K++FP+   YS    N
Sbjct: 275 MIDLYKCLPIDEKSDIWALGVLLYKLLFYTTPFELTGQFAILHSKYEFPA-NNYSSKFIN 333

Query: 276 IITIMLNKDPIKRPNICQVL 295
           +I IML ++P  RPNI QVL
Sbjct: 334 LIIIMLAENPNLRPNIFQVL 353

>Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {ON}
           similar to Ashbya gossypii AGR027C
          Length = 894

 Score =  300 bits (767), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 149/309 (48%), Positives = 203/309 (65%), Gaps = 7/309 (2%)

Query: 8   KYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARN------ELGTMACLKRVI 61
           K   G +L +G H+V I +YLA GGFA +Y V  I+ +N  +      + G +ACLKRV 
Sbjct: 27  KLTAGSILLVGVHRVEIIEYLAEGGFAHIYKVSFIEYTNELDRHHSVLQRGDIACLKRVQ 86

Query: 62  VPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVID 121
           V D++GLN LR EV+ MK LKG   +V Y DS+A R       +EV LLME CS G ++D
Sbjct: 87  VNDENGLNELRNEVEVMKKLKGCGNVVQYYDSNASRHTDGTPGFEVLLLMELCSNGSLLD 146

Query: 122 FLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFG 181
           ++N RL  +L E E+LKIM D+ +G++ MH+L+ PLIHRDIKIENVL+    ++K+CDFG
Sbjct: 147 YMNQRLATKLSEREVLKIMYDITKGISHMHFLRTPLIHRDIKIENVLVDSANNFKLCDFG 206

Query: 182 SACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKL 241
           S  + L    T QE A + ++I ++TT QYRSPEMID Y    I+EKSDIWALG+FLYKL
Sbjct: 207 STSTCLPAVSTHQEIAMLTNNIYVHTTPQYRSPEMIDLYRCLAINEKSDIWALGIFLYKL 266

Query: 242 CYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSKL 301
            +YTTPFE  G+ AIL+ K+  P    +S  + N+I +ML ++P  RPNI Q+L  +  +
Sbjct: 267 LFYTTPFELTGQFAILHSKYDIPQN-NFSSKLINLIIVMLAENPYIRPNIYQILYHICSI 325

Query: 302 QGVPCPIEN 310
                PIE+
Sbjct: 326 MECDVPIED 334

>TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1061

 Score =  302 bits (774), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 151/313 (48%), Positives = 204/313 (65%), Gaps = 15/313 (4%)

Query: 9   YEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNEL------------GTMAC 56
           Y  G  + +G+H+V + KY+A GGFAQ+Y+V+ I+  N    L            G +AC
Sbjct: 99  YPAGTPVAVGSHKVEVIKYIAEGGFAQIYTVKFIERLNEFASLPGGNQNQKPLQPGDIAC 158

Query: 57  LKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHA-QRSELKQGEYEVFLLMEYCS 115
           LKRV+V D +GLN +R EV+ M+ L+G   +V Y DS+A  RS+   G YEV LLME+C 
Sbjct: 159 LKRVLVNDDNGLNEMRNEVNVMQKLQGAPCVVQYYDSNASHRSDSAPG-YEVLLLMEFCP 217

Query: 116 RGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDY 175
              ++D++N RL  RL E EI+KIM D   G+A +HYL+ PLIHRDIKIENVL+ +  ++
Sbjct: 218 NNSLLDYMNDRLATRLSEKEIMKIMYDTTLGIAQLHYLKTPLIHRDIKIENVLVDQENNF 277

Query: 176 KICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALG 235
           K+CDFGS           ++ A    +I +NTT QYRSPEMID Y   PIDEKSDIWALG
Sbjct: 278 KLCDFGSTSICFPIVTNHRDIAIFTQNIYVNTTPQYRSPEMIDLYRYQPIDEKSDIWALG 337

Query: 236 VFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVL 295
           VFLYKL ++TTPFE+ G+ AIL+ K++FP    YS  + N+I IML ++P  RPNI QVL
Sbjct: 338 VFLYKLLFFTTPFERTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPSVRPNIYQVL 396

Query: 296 EQVSKLQGVPCPI 308
           + +  + G   P+
Sbjct: 397 QYLCSINGWKVPL 409

>TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1361

 Score =  305 bits (782), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 148/314 (47%), Positives = 204/314 (64%), Gaps = 10/314 (3%)

Query: 6   IPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDS----SNARNEL-----GTMAC 56
           I KY+ G+++ +G HQV IE YLA GGFAQ+Y V+ ID      N +++L     G +AC
Sbjct: 32  IEKYKPGKLISVGAHQVKIEDYLAEGGFAQIYKVKFIDYLNEFENKKDQLNSLKSGDIAC 91

Query: 57  LKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSR 116
           LKRV+V D++GLN +R EV+ MKLL+G   IV Y DS+A R       YE+ LLME C  
Sbjct: 92  LKRVLVNDENGLNEMRNEVEVMKLLQGCPNIVQYYDSNALRRNDGLNGYEILLLMELCPN 151

Query: 117 GGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYK 176
             ++D++N RL  +L E EI+KIM D    V+ MHYL  PLIH+DIK+EN+L+  N ++K
Sbjct: 152 NSLLDYMNQRLKTKLNETEIVKIMYDTTLAVSQMHYLDKPLIHKDIKVENILVDSNNNFK 211

Query: 177 ICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGV 236
           +CDFGS         +  + A +  +I ++TT QYRSPEMID Y   PI+E SDIWALGV
Sbjct: 212 LCDFGSTSPCYEIVTSHHDIAVLTQNIYMHTTPQYRSPEMIDLYRCLPINETSDIWALGV 271

Query: 237 FLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLE 296
           FLYKL ++ TPFE+ G+ +IL+ KF  P    Y   + N+I IML+++   RPNI QV+ 
Sbjct: 272 FLYKLLFFITPFERTGQFSILHAKFDIPVN-NYHPKLINLIIIMLSENLNLRPNIYQVMY 330

Query: 297 QVSKLQGVPCPIEN 310
           ++  +   P PIE+
Sbjct: 331 EICSITNTPLPIED 344

>CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 991

 Score =  300 bits (767), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 153/322 (47%), Positives = 212/322 (65%), Gaps = 19/322 (5%)

Query: 3   QPEIP-KYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNA---RNEL------- 51
           QP+I  K+  G+V+ +G+H+V +  YLA GGFAQ+Y V+ ++ +N    +N+        
Sbjct: 89  QPQIEEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLK 148

Query: 52  -GTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQR-----SELKQGEY 105
            G+ ACLKRV+V D+ GLN +R+EV+ MK L+G   IV Y DS+A R       + QG +
Sbjct: 149 PGSPACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQG-F 207

Query: 106 EVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIE 165
           EV LLME C    ++D++N RL  +L E EI KIM D+   VA MHYL  PLIHRDIKIE
Sbjct: 208 EVLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIE 267

Query: 166 NVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPI 225
           NVL+  N ++K+CDFGS  +      + Q+ A +  D+ ++TT QYRSPEMID +   PI
Sbjct: 268 NVLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPI 327

Query: 226 DEKSDIWALGVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDP 285
           +EKSDIWALGVFLYKL ++TTPFE+ G+ A+L+ KF+FP    YS  + N+I +ML ++P
Sbjct: 328 NEKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPPN-SYSSKLINLIIVMLAENP 386

Query: 286 IKRPNICQVLEQVSKLQGVPCP 307
             RPNI QVL  +S++     P
Sbjct: 387 SLRPNIYQVLYYLSEVTNREVP 408

>KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 814

 Score =  293 bits (751), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 145/300 (48%), Positives = 198/300 (66%), Gaps = 9/300 (3%)

Query: 17  IGTHQVIIEKYLACGGFAQVYSVRVIDSSNARN--------ELGTMACLKRVIVPDKSGL 68
           +GTH+  I ++LA GGFA +Y V+ ++ +N  +        + G +ACLKRVIVPD++GL
Sbjct: 37  VGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIVPDENGL 96

Query: 69  NTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLY 128
           N LR EV+ MK L+G+  IV Y DS+A R       +E+ LLME C +  ++D++N +L 
Sbjct: 97  NELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDYMNNKLA 156

Query: 129 HRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLR 188
            +L E EILKIM DV   +A MHYL  PLIHRDIKIENVL+ ++ ++K+CDFGS      
Sbjct: 157 TKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGSTSMCFP 216

Query: 189 PPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPF 248
              T Q+ A + ++I ++TT QYRSPEMID Y   PI+EKSDIWALG+FLYKL +YTTPF
Sbjct: 217 IVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYTTPF 276

Query: 249 EKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSKLQGVPCPI 308
           E  G+ AIL+ K++ P    YS  + N+I IML ++P  RPNI QV+  V  +     P 
Sbjct: 277 ELTGQFAILHSKYEIPQN-GYSSKLINLIIIMLAENPSLRPNIYQVMHHVCSILKCDVPF 335

>TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {ON}
           Anc_3.273 YBR059C
          Length = 788

 Score =  288 bits (738), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 149/313 (47%), Positives = 201/313 (64%), Gaps = 8/313 (2%)

Query: 6   IPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYS------VRVIDSSNARN-ELGTMACLK 58
           I  Y  G ++ +G H+V I KYLA GGFA++Y       ++ ID +  +  + G + CLK
Sbjct: 96  IDTYVPGHIVEVGIHKVEIIKYLAEGGFAKIYVAKFLQYIKQIDINKIQVLQPGDLICLK 155

Query: 59  RVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGG 118
           RV+V D +GLN +R EV  MK L G   IV   DS+A R       YEV LLME CS   
Sbjct: 156 RVLVTDDNGLNEMRNEVSVMKKLIGAPNIVQLYDSNASRRTDGIAGYEVLLLMELCSNKS 215

Query: 119 VIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKIC 178
           ++D++N RL  +L E EILKIM DV   VA MHYL  PLIHRDIKIENVL+    ++K+C
Sbjct: 216 LLDYMNQRLAVKLTEPEILKIMFDVTLAVAQMHYLPIPLIHRDIKIENVLVDSQNNFKLC 275

Query: 179 DFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFL 238
           DFGS  + +    T ++ A +  ++ ++TT QYRSPEMID Y    I+EKSDIWALG+FL
Sbjct: 276 DFGSTSTCMPIATTHRDMAALTQNLYVHTTPQYRSPEMIDVYRCIHINEKSDIWALGIFL 335

Query: 239 YKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 298
           YKL +Y TPFE+ G+ AIL+ K++FP +  YS  + N+I IML ++P  RPNI QVL  +
Sbjct: 336 YKLLFYITPFERTGQFAILHSKYEFPQH-SYSMKLINLIIIMLAENPNLRPNIYQVLAYI 394

Query: 299 SKLQGVPCPIENF 311
            K+  +  PI++ 
Sbjct: 395 CKIINIKTPIDDI 407

>AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR059C
           (AKL1)
          Length = 961

 Score =  284 bits (726), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 141/308 (45%), Positives = 197/308 (63%), Gaps = 7/308 (2%)

Query: 10  EKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARN------ELGTMACLKRVIVP 63
           + G  + +G HQV + +YLA GGFA +Y V  +  +N  +      + G   CLKRV V 
Sbjct: 30  QAGSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVS 89

Query: 64  DKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFL 123
           D++GLN LR EV+ MK L+    IV Y DS+A R    +  YEV LLME C  G ++D++
Sbjct: 90  DENGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYM 149

Query: 124 NTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSA 183
           N RL  +L E E+LKIM D+  G++ MHY + PLIHRDIKIENVL+  + ++K+CDFGS 
Sbjct: 150 NQRLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGST 209

Query: 184 CSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCY 243
              L    + QE A + ++I ++TT QYRSPEMID Y   PI+EKSDIWALG+FLYKL +
Sbjct: 210 SPCLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLF 269

Query: 244 YTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSKLQG 303
           YTTPFE  G+ AIL+ K++ P    +S  + N++ IML ++P  RPN+ QV+  +  +  
Sbjct: 270 YTTPFELTGQFAILHSKYEIPRN-SFSSKLINLVIIMLAENPYLRPNVYQVMYHICSMME 328

Query: 304 VPCPIENF 311
               I++ 
Sbjct: 329 CEVKIDDL 336

>Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C
           (SPS1) - serine/threonine kinase homologous to Ste20p;
           expressed in middle/late meiosis [contig 123] FULL
          Length = 505

 Score =  101 bits (252), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/276 (26%), Positives = 137/276 (49%), Gaps = 33/276 (11%)

Query: 24  IEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPD-KSGLNTLRAEVDAMKLLK 82
           I++ +  G F  VY  R ID      E G M  +K + + + +  ++ L  E+  +  L+
Sbjct: 38  IKECVGKGSFGDVY--RAID-----KETGEMVAVKIINLEETQDDIDVLAQEIYFLSELR 90

Query: 83  GNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSD 142
              ++ +Y  ++ +       +  ++++ME+C  G   D L     HRL E ++  I+ +
Sbjct: 91  A-PFVTTYYKTYVE-------DVSMWIVMEFCGGGSCADLLKHLPEHRLPENKVAYIIRE 142

Query: 143 VCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHD 202
           V  G+  +H  +   IHRD+K  N+L+++ G+ K+ DFG +  ++    T +   F+   
Sbjct: 143 VLYGLEYLHSQRK--IHRDVKAANILLTDEGEVKLGDFGVSGQIM---ATLKRNTFV--- 194

Query: 203 IMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEK-EGENAILNVKF 261
                T  + +PE+I + +GY  DEK+DIW+LG+   +L     P+ K +    ++N+  
Sbjct: 195 ----GTPYWMAPEIIARDNGY--DEKADIWSLGITAMELLTGQPPYAKYDPMKVLMNIPL 248

Query: 262 QFPSYPQ--YSDHIRNIITIMLNKDPIKRPNICQVL 295
           + P   Q  ++   R+ I + L KDP  RP    +L
Sbjct: 249 RKPPRLQGRFTSSARDFIALCLTKDPALRPTASDLL 284

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score =  102 bits (253), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 67/205 (32%), Positives = 108/205 (52%), Gaps = 39/205 (19%)

Query: 104 EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIK 163
           E +V++ +EYC    + ++L   + HR+   E  K+ + +   V   H LQ   +HRD+K
Sbjct: 100 ESKVWMALEYCPGKELYEYL--LMQHRISLEESGKLFAQIVSAVYYAHSLQ--CVHRDLK 155

Query: 164 IENVLISENGDYKICDFG--SACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDK-- 219
           +EN+L+ + G  KI DFG    C+     KT  E         +  T  Y +PE+I++  
Sbjct: 156 LENILLDKKGRAKITDFGFTRECAT----KTMLET--------VCGTTVYMAPELIERKS 203

Query: 220 YSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGEN----AILNVKFQFPSYPQYSDHI-- 273
           Y G+ I    DIW+LGV LY + + T PF++E E      I+N +      P Y+D +  
Sbjct: 204 YDGFKI----DIWSLGVILYTMIHGTMPFDEEDETKTKWKIINEE------PFYNDDVVS 253

Query: 274 ---RNIITIMLNKDPIKRPNICQVL 295
              +++I+ +L KDP +RP + QVL
Sbjct: 254 KDAKDLISQLLCKDPSQRPQLSQVL 278

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score =  100 bits (248), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 80/295 (27%), Positives = 142/295 (48%), Gaps = 33/295 (11%)

Query: 27  YLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKY 86
           +L  GGFA+ + ++  D S       T+A L    +  +     L +E+   K +K ++ 
Sbjct: 87  FLGEGGFARCFQIK--DDSGKIFAAKTVAKLS---IKSEKTRKKLLSEIQIHKSMK-HQN 140

Query: 87  IVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQG 146
           +V +ID         + +  V++L+E C  G ++D L  R    L E E+    + +C  
Sbjct: 141 VVQFIDCF-------EDDTNVYILLEICPNGSLMDLLKKR--KLLTEPEVRFFTTQICGA 191

Query: 147 VAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMIN 206
           +  MH  +  +IHRD+K+ N+    N + KI DFG A  +       +E  +      + 
Sbjct: 192 IKYMHSRR--VIHRDLKLGNIFFDRNYNLKIGDFGLAAVL----ANDRERKY-----TVC 240

Query: 207 TTAQYRSPE-MIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILN----VKF 261
            T  Y +PE ++ K+SG+  +   DIW++GV LY L     PF+ +  N I        F
Sbjct: 241 GTPNYIAPEVLMGKHSGHSYE--VDIWSIGVMLYALLIGKPPFQSKDVNTIYERIKCCDF 298

Query: 262 QFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSKLQGVPCPIENFMLTRI 316
            FP     S+  + +I  +L+ DP++RP+I ++++ V      P  IE+ ++T +
Sbjct: 299 SFPKEKHISNEAKVLIQDLLSLDPLERPSISEIMDYVWFRGIFPPYIESTVMTEV 353

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score = 99.4 bits (246), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 81/295 (27%), Positives = 142/295 (48%), Gaps = 33/295 (11%)

Query: 27  YLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKY 86
           +L  GGFA+ + ++  D S       T+A L    +  +     L +E+   K ++ +  
Sbjct: 106 FLGEGGFARCFQIK--DDSGKIFAAKTVAKLS---IKTEKTRKKLLSEIQIHKSMR-HAN 159

Query: 87  IVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQG 146
           IV +ID         + E  V++L+E C  G +++ L  R    L E E+    + +C G
Sbjct: 160 IVQFIDCF-------EDETNVYILLEICPNGSLMELLKKR--KTLTEPEVRFFTTQICGG 210

Query: 147 VAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMIN 206
           +  MH  +  +IHRD+K+ N+   +N + KI DFG A  +       +E  +      + 
Sbjct: 211 IKYMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFGLAAVL----ANDRERKY-----TVC 259

Query: 207 TTAQYRSPE-MIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILN----VKF 261
            T  Y +PE ++ K+SG+  +   DIW++GV +Y L     PF+ +  N I        F
Sbjct: 260 GTPNYIAPEVLMGKHSGHSYE--VDIWSIGVMIYALLIGKPPFQAKDVNTIYERIKCCDF 317

Query: 262 QFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSKLQGVPCPIENFMLTRI 316
            FP     S   R ++  +L+ DP++RP+I +VL+ V      P  I++ ++T +
Sbjct: 318 VFPKEKYISSEARILVQDLLSLDPLERPSIMEVLDYVWFRGIFPPYIQSDVMTEV 372

>ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 774

 Score = 98.2 bits (243), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 88/330 (26%), Positives = 155/330 (46%), Gaps = 44/330 (13%)

Query: 27  YLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKY 86
           +L  GGFA+ + +R  D S       T+A L    +  +     L +E+   K +K ++ 
Sbjct: 150 FLGEGGFARCFQIR--DDSGKLFAAKTVAKLS---IKTEKTRKKLLSEIQIHKSMK-HQN 203

Query: 87  IVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQG 146
           IV +ID         + +  V++L+E C  G +++ L  R   +L E E+    + +C  
Sbjct: 204 IVQFIDCF-------EDDTNVYILLEICPNGSLMELLKKR--KQLTEPEVRFFTTQICGA 254

Query: 147 VAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMIN 206
           +  MH  +  +IHRD+K+ N+    N + KI DFG A  +       +E  F      + 
Sbjct: 255 IKYMHSRR--VIHRDLKLGNIFFDRNYNLKIGDFGLAAVL----ANDRERKF-----TVC 303

Query: 207 TTAQYRSPE-MIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILN----VKF 261
            T  Y +PE ++ K+SG+  +   D+W++GV +Y L     PF+ +  N I        F
Sbjct: 304 GTPNYIAPEVLMGKHSGHSYE--VDVWSIGVMVYALLVGKPPFQAKDVNTIYERIKCCDF 361

Query: 262 QFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSKLQGVPCPIENFMLT------- 314
            FP     S   + ++  +L+ DP++RP+I ++++ V      P  I++ ++T       
Sbjct: 362 IFPKEKPISHEAKVLVQDLLSLDPLERPSISEIMDYVWFRGIFPPYIQSNVMTEVPYYEN 421

Query: 315 RIKLQ----NSRNNSNKSTSLNDTTNNSFN 340
           RI L+    N +N   KS  L     ++FN
Sbjct: 422 RITLEESFINFKNCVIKSGLLTTDGTDNFN 451

>TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON}
           Anc_6.262 YPL236C
          Length = 372

 Score = 94.7 bits (234), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 85/346 (24%), Positives = 146/346 (42%), Gaps = 63/346 (18%)

Query: 17  IGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGT-----MACLKRVIVP--DKSGLN 69
           I   +  I + L  G  + VY V+ + S  A   +       +  LKR+  P  +   ++
Sbjct: 28  INGRRYTIRRLLGEGTLSFVYLVQRLGSKTATGSISLGNAPELYALKRIRCPFGNIESIS 87

Query: 70  TLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYH 129
               EVD  K  + + YI++ +DS  Q  + K G   + +L+ Y   G + D +N  L  
Sbjct: 88  AAMKEVDNYKRFQ-SPYIITLVDS--QVVQEKDGSKTLCILLPYFPLGSLQDMVNRNLLK 144

Query: 130 R--LQEFEILKIMSDVCQGVAAMH--------------------------YL--QPPL-- 157
              + E E ++IM  + +G+  +H                          +L    PL  
Sbjct: 145 GTFVSEAECIRIMIGIARGLRCLHDPSARETSDAETMRDTVSLSYSDEAAFLLDDTPLEL 204

Query: 158 --------------IHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDI 203
                         +HRDI++ N+L S  G   + D GS C       T  +   +   +
Sbjct: 205 DVLSSHNTVNTRSYVHRDIRLANILFSSEGLPVVSDLGSCCKADITVSTKHQLNELQDWV 264

Query: 204 MINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE-------NAI 256
             N +  Y +PE+++      ID K+DIW++G   Y + +  +PFE+E +        AI
Sbjct: 265 TANCSFPYTAPELLNVKLNSTIDCKADIWSVGCTCYAMLFGMSPFERELQVSGASLTYAI 324

Query: 257 LNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSKLQ 302
              K+ FP   +YS+ +  +I   L  DP  RP+I ++L+ +  LQ
Sbjct: 325 GCGKYTFPKQTRYSESLLAVIKSCLQVDPTARPDINELLDTLQDLQ 370

>KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24
           YDR523C
          Length = 543

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 82/294 (27%), Positives = 140/294 (47%), Gaps = 37/294 (12%)

Query: 24  IEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLR--AEVDAMKLL 81
           I+K +  G F  V+         A N +       ++I  D S   T     E+  M LL
Sbjct: 18  IDKCVGKGNFGDVFK--------AMNNVTKEVVAIKIINLDDSEEETFEIIKEMRLMSLL 69

Query: 82  KGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMS 141
           K + YI  YI +  +       +Y ++++MEYC  G   D + T     L E ++  ++ 
Sbjct: 70  K-SPYIARYITTINE-------DYLMWIVMEYCGGGSARDLIKTCYREGLAENKVAFVVK 121

Query: 142 DVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHH 201
            V  G+  +H      IHRDIK  N+L++++G  K+ DFG +  +     T +   F+  
Sbjct: 122 SVLLGLQYLHAQHK--IHRDIKAANILLTDSGLVKVADFGVSAEMR---STMKAKTFV-- 174

Query: 202 DIMINTTAQYRSPEMI-DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEK-EGENAILNV 259
                 T  + +PE++ ++  GY  +EKSDIW+LG+  Y+L     P  K +    + N+
Sbjct: 175 -----GTPYWMAPEVVMNEGMGY--NEKSDIWSLGITTYELLKGVPPLAKYDAIRVMRNI 227

Query: 260 KFQFPS--YPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSKLQGVPCPIENF 311
             + P   +  Y++ +++ I   L KDP KRP+  ++LE    ++G P  +EN 
Sbjct: 228 PKRKPPKLHGAYTNLVKHFIATCLIKDPEKRPSASELLEHDFMVKG-PGNVENL 280

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score = 95.9 bits (237), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 73/277 (26%), Positives = 136/277 (49%), Gaps = 33/277 (11%)

Query: 27  YLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKY 86
           +L  GGFA+ + ++  D S       T+A   ++ +  +     L +E+   K ++    
Sbjct: 96  FLGEGGFARCFQIK--DESGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMRHFN- 149

Query: 87  IVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQG 146
           +V +ID         + +  V++L+E C  G +++ L  R    + E E+   M+ +C  
Sbjct: 150 VVQFIDCF-------EDDTNVYILLEICPNGSLMELLKKR--RTVTEPEVRYFMTQICGA 200

Query: 147 VAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMIN 206
           +  MH  +  +IHRD+K+ N+   +N + KI DFG A  +       +E  +      + 
Sbjct: 201 IKYMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFGLAAVL----ANDRERKY-----TVC 249

Query: 207 TTAQYRSPE-MIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAIL----NVKF 261
            T  Y +PE ++ K+SG+  +   DIW++GV +Y L     PF+ +  N I     N  F
Sbjct: 250 GTPNYIAPEVLMGKHSGHSYE--VDIWSIGVMIYALLIGKPPFQSKDVNMIYERIKNRDF 307

Query: 262 QFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 298
            FP     S+  + +I  +L+ DP++RP+I ++++ V
Sbjct: 308 AFPKDKYISNEAKTLIHDILSTDPLERPSIEEIIDYV 344

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score = 96.3 bits (238), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 78/296 (26%), Positives = 138/296 (46%), Gaps = 33/296 (11%)

Query: 26  KYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNK 85
           ++L  GGFA+ + ++  D S       T+A   ++ +  +     L +E+   K +K ++
Sbjct: 146 QFLGEGGFARCFQIK--DESGKIFAAKTVA---KISIKTEKTRRKLLSEIQIHKSMK-HQ 199

Query: 86  YIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQ 145
            IV ++D         +    V++L+  C  G +++ L  R    L E E+      +C 
Sbjct: 200 NIVQFVDCF-------EDHINVYILLGMCPNGSLMELLKKR--KILTEPEVRFFTVQICG 250

Query: 146 GVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMI 205
            +  MH  +  +IHRD+K+ N+   EN + KI DFG A  +       +E  +      +
Sbjct: 251 AIKYMHSRR--VIHRDLKLGNIFFDENYNLKIGDFGLAAVL----ANDRERKY-----TV 299

Query: 206 NTTAQYRSPE-MIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAIL----NVK 260
             T  Y +PE ++ K+SG+  +   DIW++GV ++ L     PF+ +  N I     N +
Sbjct: 300 CGTPNYIAPEVLLGKHSGHSYE--VDIWSIGVMIFALLIGKPPFQAKDVNTIYSRIKNSE 357

Query: 261 FQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSKLQGVPCPIENFMLTRI 316
           + FP     S   + +I  +L  DPI RP+I +++E V      P    N + T I
Sbjct: 358 YTFPINKSISQEAKTLIQDILINDPIARPSINEIMEYVWFRGTFPSMTSNTVFTEI 413

>KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON} 
          Length = 668

 Score = 95.5 bits (236), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 65/241 (26%), Positives = 121/241 (50%), Gaps = 40/241 (16%)

Query: 70  TLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYH 129
           T+  E++  KL+ G+K I+S ID         + +  +++++E C  G + D +  R   
Sbjct: 95  TILKEIEIHKLVNGHKNIISMIDHF-------EIDATMYMVLELCGAGSLYDII-CRSKR 146

Query: 130 RLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRP 189
            L+E+E  ++M  +C  V  +H  +  ++H D+K+ N+LI  + + ++CDFG        
Sbjct: 147 SLREWEAKRLMIQLCGAVDWIH--EKNIVHADLKLSNILIDSSNNLQLCDFGH------- 197

Query: 190 PKTPQEAAFIHHDIMINT-----TAQYRSPEMI------DKYSGYPIDEKSDIWALGVFL 238
                  +F+  DI  N+     T  Y SPE+I      DK   Y   ++SDIW++G+ L
Sbjct: 198 -------SFVSTDIDNNSINKFGTPNYLSPEIISNFILSDKKDLY-FPKESDIWSIGIVL 249

Query: 239 YKLCYYTTPFE----KEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQV 294
           Y + +  TPFE    +     I+  K+ F    + S+ ++ +I  +L   P++R  I ++
Sbjct: 250 YAMIFDKTPFEATTLRSTYENIVECKYGFVENKRVSNKVKKLIQNILKIQPLERKTIVEI 309

Query: 295 L 295
           +
Sbjct: 310 V 310

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 95.5 bits (236), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 77/277 (27%), Positives = 130/277 (46%), Gaps = 33/277 (11%)

Query: 27  YLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKY 86
           +L  GGFA+ + ++  D S    E+     + +  +  +     L +E+   K +  +  
Sbjct: 87  FLGEGGFARCFQIK--DDSG---EIFAAKTVAKASIKSEKTRKKLLSEIQIHKSM-AHPN 140

Query: 87  IVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQG 146
           IV ++D     S        V++L+E C  G +++ L  R    L E E+    + +C  
Sbjct: 141 IVQFVDCFEDDSN-------VYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGA 191

Query: 147 VAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMIN 206
           +  MH  +  +IHRD+K+ N+    N + KI DFG A  +         A        I 
Sbjct: 192 IKYMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVL---------ANESERKYTIC 240

Query: 207 TTAQYRSPE-MIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAIL-NVK---F 261
            T  Y +PE ++ K+SG+  +   DIW+LGV LY L     PF+    N I   +K   F
Sbjct: 241 GTPNYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDF 298

Query: 262 QFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 298
            FP     SD  + +I  +L+ DPI+RP++ ++++ V
Sbjct: 299 SFPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 346

 Score = 92.0 bits (227), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 86/332 (25%), Positives = 141/332 (42%), Gaps = 57/332 (17%)

Query: 17  IGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKS--GLNTLRAE 74
           +  H+  I++ L  GGF+ VY V          E G MA LK++  P  S   ++    E
Sbjct: 21  VNGHRYHIKRLLGEGGFSFVYLVE-------SRENGLMA-LKKIRCPFGSIGSISPAMKE 72

Query: 75  VDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQ-- 132
           VD  +  K + YI   IDS  Q  + + G   V++L+ Y S+G + D +N  L    Q  
Sbjct: 73  VDNYQKFK-SPYIAQIIDS--QVVQERDGSKTVYILLPYFSKGSLQDEINRHLLDCTQVP 129

Query: 133 EFEILKIMSDVCQGVAAMHYLQPP-----------------------------------L 157
           E E++++   V +G+  +H   P                                     
Sbjct: 130 ELEVVRLALGVARGLLCIHDAAPADESDVTYSIVSAPYAEDSSLLNDLELDTFGESHQAY 189

Query: 158 IHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI 217
            H DIK  N++IS  G   I D GS         + Q           + T  + +PE++
Sbjct: 190 AHHDIKPSNIMISSEGMPVISDLGSCSRACVEINSRQALLQFQEWRSEHCTLTFMAPEIL 249

Query: 218 DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILNV-------KFQFPSYPQYS 270
           D      I EK D+W+ G  +Y +C+  +PFE+E + +  +V       K+  PS   YS
Sbjct: 250 DVKLNSVITEKCDVWSFGCTIYTMCFGISPFEREEQISGASVTYSLTTGKYSIPSGTNYS 309

Query: 271 DHIRNIITIMLNKDPIKRPNICQVLEQVSKLQ 302
             + +++   LN DP  RP++ +++  +  LQ
Sbjct: 310 SGLIDVVKKCLNVDPDGRPSVDELISLLMDLQ 341

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 94.7 bits (234), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 78/277 (28%), Positives = 130/277 (46%), Gaps = 33/277 (11%)

Query: 27  YLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKY 86
           +L  GGFA+ + ++  D S    E+     + +  +  +     L +E+   K +  +  
Sbjct: 87  FLGEGGFARCFQIK--DDSG---EIFAAKTVAKASIKSEKTRKKLLSEIQIHKSM-SHPN 140

Query: 87  IVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQG 146
           IV +ID     S        V++L+E C  G +++ L  R    L E E+    + +C  
Sbjct: 141 IVQFIDCFEDDSN-------VYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGA 191

Query: 147 VAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMIN 206
           +  MH  +  +IHRD+K+ N+    N + KI DFG A  +         A        I 
Sbjct: 192 IKYMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVL---------ANESERKYTIC 240

Query: 207 TTAQYRSPE-MIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAIL-NVK---F 261
            T  Y +PE ++ K+SG+  +   DIW+LGV LY L     PF+    N I   +K   F
Sbjct: 241 GTPNYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDF 298

Query: 262 QFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 298
            FP     SD  + +I  +L+ DPI+RP++ ++++ V
Sbjct: 299 SFPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score = 94.7 bits (234), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 78/277 (28%), Positives = 130/277 (46%), Gaps = 33/277 (11%)

Query: 27  YLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKY 86
           +L  GGFA+ + ++  D S    E+     + +  +  +     L +E+   K +  +  
Sbjct: 87  FLGEGGFARCFQIK--DDSG---EIFAAKTVAKASIKSEKTRKKLLSEIQIHKSM-SHPN 140

Query: 87  IVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQG 146
           IV +ID     S        V++L+E C  G +++ L  R    L E E+    + +C  
Sbjct: 141 IVQFIDCFEDDSN-------VYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGA 191

Query: 147 VAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMIN 206
           +  MH  +  +IHRD+K+ N+    N + KI DFG A  +         A        I 
Sbjct: 192 IKYMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVL---------ANESERKYTIC 240

Query: 207 TTAQYRSPE-MIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAIL-NVK---F 261
            T  Y +PE ++ K+SG+  +   DIW+LGV LY L     PF+    N I   +K   F
Sbjct: 241 GTPNYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDF 298

Query: 262 QFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 298
            FP     SD  + +I  +L+ DPI+RP++ ++++ V
Sbjct: 299 SFPRDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score = 95.1 bits (235), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 61/200 (30%), Positives = 105/200 (52%), Gaps = 29/200 (14%)

Query: 104 EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIK 163
           E +V++ +EYC    + D L +   HR+   E  ++ + +   V   H +    +HRD+K
Sbjct: 104 ETKVWMALEYCPGKELYDHLLS--LHRISLLECAELFAQISGAVYYAHSMH--CVHRDLK 159

Query: 164 IENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDK--YS 221
           +EN+L+ +NG+ K+ DFG     +   KT  E         +  T  Y +PE+I++  Y 
Sbjct: 160 LENILLDKNGNAKLTDFGFTRECM--TKTTLET--------VCGTTVYMAPELIERRTYD 209

Query: 222 GYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILNVKFQF----PSYPQ--YSDHIRN 275
           G+ I    DIW+LGV LY L   + PF+ + E   +  K++     P+Y      D  ++
Sbjct: 210 GFKI----DIWSLGVILYTLITGSLPFDDDDE---VKTKWKIVNEEPNYDSTLIPDDAKD 262

Query: 276 IITIMLNKDPIKRPNICQVL 295
           +I+ +L K+P +RP++ QVL
Sbjct: 263 LISRLLAKNPKERPSLPQVL 282

>TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_7.86
            YAL017W
          Length = 1262

 Score = 95.1 bits (235), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 70/235 (29%), Positives = 111/235 (47%), Gaps = 31/235 (13%)

Query: 68   LNTLRAEVDAMKLLK--GNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLN- 124
            L T+ +E+  M  L    NK I+S +D        +  +Y  ++      + G ID  + 
Sbjct: 1049 LGTIPSEIQIMSTLNKTSNKNILSILDF------FEDDDY-YYVEQPVHGKTGCIDLFDL 1101

Query: 125  TRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSAC 184
                  + EFE   I   +  G++ +H  +  ++HRDIK ENV++   G  K+ DFGSA 
Sbjct: 1102 IEFKTNMTEFEAKLIFKQIISGISHLH--ESGIVHRDIKDENVIVDAKGFVKLIDFGSAA 1159

Query: 185  SVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYSGYPIDEKSDIWALGVFLYKLC 242
             V   P           D+ + T   Y SPE++  +KY G P     DIWALG+ LY + 
Sbjct: 1160 YVKNGP----------FDVFVGTI-DYASPEVLRGEKYEGKP----QDIWALGILLYTIV 1204

Query: 243  YYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQ 297
            +   PF    E  IL    +FP     S +  ++I ++LN+  ++RP+I  + E 
Sbjct: 1205 FKENPFYNIDE--ILEGDMKFPETENISANCIDLIKLILNRSALERPSITDISEH 1257

>Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {ON}
           YDR466W - Hypothetical ORF [contig 196] FULL
          Length = 621

 Score = 94.4 bits (233), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 86/278 (30%), Positives = 132/278 (47%), Gaps = 40/278 (14%)

Query: 28  LACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLK--GNK 85
           L  G ++ VY  R ++ SN+        C K+ I+ +K  +  +  E D + +L   G+ 
Sbjct: 16  LGQGSYSTVY--RAVERSNSGRNYAIKVCSKKHIIREKK-VKYVTIEKDLLNMLAKGGHL 72

Query: 86  YIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQ 145
            IV    +      L       + ++EY S GG +  L  RL  RL E     I + +  
Sbjct: 73  GIVKLFCTFHDIENL-------YFVLEYVS-GGELLALIQRL-GRLTEDLSRHITAQLVD 123

Query: 146 GVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVL--RPPKTPQEAAFIHHDI 203
            V  MH     +IHRD+K ENVL+S+ G   I DFG+AC+    +   T + A+F+    
Sbjct: 124 TVDYMH--SKGVIHRDLKPENVLLSQEGRVVITDFGAACTAADRKFENTKRTASFVG--- 178

Query: 204 MINTTAQYRSPE-MIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGEN------AI 256
               TA+Y SPE ++    G+     SDIWALG  +Y+L     PF  E E         
Sbjct: 179 ----TAEYVSPELLLHSQCGF----SSDIWALGCIIYQLNQGKPPFRGENELQTFEKIVA 230

Query: 257 LNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQV 294
           L+ K+ F + PQ    + +I+  +L  DP+KRP+  Q+
Sbjct: 231 LDYKWLFSNSPQ----VVSIVQSILVTDPLKRPSAAQL 264

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 94.4 bits (233), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 79/277 (28%), Positives = 130/277 (46%), Gaps = 33/277 (11%)

Query: 27  YLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKY 86
           +L  GGFA+ + ++  D S       T+A   +  +  +     L +E+   K +  +  
Sbjct: 87  FLGEGGFARCFQIK--DDSGDIFAAKTVA---KASIKSEKTRKKLLSEIQIHKSM-AHPN 140

Query: 87  IVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQG 146
           IV +ID     S        V++L+E C  G +++ L  R    L E E+    + +C  
Sbjct: 141 IVQFIDCFEDDSN-------VYILLEICPNGSLMELLKRR--KVLSEPEVRFFTTQICGA 191

Query: 147 VAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMIN 206
           +  MH  +  +IHRD+K+ N+    N + KI DFG A  +         A        I 
Sbjct: 192 IKYMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVL---------ANESERKYTIC 240

Query: 207 TTAQYRSPE-MIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAIL-NVK---F 261
            T  Y +PE ++ K+SG+  +   DIW+LGV LY L     PF+    N I   +K   F
Sbjct: 241 GTPNYIAPEVLMGKHSGHSFE--VDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDF 298

Query: 262 QFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 298
            FP     SD  + +I  +L+ DPI+RP++ ++++ V
Sbjct: 299 SFPKDKPISDEGKILIRDILSLDPIERPSLTEIMDYV 335

>KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 1016

 Score = 94.7 bits (234), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 76/301 (25%), Positives = 137/301 (45%), Gaps = 50/301 (16%)

Query: 35  QVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSH 94
           QVY+++V++  N  +E+                   +R E+  +  LK    I  Y  S+
Sbjct: 40  QVYAIKVLNLDNTEDEV-----------------EDIRKEIQFLSSLKQTPNITHYYGSY 82

Query: 95  AQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQ 154
              ++L       +++MEYC+ G +   L   +   ++E  I  IM ++   + ++H  +
Sbjct: 83  LIDTKL-------WVIMEYCAGGSLRTLLRPGI---IEEKYIGVIMREILVALISIH--R 130

Query: 155 PPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSP 214
             +IHRDIK  N+LI+ NG  K+CDFG A  + +        + +    M   T  + +P
Sbjct: 131 DNVIHRDIKAANILIANNGSVKLCDFGVAAQLSQ--------SMLKRQTMAG-TPYWMAP 181

Query: 215 EMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILNVKFQFPSYP------Q 268
           E+I    G   D K DIW+LG+  Y++     P+      AI  ++    S P      +
Sbjct: 182 EVI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCH--MEAIRAMQMITKSKPPRLEGRE 237

Query: 269 YSDHIRNIITIMLNKDPIKRPNICQVLEQ--VSKLQGVPCPIENFMLTRIKLQNSRNNSN 326
           YS  ++  I + L++DP +RP   ++ +   + + +G    I   ++TR  L   +N   
Sbjct: 238 YSQPLKEFIALCLDEDPKERPYAEELFKSKLIKQEKGTSTVILKELITRYLLFREKNEQY 297

Query: 327 K 327
           K
Sbjct: 298 K 298

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score = 94.0 bits (232), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 75/278 (26%), Positives = 136/278 (48%), Gaps = 33/278 (11%)

Query: 26  KYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNK 85
           ++L  GGFA+ + ++  D S       T+A   ++ +  +     L +E+   K +    
Sbjct: 85  QFLGEGGFARCFQIK--DDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMSHTN 139

Query: 86  YIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQ 145
            IV +ID         +    V++L+E C  G +++ +  R    + E E+   M+ +C 
Sbjct: 140 -IVQFIDCF-------EDNVNVYILLEICPNGSLMELIKKR--KTITEPEVRFFMTQICG 189

Query: 146 GVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMI 205
           G+  MH     +IHRD+K+ N+   E+ + KI DFG A  +       +E  F      I
Sbjct: 190 GIQYMH--SNRVIHRDLKLGNIFFDEHYNLKIGDFGLAAVL----ANDRERKFT-----I 238

Query: 206 NTTAQYRSPE-MIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAIL-NVK--- 260
             T  Y +PE ++ K+SG+  +   DIW++GV LY L     PF+ +  N I   +K   
Sbjct: 239 CGTPNYIAPEVLMGKHSGHSYE--VDIWSIGVMLYALLIGKPPFQAKDVNTIYERIKQRN 296

Query: 261 FQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 298
           F +P   + S   + +I  +L+ +P++RP+I ++++ V
Sbjct: 297 FAYPKDKKISQDAKYLIDDILSLNPMERPSIQEIMDYV 334

>Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON}
           (48405..49868) [1464 nt, 488 aa]
          Length = 487

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 88/330 (26%), Positives = 161/330 (48%), Gaps = 37/330 (11%)

Query: 24  IEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV-IVPDKSGLNTLRAEVDAMKLLK 82
           I++ +  G F  VY  +  D +N     G +  +K V +   +  ++ L  E+  +  L+
Sbjct: 17  IQECVGRGNFGDVY--KAFDKTN-----GAIVAVKVVNLEHTEEDIDLLAQEIFFLAELR 69

Query: 83  GNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSD 142
            + YI +YI +  +       +  ++++MEYC  G   D + T   + L E ++  I  +
Sbjct: 70  -SPYITNYITTMIE-------DVSMWIVMEYCGGGACSDLIKTVYINGLPENKVGFITRE 121

Query: 143 VCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHD 202
           V +G+  +H  +   IHRDIK  N+L+++ G  K+ DFG +  +     T +   F+   
Sbjct: 122 VLKGLKYLHDQKK--IHRDIKAANILLTDEGKVKLGDFGVSGQIR---ATMKRGTFV--- 173

Query: 203 IMINTTAQYRSPEMIDKYS-GYPIDEKSDIWALGVFLYKLCYYTTPFEK-EGENAILNVK 260
                T  + +PE+++K S GY  +EK+DIW+LG+ +Y+L     P  K +    ++++ 
Sbjct: 174 ----GTPYWMAPEVVNKESNGY--NEKADIWSLGITVYELLKGLPPLSKCDPMKVMVSLP 227

Query: 261 FQFPS--YPQYSDHIRNIITIMLNKDPIKRPNICQVL--EQVSKLQGVPCPIENFMLTRI 316
            + P   + QYSD  +  +   L KDP  RP+   +L  E V+  +      +   + R 
Sbjct: 228 RRKPPKLHGQYSDVAKGFVAACLVKDPNLRPSAEMLLTNEFVTNTEINDLKSDIDFVKRR 287

Query: 317 KLQNSRNNSNKSTSLNDTTNNSFNNELALD 346
           K+QN+ + + K   L +   N  NNE+  D
Sbjct: 288 KVQNNYSKAPK-FQLQEKLYNEANNEIPWD 316

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score = 93.2 bits (230), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 80/295 (27%), Positives = 139/295 (47%), Gaps = 33/295 (11%)

Query: 27  YLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKY 86
           +L  GGFA+ +     D S       T+A L    +  +     L +E+   K +K N  
Sbjct: 88  FLGEGGFARCFQFN--DDSGKIFAAKTVAKLS---IKSEKTRRKLLSEIQIHKSMK-NVN 141

Query: 87  IVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQG 146
           IV +ID         + +  V++L+E C  G ++D L  R    L E E+    + +C  
Sbjct: 142 IVQFIDCF-------EDDTNVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGA 192

Query: 147 VAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMIN 206
           +  MH  +  +IHRD+K+ N+   ++ + KI DFG A  +       +E  +      + 
Sbjct: 193 IKYMHSRR--VIHRDLKLGNIFFDKDYNLKIGDFGLAAVL----ANDRERKY-----TVC 241

Query: 207 TTAQYRSPE-MIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILN----VKF 261
            T  Y +PE ++ K++G+  +   DIW++GV LY L     PF+ +  N I        F
Sbjct: 242 GTPNYIAPEVLMGKHTGHSYE--VDIWSIGVMLYALLIGKPPFQSKDVNTIYERIKCCDF 299

Query: 262 QFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSKLQGVPCPIENFMLTRI 316
            FP     S   + +I  +L+ DP++RP++ ++++ V      P  IE+ ++T I
Sbjct: 300 TFPKDKYISPEAKILIQDLLSLDPLERPSVDEIIDYVWFRGLFPPQIESDVMTNI 354

>ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakly
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1262

 Score = 94.0 bits (232), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 62/179 (34%), Positives = 88/179 (49%), Gaps = 20/179 (11%)

Query: 118  GVIDFLN-TRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYK 176
            G ID  +   L   + E+E   I   V   +  +H     ++HRDIK ENV++   G  K
Sbjct: 1094 GCIDLFDLIELKTNMTEYEAKLIFRQVVSAIRHLH--SQGIVHRDIKDENVVVDSKGFVK 1151

Query: 177  ICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEK-SDIWALG 235
            + DFGSA  V   P           D+ + T   Y +PE++   SG P D K  DIWA+G
Sbjct: 1152 LIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVL---SGEPFDGKPQDIWAIG 1197

Query: 236  VFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQV 294
            V LY + +   PF    E  IL V  +F      S+   N+I ++LNK+P +RP I +V
Sbjct: 1198 VLLYTIVFKENPFYNIDE--ILEVNLKFHGTKGVSEECINLIKMILNKNPSQRPTIDEV 1254

>TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {ON}
           Anc_1.24 YDR523C
          Length = 482

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 76/277 (27%), Positives = 134/277 (48%), Gaps = 32/277 (11%)

Query: 24  IEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKG 83
           I+  +  G F  VY  + ID    +NE   +A     +      +  L  E+  +  LK 
Sbjct: 17  IQDCVGRGNFGDVY--KAID----KNESKVVAIKIVNLENTDEDIELLTQEIFFLSELK- 69

Query: 84  NKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDV 143
           + +I +YI +  +       +  ++++MEYC  G   D +       + E ++  I+ D 
Sbjct: 70  SPFITNYITTLTE-------DVTMWIVMEYCGGGSCADLIKMVYSKGIPESKVSYILRDT 122

Query: 144 CQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDI 203
            +G+  +H      IHRDIK  N+L+++ G  K+ DFG +  +     T +   F+    
Sbjct: 123 VKGLKYLH--DQKKIHRDIKAANILLTDCGKVKLGDFGVSGQI---RATMKRGTFVG--- 174

Query: 204 MINTTAQYRSPEMIDKYS-GYPIDEKSDIWALGVFLYKLCYYTTPFEK-EGENAILNVKF 261
               T  + +PE+I+K   GY  +EK+DIW+LG+  Y+L     P  K +    +LN+  
Sbjct: 175 ----TPYWMAPEVINKQCKGY--NEKADIWSLGITAYELLKGVPPLSKYDPFKVMLNIPK 228

Query: 262 QFPS--YPQYSDHIRNIITIMLNKDPIKRPNICQVLE 296
           + P   + QYS+  +  +++ L KDP +RP+I  +LE
Sbjct: 229 RKPPKLHGQYSEKAKYFVSLCLIKDPKQRPSIEALLE 265

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score = 92.8 bits (229), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 73/287 (25%), Positives = 134/287 (46%), Gaps = 38/287 (13%)

Query: 25  EKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGN 84
           E +L  GGFA+ + ++        +E G +   K V         T R  +  +++ K  
Sbjct: 98  EHFLGEGGFARCFQIK--------DESGKIFAAKTVAKISIKSEKTKRKLLSEIQIHKSM 149

Query: 85  KY--IVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSD 142
           K+  IV +ID         + +  V++L+E C  G ++D L  R    L E E+    + 
Sbjct: 150 KHSNIVQFIDCF-------EDDANVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQ 200

Query: 143 VCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHD 202
           +C  +  +H  +  +IHRD+K+ N+   ++ + K+ DFG A  +       +E  +    
Sbjct: 201 ICGAIKYLHSRR--IIHRDLKLGNIFFDKDYNLKVGDFGLAAVL----ANDRERKY---- 250

Query: 203 IMINTTAQYRSPE-MIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILN--- 258
             +  T  Y +PE ++ K+SG+  +   DIW++GV +Y L     PF+ +  N I     
Sbjct: 251 -TVCGTPNYIAPEVLMGKHSGHSFE--VDIWSIGVMIYALLVGKPPFQAKDVNVIYERIK 307

Query: 259 -VKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSKLQGV 304
             K+ +P     S     +I  +L+ +P++RP I  +++ V   +GV
Sbjct: 308 LCKYGYPKDKYVSKEAEILIHDILSLNPLQRPTIIDIIDDVW-FRGV 353

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score = 92.4 bits (228), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 74/277 (26%), Positives = 134/277 (48%), Gaps = 33/277 (11%)

Query: 27  YLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKY 86
           +L  GGFA+ + +R  D S       T+A   ++ +  +     L +E+   K +K +  
Sbjct: 100 FLGEGGFARCFQIR--DDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMK-HVN 153

Query: 87  IVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQG 146
           IV +ID         + +  V++L+E C  G ++D L  R    L E E+    + +C  
Sbjct: 154 IVQFIDCF-------EDDTNVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGA 204

Query: 147 VAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMIN 206
           +  MH     +IHRD+K+ N+      + KI DFG A ++       +E  +      + 
Sbjct: 205 IKYMH--SRKVIHRDLKLGNIFFDRKYNLKIGDFGLAATL----ANDRERKY-----TVC 253

Query: 207 TTAQYRSPE-MIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILN-VK---F 261
            T  Y +PE ++ K+SG+  +   DIW++GV +Y L     PF+ +  N I   +K   F
Sbjct: 254 GTPNYIAPEVLMGKHSGHSYE--VDIWSIGVMIYALIIGRPPFQSKDVNTIYERIKCRDF 311

Query: 262 QFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 298
            FP     S   + +I  +L+ DP++RP++ ++++ +
Sbjct: 312 SFPKDKLISSEAKILIQDILSLDPLERPSVNEIMDYI 348

>Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {ON}
           YHR102W (KIC1) - PAK/Ste20 kinase family [contig 128]
           FULL
          Length = 865

 Score = 92.8 bits (229), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 87/328 (26%), Positives = 151/328 (46%), Gaps = 48/328 (14%)

Query: 9   YEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGL 68
           +++  V+  G   V+ + Y       QV +++V++  +A +E+                 
Sbjct: 19  FKRTEVIGRGKFGVVYKGYYT--KTKQVCAIKVLNLDSADDEV----------------- 59

Query: 69  NTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLY 128
             ++ E+  +  LK    I  Y  S+   ++L       +++MEYC+ G +   L     
Sbjct: 60  EDVQKEIQFLSSLKQVPNITHYYGSYLNDTKL-------WVIMEYCAGGSLRTLLRP--- 109

Query: 129 HRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLR 188
            ++ E  I  IM ++    A MH  +  +IHRDIK  NVLI+ +G  K+CDFG A  +  
Sbjct: 110 GKIGEQYIGVIMRELL--TALMHIHKDGVIHRDIKAANVLITNDGHIKLCDFGVAAQL-- 165

Query: 189 PPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPF 248
                     I    M   T  + +PE+I    G   D K DIW+LG+  Y++     P+
Sbjct: 166 ------SQTKIRRQTMAG-TPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNPPY 216

Query: 249 -EKEGENAI-LNVKFQFPSYP--QYSDHIRNIITIMLNKDPIKRPNICQVLE-QVSKL-Q 302
            E E   A+ L  K + P     Q+S  ++ II + L++DP +RP+   +L+ +  KL +
Sbjct: 217 CEVEALRAMQLITKSKPPRLEGRQHSSALKEIIALCLDEDPKERPSAEDLLKTKFIKLHK 276

Query: 303 GVPCPIENFMLTRIKLQNSRNNSNKSTS 330
            VP  I   +++R  L   + +  +S S
Sbjct: 277 NVPVSILKELISRYLLHRDKRSQRESVS 304

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score = 92.8 bits (229), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 80/298 (26%), Positives = 135/298 (45%), Gaps = 54/298 (18%)

Query: 8   KYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIV---PD 64
           ++    +  +G ++  I+K +  G F +VY             L T    K+ +V    D
Sbjct: 30  QFSSSELTEVGNYK--IQKQIGEGSFGKVY-------------LATHRPTKQKVVLKTGD 74

Query: 65  KSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLN 124
           KS  N +R      ++    ++   YI    +  E+   E +V++ +EYC    + D L 
Sbjct: 75  KSDPNVVR------EVFYHRQFDYPYI---TKLYEVIVTETKVWMALEYCPGKELYDHLL 125

Query: 125 TRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSAC 184
           ++   RL   E  ++ + +   V   H L    +HRD+K+ENVL+ +NG+ K+ DFG   
Sbjct: 126 SK--SRLPTLECAELFAQITGAVHYAHTLN--CVHRDLKLENVLLDKNGNAKLTDFGFT- 180

Query: 185 SVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDK--YSGYPIDEKSDIWALGVFLYKLC 242
                 +     A +     +  T  Y +PEMI    Y G+    K DIW+LGV LY L 
Sbjct: 181 ------RESMTKAVLE---TVCGTTVYMAPEMIQHKPYDGF----KVDIWSLGVILYTLL 227

Query: 243 YYTTPFEKEGENAILNVKFQFPSYPQYSDHI-----RNIITIMLNKDPIKRPNICQVL 295
               PF+++ +  +L  +      P   + I     +N+I  +L+KDP +RPN   +L
Sbjct: 228 CGCLPFDEDDD--LLTKQKIINDTPVIDERITIPEAQNLIEQLLSKDPTERPNTSAIL 283

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score = 91.7 bits (226), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 70/277 (25%), Positives = 136/277 (49%), Gaps = 33/277 (11%)

Query: 27  YLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKY 86
           +L  GGFA+ + ++  D S       T+A   ++ +  +     L +E+   K +K +  
Sbjct: 97  FLGEGGFARCFQIK--DESGKIFAAKTVA---KISIKTEKTKKKLLSEIQIHKSMK-HPN 150

Query: 87  IVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQG 146
           IV ++D         + +  V++L+E CS G ++D +  R    L E E+    + +C  
Sbjct: 151 IVHFVDCF-------EDDTNVYILLEICSNGSLMDLMKKR--KTLTEPEVRFFTTQICGA 201

Query: 147 VAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMIN 206
           V  MH  +  +IHRD+K+ N+   ++ + K+ DFG A  +       +E  +      + 
Sbjct: 202 VKYMHSRR--VIHRDLKLGNIFFDKDYNLKVGDFGLAAVL----ANNRERKY-----TVC 250

Query: 207 TTAQYRSPE-MIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILN----VKF 261
            T  Y +PE ++ K++G+  +   DIW++GV +Y L     PF+ +  N I +     ++
Sbjct: 251 GTPNYIAPEVLMGKHAGHSFE--VDIWSIGVMIYALLVGKPPFQAKDVNVIYDRIKACQY 308

Query: 262 QFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 298
            +P     S   + +I  +L  DP++RP+I ++++ V
Sbjct: 309 GYPKDKYVSSEAKTLIADILCVDPVERPSIREIIDDV 345

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score = 92.0 bits (227), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 105/199 (52%), Gaps = 29/199 (14%)

Query: 107 VFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIEN 166
           V++ +EYC    + ++L  + +  L+E    ++ S +   V   H ++   +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYLLAKKHIPLEECS--ELFSQIVGAVYYAHSMK--CVHRDLKLEN 158

Query: 167 VLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDK--YSGYP 224
           +L+ + G  K+ DFG            +E A       I  T  Y +PE+I++  Y GY 
Sbjct: 159 ILLDKKGHAKLTDFGFT----------RECATKGILETICGTTVYMAPELIERKPYEGYK 208

Query: 225 IDEKSDIWALGVFLYKLCYYTTPFEKEGENAILNVKFQFPSY-PQY-SDHI----RNIIT 278
           I    D W+LG+ LY + + T PF++  E   +  K++   Y P Y +D+I    + +I+
Sbjct: 209 I----DTWSLGIILYTMIHGTMPFDEVDE---VKTKYKIVHYNPTYDNDYIDSNGKELIS 261

Query: 279 IMLNKDPIKRPNICQVLEQ 297
            +L KDP +RP++ QVL+ 
Sbjct: 262 QLLEKDPNQRPSLTQVLQH 280

>KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar to
           uniprot|P08458 Saccharomyces cerevisiae YDR523C SPS1
           dispensable for mitosis involved in middle/late stage of
           meiosis required for spore wall formation
           serine/threonine kinase homologous to Ste20p expressed
           in middle/late meiosis
          Length = 512

 Score = 90.9 bits (224), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 59/193 (30%), Positives = 103/193 (53%), Gaps = 18/193 (9%)

Query: 107 VFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIEN 166
           ++++ME+C  G   D L     HRL E ++  I+ +V  G+  +H  +   IHRDIK  N
Sbjct: 110 MWIVMEFCGGGSCADLLKHLPEHRLSENKVAYIIREVLFGLDYLHSQKK--IHRDIKAAN 167

Query: 167 VLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKY-SGYPI 225
           +L++++G+ K+ DFG +  ++    T +   F+        T  + +PE+I K  +GY  
Sbjct: 168 ILLTDDGEVKLGDFGVSGQIM---ATLKRTTFV-------GTPYWMAPEIIAKKDNGY-- 215

Query: 226 DEKSDIWALGVFLYKLCYYTTPFEKEGENAIL-NVKFQFPSYPQ--YSDHIRNIITIMLN 282
           +EK+DIW+LG+   +L     P+ K     +L N+  + P   Q  ++   R+ I + L 
Sbjct: 216 NEKADIWSLGITAIELLTGQPPYAKHDPMKVLVNIPLRKPPKLQGRFTGSARDFIALCLI 275

Query: 283 KDPIKRPNICQVL 295
           KDP  RP+  ++L
Sbjct: 276 KDPDLRPSAAELL 288

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score = 92.0 bits (227), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 82/326 (25%), Positives = 146/326 (44%), Gaps = 62/326 (19%)

Query: 2   NQPEIPKYEKGRVLPIGTH-QVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 60
           N+  +  ++ G+ L  G+  +V + K +  G  A   +++++   N R+    +  L   
Sbjct: 54  NRDTVGPWKLGKTLGKGSSGRVRLAKNMQSGKLA---AIKIVPKRNVRHNQKQVTALPYG 110

Query: 61  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 120
           I            E+  MKL+     +  Y        E+ + + E++L++EY   G + 
Sbjct: 111 I----------EREIIIMKLITHPNIMALY--------EVWENKSELYLVLEYVEGGELF 152

Query: 121 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLI-SENGDYKICD 179
           D+L  R   +L E E +     + QGV+  H     + HRD+K EN+L+  +N   KI D
Sbjct: 153 DYLIAR--GKLPEQEAIHYFKQIVQGVSYCHNFN--ICHRDLKPENLLLDKKNKTVKIAD 208

Query: 180 FGSACSVLRPPKTPQEAAFIHHDIMINTTA---QYRSPEMI--DKYSGYPIDEKSDIWAL 234
           FG A             A    + ++ T+     Y SPE++   KY G P    SD+W+ 
Sbjct: 209 FGMA-------------ALETTNRLLETSCGSPHYASPEIVMGQKYHGSP----SDVWSC 251

Query: 235 GVFLYKLCYYTTPFEKEGENAIL----NVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPN 290
           G+ L+ L     PF  +    +L    + ++Q PS    S   +++I+ +L  DP KR  
Sbjct: 252 GIILFALLTGHLPFNDDNVRKLLLKVQHGRYQMPS--NVSKEAKDLISKILVVDPEKRIT 309

Query: 291 ICQVLEQVSKLQ-------GVPCPIE 309
           + ++LE    ++       G+ CP+E
Sbjct: 310 VDKILEHPLLVKYDNPGKGGLACPLE 335

>TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.406
           YHR102W
          Length = 975

 Score = 91.7 bits (226), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 72/268 (26%), Positives = 128/268 (47%), Gaps = 37/268 (13%)

Query: 71  LRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHR 130
           ++ E+  +  LK    I  Y  S+ + + L       +++MEYC+ G V   L      +
Sbjct: 85  IQREIQFLVSLKQVPNITRYYASYLKDTSL-------WIIMEYCAGGSVRTLLRP---GK 134

Query: 131 LQEFEILKIMSDVCQGVAAMHYLQPP-LIHRDIKIENVLISENGDYKICDFGSACSVLRP 189
           + E  I  IM ++   + A+HY+    +IHRDIK  N+LI+  G+ K+CDFG A  + + 
Sbjct: 135 IDEKYIAVIMREL---LVALHYIHKDNVIHRDIKAANLLITNEGNVKLCDFGVAAQLNQN 191

Query: 190 PKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPF- 248
               Q  A          T  + +PE+I    G   D K+DIW++G+  Y++     PF 
Sbjct: 192 TMRRQTMA---------GTPYWMAPEVI--MEGISYDTKADIWSVGITAYEIATGNPPFC 240

Query: 249 EKEGENAILNVKFQFPSYPQYSDH---IRNIITIMLNKDPIKRPNICQVLEQVSKLQG-- 303
           E E   A+  +    P+  +  +H   ++  I + L++DP +RP   ++L + + ++   
Sbjct: 241 EMEALRAMQVISKSKPARLEGKNHDPLLKEFIAMCLDEDPQERPTADKLLHESAFIKHYK 300

Query: 304 ------VPCPIENFMLTRIKLQNSRNNS 325
                 +   I  ++L R K  N+ N+S
Sbjct: 301 NTHTSVLKELISRYLLFRDKYANAYNDS 328

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score = 91.7 bits (226), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 106/202 (52%), Gaps = 29/202 (14%)

Query: 104 EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIK 163
           E +V++ +EYC    + D + +   HR+   E +++ + +  GV   H L    +HRD+K
Sbjct: 101 ETKVWMALEYCPGKELYDRVLS--MHRVPTDECVQLFAQIVGGVHYAHSLN--CVHRDLK 156

Query: 164 IENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDK--YS 221
           +EN+L+ ++GD K+ DFG     +   KT  E         I  T  Y +PE+I++  Y 
Sbjct: 157 LENILLDKSGDAKLTDFGFTRECM--TKTTLET--------ICGTTVYMAPELIERKSYD 206

Query: 222 GYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAI-LNVKFQFPSYPQYSDHI-----RN 275
           G+ I    DIW+LGV LY +   + PF+++ E      +  Q    PQ +++I     ++
Sbjct: 207 GFKI----DIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQ---TPQLNENIVTADAKD 259

Query: 276 IITIMLNKDPIKRPNICQVLEQ 297
           +I  +L K+P  RP + Q+L+ 
Sbjct: 260 LILRLLAKNPNDRPTVEQILKH 281

>Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236C -
           Hypothetical ORF [contig 165] FULL
          Length = 346

 Score = 88.2 bits (217), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 83/330 (25%), Positives = 141/330 (42%), Gaps = 65/330 (19%)

Query: 24  IEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKG 83
           I+K L  GG + VY V         ++ G +  LK+   P      ++ +   AMK +  
Sbjct: 28  IQKLLGEGGLSFVYLVE--------SKEGELFALKKTRCP----FGSIGSISPAMKEVAN 75

Query: 84  NK-----YIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYH--RLQEFEI 136
            +     YI   +DS  Q  + K G   V++L+ Y ++G + D +N  L    ++ E +I
Sbjct: 76  YQRFSSPYIAQIVDS--QVVQEKDGSKTVYVLLPYFAKGSLQDLINRHLLDCTQMSELDI 133

Query: 137 LKIMSDVCQGVAAMHYLQP-----------------------------------PLIHRD 161
           L++   + +G+  +H   P                                      HRD
Sbjct: 134 LRMALGIARGLLCIHEANPNHETDVAYSIVSAPYAEDSSLLNDLELDTFGESQQSYAHRD 193

Query: 162 IKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMI-NTTAQYRSPEMIDKY 220
           +K  N++IS      I D GS CS  R     ++A     +    N T  Y +PE++D  
Sbjct: 194 VKPSNIMISPEDLPVISDLGS-CSRARIDINSRQALLRFQEWSSDNCTLSYAAPEILDVK 252

Query: 221 SGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE-------NAILNVKFQFPSYPQYSDHI 273
               I EK DIW+ G  +Y +C+  +PFE+E +        AI   K+  P    YS  +
Sbjct: 253 LNSVITEKCDIWSFGCTMYSMCFGISPFEREEQISGASVTYAITTGKYTVPRGTSYSSSL 312

Query: 274 RNIITIMLNKDPIKRPNICQVLEQVSKLQG 303
             +I   L+ +P +RP++ +++  + +LQG
Sbjct: 313 IELIGKCLSVNPEQRPSVNELIALLMELQG 342

>SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar to
           uniprot|Q751V1 Ashbya gossypii AFR724C AFR724Cp and some
           similarites with YDR523C uniprot|P08458 Saccharomyces
           cerevisiae YDR523C SPS1 dispensable for mitosis involved
           in middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 564

 Score = 90.5 bits (223), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 106/219 (48%), Gaps = 31/219 (14%)

Query: 86  YIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQ 145
           YI +Y  +  +       +  ++++MEYC  G   D L       L E ++  I  ++ +
Sbjct: 91  YITNYFSTFVE-------DVSMWIVMEYCGGGSCSDLLKCLPRGTLTEEKVAFITREILR 143

Query: 146 GVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMI 205
           G+  +H  +   IHRDIK  N+L++++G  K+ DFG          + Q  A    D  +
Sbjct: 144 GLEYLHSQRK--IHRDIKAANILLTDDGKVKLGDFGV---------SGQMMATRRRDTFV 192

Query: 206 NTTAQYRSPEMIDK-YSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILNVKFQFP 264
            T   + +PE+I +   GY  +EK+DIW+LG+ +++L     P  +     +L      P
Sbjct: 193 GTPF-WMAPEVIARSEQGY--NEKADIWSLGITVFELLKGQPPLSQHDPMKVL---MSIP 246

Query: 265 SY------PQYSDHIRNIITIMLNKDPIKRPNICQVLEQ 297
           S        +YS  IR  +++ LNKDP KRP   ++L+ 
Sbjct: 247 SRRPPKLEDRYSHAIREFVSLCLNKDPAKRPTASELLKH 285

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score = 91.3 bits (225), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 77/287 (26%), Positives = 133/287 (46%), Gaps = 50/287 (17%)

Query: 17  IGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIV---PDKSGLNTLRA 73
           +G ++++  K +  G F +VY             L +     R +V    DKS  N +R 
Sbjct: 34  VGNYKIL--KQIGEGSFGKVY-------------LASHKPTHRKVVLKTSDKSDPNLVR- 77

Query: 74  EVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQE 133
                ++    ++   YI    +  E+   E +V++ +EYC    + + L   + HR+  
Sbjct: 78  -----EVFYHRQFDFPYI---TKLYEVIVTETKVWMALEYCPGRELYEHL--LMLHRIPL 127

Query: 134 FEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTP 193
            E  K+ + +   V   H L    +HRD+K+EN+L+ +NG+ K+ DFG     +   K+ 
Sbjct: 128 DECAKLFAQIVSAVHYAHSLN--CVHRDLKLENILLDKNGNAKLTDFGFTRECV--SKSS 183

Query: 194 QEAAFIHHDIMINTTAQYRSPEMIDK--YSGYPIDEKSDIWALGVFLYKLCYYTTPFEKE 251
            E         I  T  Y +PE+I +  Y G+ I    DIW+LGV LY +   T PF+++
Sbjct: 184 LET--------ICGTTVYMAPELIQRQAYDGFKI----DIWSLGVILYTMINGTMPFDED 231

Query: 252 GENAI-LNVKFQFPSYPQ--YSDHIRNIITIMLNKDPIKRPNICQVL 295
            E      +   FP++     S   +++I  +L K P +RP + Q+L
Sbjct: 232 DETKTKWKIVNDFPNFNDNFVSHEAKDLIKRLLAKCPSERPTMEQIL 278

>NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {ON}
           Anc_8.140
          Length = 915

 Score = 90.9 bits (224), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 76/265 (28%), Positives = 122/265 (46%), Gaps = 46/265 (17%)

Query: 63  PDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDF 122
           P ++  N ++ E+  MK    NK++V  I+     S  K     ++L++EYC +G ++  
Sbjct: 136 PKRNDPNKIKKEIAIMKKC-NNKHVVKLIEILDDLSSRK-----IYLVLEYCEKGPILWC 189

Query: 123 ------LNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYK 176
                 +++R   +L      +I  DV  G+  +H     +IHRDIK  N+L+ +NG  K
Sbjct: 190 PRDQLEIDSRGPPQLSFQRAREIFRDVILGLEYLH--SQGIIHRDIKPANLLMDKNGVVK 247

Query: 177 ICDFGSACSV----------LRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDK---YSGY 223
           I DFG + +           L   KT     F   +I +   A  R    +DK   ++G 
Sbjct: 248 ISDFGVSLAANGNIDTNDDELELTKTVGTPVFYAPEICLGAAAMERFN--LDKDELFNGS 305

Query: 224 PIDEKSDIWALGVFLYKLCYYTTPFEKEGE----NAILNVKFQFPSYPQYSD-------- 271
            I  K DIWALG+ LY L +   PF  E E      I+N K +FP++    D        
Sbjct: 306 CISFKIDIWALGITLYCLLFGMLPFVSEFELKLFEKIVNEKLRFPTFETLQDNHISEISH 365

Query: 272 -----HIRNIITIMLNKDPIKRPNI 291
                H ++++  +L K+P KR +I
Sbjct: 366 IREFVHAKDLLNKLLEKNPAKRISI 390

>TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.668
           YPL150W
          Length = 871

 Score = 90.5 bits (223), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 63/205 (30%), Positives = 103/205 (50%), Gaps = 35/205 (17%)

Query: 104 EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIK 163
           E +V++ +EYC    + D+L   +  R+   E  ++ + +   V   H L    +HRD+K
Sbjct: 100 ETKVWMSLEYCPGKELYDYL--LVMRRIPLDECSRLFAQIVGAVYYAHSLN--CVHRDLK 155

Query: 164 IENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYS 221
           +EN+L+   G+ K+ DFG            +E A  +    I  T  Y +PE++  D Y 
Sbjct: 156 LENILLDMQGNAKLADFGFT----------RECATKNQLETICGTTVYMAPELLRRDTYD 205

Query: 222 GYPIDEKSDIWALGVFLYKLCYYTTPFEKEGEN----AILNVKFQFPSYPQYSDHIRN-- 275
           G+ I    DIW+LGV LY L   + PF++E E      I+N +      P Y++ I N  
Sbjct: 206 GFKI----DIWSLGVILYTLINGSMPFDEEDETRTEWKIINEE------PDYNEKIFNAN 255

Query: 276 ---IITIMLNKDPIKRPNICQVLEQ 297
              +I  +L KDP KRP++ ++L+ 
Sbjct: 256 SIELIKSLLIKDPKKRPSMTEILKH 280

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score = 90.5 bits (223), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 100/197 (50%), Gaps = 23/197 (11%)

Query: 104 EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIK 163
           E +V++++EYC    + D+L ++   R+   E  +I + +   V   H L    +HRD+K
Sbjct: 102 ETKVWMVIEYCPNKELYDYLLSK--KRISLDESARIFAQIVGAVYYAHSLS--CVHRDLK 157

Query: 164 IENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYS 221
           +EN+L+ ++ + K+ DFG      +  +             I  T  Y +PE++  +KY 
Sbjct: 158 LENILLDKDNNAKLTDFGFTRDFSKNTQLE----------TICGTTVYMAPELLRREKYD 207

Query: 222 GYPIDEKSDIWALGVFLYKLCYYTTPF-EKEGENAILNVKFQFPSYPQ--YSDHIRNIIT 278
           GY I    DIWALG+ LY +   T PF E + +   L +    P Y    ++D   +++ 
Sbjct: 208 GYKI----DIWALGILLYTIINGTMPFDEDDPKKTELKIISASPDYDNKYFNDDSIDLVN 263

Query: 279 IMLNKDPIKRPNICQVL 295
            +L+KDP  RP I Q+L
Sbjct: 264 RLLSKDPSMRPTIEQIL 280

>Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 87.8 bits (216), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 82/336 (24%), Positives = 143/336 (42%), Gaps = 61/336 (18%)

Query: 24  IEKYLACGGFAQVYSVRVIDSSNARNELGTMA----CLKRVIVPDKSGLNTLRAEVDAMK 79
           I++ L  GG + VY V+++  S    E G  A     LK++I P+   ++    E++  K
Sbjct: 32  IQRLLGEGGLSFVYLVQLLKGSLIM-ENGVAAPELYALKKIICPNVESISNGMREIENYK 90

Query: 80  LLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHR--LQEFEIL 137
             + + Y++  IDS   +   K G   +++++ + + G + D +N RL     + E E +
Sbjct: 91  RFQ-SPYVIQSIDSQVMQE--KDGSKSIYIILPFYTLGSLQDSINRRLLEGTFISEAECV 147

Query: 138 KIMSDVCQGVAAMH---------------------------YL--QPPL----------- 157
           +IM  V +G+  +H                           +L    PL           
Sbjct: 148 RIMLGVIRGLLCLHDPASRQDNTNSRTTVDTVSMTYSDETAFLLEDTPLEMDMLSSNLGA 207

Query: 158 ----IHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRS 213
                HRDI   N+L S +G   I D GS            +   +   +  N T  Y +
Sbjct: 208 SIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLRELQEWVNDNCTLPYTA 267

Query: 214 PEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE-------NAILNVKFQFPSY 266
           PE++       +D K DIW+LG   Y L +  +PFE+E +        AI   K+ FP  
Sbjct: 268 PELLGLKLNQTLDCKVDIWSLGCTFYTLMFGISPFEREEQIHGASITYAINTGKYSFPRN 327

Query: 267 PQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSKLQ 302
            ++S+ + ++I   +  DP++RP   Q+L  +  L+
Sbjct: 328 SRFSEGLLSVIKKCIQVDPVQRPTTSQLLNILQDLE 363

>CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]
           {ON} similar to uniprot|P38990 Saccharomyces cerevisiae
           YER129w Serine/threonine-protein kinase
          Length = 1162

 Score = 90.9 bits (224), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 86/277 (31%), Positives = 127/277 (45%), Gaps = 59/277 (21%)

Query: 63  PDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI-- 120
           P K+  + ++ E+  MK    +K++V  I+      +LK    +++L++EYCSRG V   
Sbjct: 188 PGKTENDKIKREIAIMKKCH-HKHVVKLIEV---LDDLKS--RKIYLVLEYCSRGEVKWC 241

Query: 121 --DFLNTRLYH-RLQEFEILK-IMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYK 176
             D L T         F+  + I+  V  G+  +HY    +IHRDIK  N+L+SE G  K
Sbjct: 242 PPDCLETEAKGPSPLSFQFTREILRGVVLGLEYLHY--QGIIHRDIKPANLLLSETGIVK 299

Query: 177 ICDFGSACSV--------------LRPPKTPQEAAFIHHDIMINTTA----QYRSPEMID 218
           I DFG + +               L   KT    AF   +I +   A    Q    E+  
Sbjct: 300 ISDFGVSLAASSSNVDGSDETIDELELAKTAGTPAFFAPEICLGEDAFEKYQLDREEL-- 357

Query: 219 KYSGYPIDEKSDIWALGVFLYKLCYYTTP----FEKEGENAILNVKFQFPSYPQYSDHIR 274
            + G  I  K DIWALGV LY L +   P    FE E    I+N   +F   P+YSD ++
Sbjct: 358 -FKGSCISFKIDIWALGVTLYCLVFGMLPFVSSFELELFEKIVNDPVKF---PKYSDMLK 413

Query: 275 N-----------------IITIMLNKDPIKRPNICQV 294
           N                 ++T +L K+PIKR NI ++
Sbjct: 414 NNQVLQMTEEAEYEAAKDLLTRLLEKNPIKRINIEEI 450

>KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 878

 Score = 90.5 bits (223), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 69/230 (30%), Positives = 112/230 (48%), Gaps = 27/230 (11%)

Query: 71  LRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHR 130
           ++ EV  +  LK    I  Y  S+   +EL       +++MEYC+ G +   L      +
Sbjct: 62  VQKEVQFLSSLKQVPNITHYYGSYLNNTEL-------WVIMEYCAGGSLRTLLRP---GK 111

Query: 131 LQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPP 190
           + E  I  IM ++   +A MH  +  +IHRDIK  NVLI+ +G  K+CDFG A  +    
Sbjct: 112 IGEQYIGVIMRELL--IALMHIHKDGVIHRDIKAANVLITNDGHIKLCDFGVAAQL---- 165

Query: 191 KTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPF-E 249
                   I    M   T  + +PE+I    G   D K DIW+LG+  Y++     P+ +
Sbjct: 166 ----SQTKIRRQTMAG-TPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNPPYCD 218

Query: 250 KEGENAI-LNVKFQFPSYP--QYSDHIRNIITIMLNKDPIKRPNICQVLE 296
            E   A+ L  K + P     Q+S  ++  I + L++DP +RP+  ++L+
Sbjct: 219 VEALRAMQLITKSKPPRLEGRQHSSALKEFIALCLDEDPKERPSAEELLK 268

>TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.668
           YPL150W
          Length = 988

 Score = 90.5 bits (223), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 73/229 (31%), Positives = 115/229 (50%), Gaps = 32/229 (13%)

Query: 104 EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIK 163
           E +V++ +EYC    + + L  RL HR+   E  ++ + +   +   H L    +HRD+K
Sbjct: 100 ETKVWMALEYCPGKELYEHL-LRL-HRIPVDECSRLFAQISGAMYYAHSLN--CVHRDLK 155

Query: 164 IENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYS 221
           +EN+L+ + G+ K+ DFG            +E A  +    I  T  Y +PE+I  ++Y 
Sbjct: 156 LENILLDKVGNAKLTDFGFT----------RECASKNILETICGTTVYMAPELIKRERYD 205

Query: 222 GYPIDEKSDIWALGVFLYKLCYYTTPFEKEG----ENAILNVKFQFPSYPQYSDHIRNII 277
           G+ I    D+W+LGV LY L     PF++E     E  I+N    F S     D + +++
Sbjct: 206 GFKI----DVWSLGVILYTLLNGFMPFDEEQQKNTEWKIVNEMPSFDSTLLGPDAV-DLL 260

Query: 278 TIMLNKDPIKRPNICQVLEQVSKLQGVPCPIENFMLTRIK--LQNSRNN 324
           + +L KDPI RP++ +VLE    LQ    P  N ML +    L   RNN
Sbjct: 261 SKLLAKDPIDRPSMKEVLEH-PYLQ----PYGNVMLEQADNILYKQRNN 304

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score = 90.5 bits (223), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 80/307 (26%), Positives = 138/307 (44%), Gaps = 55/307 (17%)

Query: 2   NQPEIPKYEKGRVLPIGTH-QVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 60
           N+  +  ++ G+ L  G+  +V + K +  G  A   +++++   N R+    +  L   
Sbjct: 57  NRDTVGPWKLGKTLGKGSSGRVRLAKNMETGKLA---AIKIVPKRNVRHNNTQLTSLPYG 113

Query: 61  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 120
           I            E+  MKL+     +  Y        E+ + + E++L++EY   G + 
Sbjct: 114 I----------EREIIIMKLISHPNVMALY--------EVWENKPELYLVLEYVEGGELF 155

Query: 121 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLI-SENGDYKICD 179
           D+L +R   +L E E +     + QGV+  H+    + HRD+K EN+L+  +N   KI D
Sbjct: 156 DYLISR--GKLPEQEAVHYFKQIVQGVSYCHHFN--ICHRDLKPENLLLDKKNLSVKIAD 211

Query: 180 FGSACSVLRPPKTPQEAAFIHHDIMINTTA---QYRSPEMI--DKYSGYPIDEKSDIWAL 234
           FG A             A    D ++ T+     Y SPE++   KY G P    SD+W+ 
Sbjct: 212 FGMA-------------ALETTDKLLETSCGSPHYASPEIVMGQKYHGSP----SDVWSC 254

Query: 235 GVFLYKLCYYTTPFEKEGENAIL----NVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPN 290
           G+ L+ L     PF  +    +L    + K+Q P     S+  +++I  +L  DP  R  
Sbjct: 255 GIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQ--NISNEAKDLIAKILIVDPAMRIT 312

Query: 291 ICQVLEQ 297
           I +VLE 
Sbjct: 313 IDEVLEH 319

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score = 90.1 bits (222), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 102/199 (51%), Gaps = 23/199 (11%)

Query: 104 EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIK 163
           E +V++ +EYC    + D L +   HR+   E  ++ + +   V   H +    +HRD+K
Sbjct: 104 ESKVWMALEYCPGKELYDHLLS--LHRISLLECGELFAQISGAVYYAHSMH--CVHRDLK 159

Query: 164 IENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDK--YS 221
           +EN+L+ +NG+ K+ DFG     +   KT  E         +  T  Y +PE+I +  Y 
Sbjct: 160 LENILLDKNGNAKLTDFGFTRECM--TKTTLET--------VCGTTVYMAPELIGRKTYD 209

Query: 222 GYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAI-LNVKFQFPSY-PQY-SDHIRNIIT 278
           G+ I    D W+LGV LY L   + PF+ + E      +  + P Y P+   D  +++I+
Sbjct: 210 GFKI----DTWSLGVILYTLITGSLPFDDDDEAKTKWKIVNEEPKYDPKLIPDDAKDLIS 265

Query: 279 IMLNKDPIKRPNICQVLEQ 297
            +L K+P +RP++ QVL  
Sbjct: 266 RLLAKNPGERPSLPQVLRH 284

>TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {ON}
           Anc_5.406 YHR102W
          Length = 996

 Score = 89.7 bits (221), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 77/291 (26%), Positives = 133/291 (45%), Gaps = 39/291 (13%)

Query: 26  KYLACGGFAQVYSVRVIDSSNARN-ELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGN 84
           K +  G F  VY    I S      ++  + C       D + +  ++ E+  + LL+  
Sbjct: 10  KVIGKGKFGTVYKGHSIKSKKVFAIKVLNLDC-------DINEIQDIQNEIKFLSLLRYA 62

Query: 85  KYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVC 144
             I  Y  S+    +       ++++MEYC+ G V + +      R  E  I  I+ ++ 
Sbjct: 63  PNITYYYHSYLINRK-------IWIIMEYCNGGSVRNLIKI---GRFNEIYISVILRELL 112

Query: 145 QGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSV-LRPPKTPQEAAFIHHDI 203
             +  +H+    +IHRDIK  N+LI++NG  K+CDFG A  +    PK    A       
Sbjct: 113 YALEYIHHDN--IIHRDIKAANILINQNGGIKLCDFGIAAKLEFSKPKRQTMAG------ 164

Query: 204 MINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPF-EKEGENAI-LNVKF 261
               T  + +PE+I + S Y  D K+DIW++G+  Y++     P+ E +   A+ L  K 
Sbjct: 165 ----TPYWMAPEVIIESSLY--DTKADIWSVGITAYEITTGNPPYCEYDATKAMQLITKL 218

Query: 262 QFPSY--PQYSDHIRNIITIMLNKDPIKRPNICQVLEQ--VSKLQGVPCPI 308
           + P      YS  ++  I + L++DP +R    ++LE   + + Q  P  I
Sbjct: 219 KPPRLEGKMYSKSLKEFIALCLDEDPSERLTSTKLLETEFIKEYQETPTKI 269

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score = 89.0 bits (219), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 72/277 (25%), Positives = 133/277 (48%), Gaps = 33/277 (11%)

Query: 27  YLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKY 86
           +L  GGFA+ + ++  D S       T+A   ++ +  +     L +E+   K +K +  
Sbjct: 78  FLGEGGFARCFQMK--DDSGKVFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMK-HPN 131

Query: 87  IVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQG 146
           IV + D         + +  V++L+E C  G ++D L  R   +L E E+    + +   
Sbjct: 132 IVQFTDCF-------EDDTNVYILLEICPNGSLMDLLKQR--KQLTEPEVRFFTTQIVGA 182

Query: 147 VAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMIN 206
           +  MH  +  +IHRD+K+ N+   ++ + KI DFG A  +       +E  +      I 
Sbjct: 183 IKYMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFGLAAVL----ANDRERKYT-----IC 231

Query: 207 TTAQYRSPEMI-DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILN----VKF 261
            T  Y +PE++  K++G+  +   DIW++GV +Y L     PF+ +  N I        F
Sbjct: 232 GTPNYIAPEVLTGKHTGHSFE--VDIWSIGVMIYALLIGKPPFQAKEVNTIYERIKVCDF 289

Query: 262 QFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 298
            FP     S   + +I  +L+ DP++RP++ +++E V
Sbjct: 290 SFPKDKPISSEAKVLIKDILSLDPLERPSLAEIMEYV 326

>Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {ON}
            YJL095W (REAL)
          Length = 1484

 Score = 89.7 bits (221), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 85/316 (26%), Positives = 137/316 (43%), Gaps = 45/316 (14%)

Query: 28   LACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLN--------TLRAEVDAMK 79
            +  G F  VY    + +       G M  +K+V VP  S  N         LR+EV  +K
Sbjct: 1187 IGKGSFGAVYLCLNVTT-------GEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLK 1239

Query: 80   LLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKI 139
             L  +  IV Y+       E K   Y +FL  EY + G V   +  R+Y R  E  I  +
Sbjct: 1240 DL-DHLNIVQYLGF-----ENKNSIYSLFL--EYVAGGSVGSLI--RMYGRFDESLIKHL 1289

Query: 140  MSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFI 199
             + V +G+A +H     ++HRD+K +N+L+ ++G  KI DFG    + R  K      + 
Sbjct: 1290 TTQVLRGLAYLH--SKGILHRDMKADNLLLDQDGICKISDFG----ISRKSKD----IYS 1339

Query: 200  HHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEK-EGENAILN 258
            + D+ +  T  + +PEM+D   GY    K DIW+LG  + ++     P+   E   A+  
Sbjct: 1340 NSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFK 1397

Query: 259  VKFQFPSYPQYSDHI-------RNIITIMLNKDPIKRPNICQVLEQVSKLQGVPCPIENF 311
            +     + P   D +       R+ +      DP KRP   ++L        V    ++ 
Sbjct: 1398 IGKSKSAPPIPEDTLPLITRVGRSFLDACFEIDPEKRPTATKLLSHQFSEVDVTFDFKST 1457

Query: 312  MLTRIKLQNSRNNSNK 327
             L +    N + NS+K
Sbjct: 1458 TLAKFIKSNDKLNSSK 1473

>CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa] {ON}
            similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095w BCK1
          Length = 1447

 Score = 89.7 bits (221), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 85/306 (27%), Positives = 135/306 (44%), Gaps = 50/306 (16%)

Query: 28   LACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPD--------KSGLNTLRAEVDAMK 79
            +  G F  VY    I +       G M  +K+V VP         K  +  L++EV  +K
Sbjct: 1157 IGKGSFGAVYLSLNITT-------GEMMAVKQVEVPKYGTQNELVKDMVEALKSEVATLK 1209

Query: 80   LLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKI 139
             L  +  IV Y+ S     E++   Y +FL  EY + G V   +  RLY R  E  I  +
Sbjct: 1210 DLD-HLNIVQYLGS-----EIRGNIYSLFL--EYVAGGSVGSLI--RLYGRFDEKLIRHL 1259

Query: 140  MSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFI 199
             + V  G+  +H     ++HRD+K +N+L+ E+G  KI DFG +           +  + 
Sbjct: 1260 NTQVLSGLKYLH--SKGILHRDMKADNLLLDEDGICKISDFGIS--------KKSKNIYS 1309

Query: 200  HHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEK-EGENAILN 258
            + D+ +  T  + +PEM+D   GY    K DIW+LG  + ++     P+   E   A+  
Sbjct: 1310 NSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFQ 1367

Query: 259  VKFQFPSYPQYSDHI-------RNIITIMLNKDPIKRPNICQVLEQ-VSKLQGVPCPIEN 310
            +     + P   D I       ++ ++     DP KRP    +LE   SK+     P  N
Sbjct: 1368 IGKSKSAPPIPDDTIQLISSKGKDFLSKCFEIDPEKRPTADDLLEHSFSKVD----PAFN 1423

Query: 311  FMLTRI 316
            F  TR+
Sbjct: 1424 FSRTRL 1429

>KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.24
           YDR523C
          Length = 507

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 64/232 (27%), Positives = 117/232 (50%), Gaps = 23/232 (9%)

Query: 68  LNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRL 127
           ++ L  E+  +  LK + YI++YI +  +       +  ++++M+YC  G   D +    
Sbjct: 56  IDLLAQEIFFLAELKSD-YIINYITTIME-------DVSMWIVMDYCGGGSCSDLIKIVY 107

Query: 128 YHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVL 187
            + + E ++  I+ +V  G+  +H  +   IHRDIK  N+L++++G  K+ DFG +  + 
Sbjct: 108 PNGIVEEKVSFIVKNVLLGLQYLH--EQKKIHRDIKAANILLTDDGQVKLGDFGVSGQI- 164

Query: 188 RPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTP 247
                    A +  D  + T   + +PE+I+K      DEK DIW+LG+  Y+L     P
Sbjct: 165 --------KATLKRDTFVGT-PYWMAPEVINKEINNGYDEKVDIWSLGITTYELLKGVPP 215

Query: 248 FEKEGENAILN--VKFQFPS-YPQYSDHIRNIITIMLNKDPIKRPNICQVLE 296
             K     ++   VK + P  +  Y+D  ++ I+  L KDP  RPN+  +L+
Sbjct: 216 LSKYDPVKVMTSLVKRKPPKLHGPYNDFTKSFISFCLIKDPKLRPNVQNLLK 267

>YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON}
           ENV7Protein proposed to be involved in vacuolar
           functions; mutant shows defect in CPY processing; has
           sequence similarity with the human serine/threonine
           protein kinase STK16
          Length = 364

 Score = 86.7 bits (213), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 81/325 (24%), Positives = 136/325 (41%), Gaps = 65/325 (20%)

Query: 24  IEKYLACGGFAQVYSVR------VIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDA 77
           I++ L  GG + VY V+      +ID+  A  EL     LK++I P    ++    E++ 
Sbjct: 32  IQRLLGEGGMSFVYLVQLSKNSLIIDNGIATPEL---YALKKIICPSVESISNGMREIEN 88

Query: 78  MKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHR--LQEFE 135
            K  + + Y++  IDS   +   K G   +++++ Y S G + D +N RL     + E E
Sbjct: 89  YKRFQ-SPYVIKSIDSQVMQE--KDGSKTIYIVLPYYSLGSLQDSINRRLLEGTFVSEAE 145

Query: 136 ILKIMSDVCQGVAAMH-----------------------------YLQPPL--------- 157
            ++IM  V +G+  +H                                 PL         
Sbjct: 146 CVRIMLGVTRGLLCLHDPASRQDNATSRVNVDAVSMTYSDETAMLLEDTPLEMDMLSSNS 205

Query: 158 ------IHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQY 211
                  HRDI   N+L S +G   I D GS        +   + + +   +  N T  Y
Sbjct: 206 AGSIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIENRHQLSELQEWVNDNCTLPY 265

Query: 212 RSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE-------NAILNVKFQFP 264
             PE+++      +  K DIW+LG   Y L +  +PFE+E +        AI   K+ FP
Sbjct: 266 TPPELLNLKLNQVLSSKVDIWSLGCTFYTLMFGISPFEREEQIHGASLTYAINTGKYSFP 325

Query: 265 SYPQYSDHIRNIITIMLNKDPIKRP 289
              ++S+ + ++I   +  DPI+RP
Sbjct: 326 RNSRFSEGLLSVIKKCIQVDPIQRP 350

>Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 86.3 bits (212), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 78/322 (24%), Positives = 136/322 (42%), Gaps = 59/322 (18%)

Query: 24  IEKYLACGGFAQVYSVRVIDSS-NARNELGT--MACLKRVIVPDKSGLNTLRAEVDAMKL 80
           I++ L  GG + VY V+++  S +  N   T  +  LK++I P    ++    E++  K 
Sbjct: 32  IQRLLGEGGMSFVYLVQLLKGSLSMENSAATAELYALKKIICPSVENISNGMREIENYKR 91

Query: 81  LKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHR--LQEFEILK 138
            + + Y++  IDS   +   K G   +++++ Y S G + D +N RL     + E E ++
Sbjct: 92  FQ-SPYVIQSIDSQVMQE--KDGSKTIYIILPYYSLGSLQDSINRRLLEGTFISEAECVR 148

Query: 139 IMSDVCQGVAAMH-----------------------------YLQPPL------------ 157
           IM  V +G+  +H                                 PL            
Sbjct: 149 IMLGVTRGLLCLHDPASRQDNVTTRTTVDTISMTYSDETAMLLEDTPLEMDMLSSSSAGL 208

Query: 158 ---IHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSP 214
               HRDI   N+L S +G   I D GS            + + +   +  N T  Y +P
Sbjct: 209 IAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLSELQEWVNDNCTLPYTAP 268

Query: 215 EMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE-------NAILNVKFQFPSYP 267
           E+++      +  K DIW++G   Y L +  +PFE+E +        AI   K+ FP   
Sbjct: 269 ELLNLKLNQALSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASLTYAINTGKYSFPRNS 328

Query: 268 QYSDHIRNIITIMLNKDPIKRP 289
           ++S+ + ++I   +  DPI+RP
Sbjct: 329 RFSERLLDVIKRCIQVDPIQRP 350

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 88.6 bits (218), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 72/278 (25%), Positives = 133/278 (47%), Gaps = 41/278 (14%)

Query: 28  LACGGFAQVYSVRVIDSSNARNELG-TMACL---KRVIVPDKSGLNTLRAEVDAMKLLKG 83
           L  GGFA+ + ++        +++G + AC    K+ I  +++    L +E+   + L+ 
Sbjct: 99  LGEGGFARCFHIK--------DDVGISFACKIVSKKSIKTERTKFKLL-SEIQIHQNLRY 149

Query: 84  NKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDV 143
           + +IV ++D         + E  V++L+E C  G ++D L  R    L E E+  + + V
Sbjct: 150 S-HIVKFMDCF-------EDELNVYILLELCPNGSLMDLLKKR--KILTEAEVKFMTTQV 199

Query: 144 CQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDI 203
           C  +  MH     +IHRD+K+ NV   +N + KI DFG A ++    +            
Sbjct: 200 CGAINYMH--SNNIIHRDLKLGNVFFDKNFNIKIGDFGLAATLSNVSEKKYTMC------ 251

Query: 204 MINTTAQYRSPEMI-DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILN---- 258
               T  Y +PE+I  K  G+  +  +DIW+LG+ +Y +     PF+ +    I      
Sbjct: 252 ---GTPNYIAPEVILSKQIGHSFE--ADIWSLGIMIYAMVLGKPPFQAKDVTTIYEKIKL 306

Query: 259 VKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLE 296
            +++FP     ++ ++ +I  +L  DP +RP I  +L+
Sbjct: 307 CQYEFPPDKYITNDVKVLIQDLLVLDPSQRPRIMDILK 344

>KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7.86
            YAL017W
          Length = 1440

 Score = 89.0 bits (219), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 85/177 (48%), Gaps = 22/177 (12%)

Query: 118  GVIDFLN-TRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYK 176
            G ID  +   L + + E E+  I   +  G+  +H     +IHRDIK ENV++   G  K
Sbjct: 1272 GCIDLFDLIELKNNMTEMEVKLIFKQIVSGIKHLH--DQAIIHRDIKDENVIVDATGFVK 1329

Query: 177  ICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYSGYPIDEKSDIWAL 234
            + DFGSA  V   P           D+ + T   Y +PE++  D Y G P     DIWA+
Sbjct: 1330 LIDFGSAAHVKSGP----------FDVFVGTI-DYAAPEVLSGDPYEGKP----QDIWAI 1374

Query: 235  GVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNI 291
            G+ LY + +   PF    E  IL  +  F      S   + +I+++LN++  KRP I
Sbjct: 1375 GILLYTIVFKENPFYNIDE--ILEGELTFSESSDVSAECKALISMILNRNVQKRPTI 1429

>Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C
           (REAL)
          Length = 364

 Score = 85.9 bits (211), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 82/322 (25%), Positives = 141/322 (43%), Gaps = 59/322 (18%)

Query: 24  IEKYLACGGFAQVYSVRVIDSS-NARNELGT--MACLKRVIVPDKSGLNTLRAEVDAMKL 80
           I++ L  GG + VY V+++ +S    N + T  M  LK++I P    ++    E++  K 
Sbjct: 32  IQRLLGEGGMSFVYLVQLLKNSLIMENGIITPEMYALKKIICPSVESISNGMREIENYKR 91

Query: 81  LKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHR--LQEFEILK 138
            + + Y++  IDS  Q ++ K G   +++++ Y S G + D +N RL     + E E ++
Sbjct: 92  FQ-SPYVIQSIDS--QVTQEKNGSKIIYIILPYYSLGSLQDSINRRLLEGTFISEAECVR 148

Query: 139 IMSDVCQGVAAMH-------YLQP----------------------PL------------ 157
           IM  V +G+  +H        + P                      PL            
Sbjct: 149 IMLGVTRGLLCLHDPASRQDNITPRVNVDAVSMTYSDETAMLLEDTPLEMDVLSSGSAGS 208

Query: 158 ---IHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSP 214
               HRDI   N+L S  G   I D GS         +  + + +   +  N T  Y +P
Sbjct: 209 IAYAHRDITPSNILYSSEGLPVIADLGSCSQADIRIGSRNQLSELQEWVNDNCTLPYTAP 268

Query: 215 EMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE-------NAILNVKFQFPSYP 267
           E+++      +  K DIW++G   Y L +  +PFE+E +        AI   K+ FP   
Sbjct: 269 ELLNLKLNQILSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASITYAINTGKYSFPRNS 328

Query: 268 QYSDHIRNIITIMLNKDPIKRP 289
           ++S+ + N+I   +  DPI+RP
Sbjct: 329 RFSEALLNVIKKCIQVDPIQRP 350

>ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1204

 Score = 88.6 bits (218), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 67/215 (31%), Positives = 115/215 (53%), Gaps = 22/215 (10%)

Query: 108 FLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVA-AMHYLQPP-LIHRDIKIE 165
           ++L EY S G ++D++    +  L+E    K      +G+A A+ YL    ++HRD+KIE
Sbjct: 240 YMLFEYVSGGQLLDYIIQ--HGSLREHHARKF----ARGIASALQYLHANNIVHRDLKIE 293

Query: 166 NVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPI 225
           N++IS +G+ KI DFG   S +  P+T Q   F         +  + +PE++ K S Y +
Sbjct: 294 NIMISTSGEIKIIDFG--LSNMFDPRT-QLHTFC-------GSLYFAAPELL-KASPY-V 341

Query: 226 DEKSDIWALGVFLYKLCYYTTPFEKEGENAIL-NVKFQFPSYPQY-SDHIRNIITIMLNK 283
             + D+W+ GV LY L     PF+ E  + +   +K     YPQ+ S  + ++++ ML  
Sbjct: 342 GPEVDVWSFGVVLYVLVCGKVPFDDENSSVLHEKIKQGKVDYPQHLSIEVISLLSKMLVV 401

Query: 284 DPIKRPNICQVLEQVSKLQGVPCPIENFMLTRIKL 318
           DP KR ++ QV+E    ++G   P  +++  RI +
Sbjct: 402 DPRKRASLKQVVEHHWMIRGYDFPAPSYVPNRIPM 436

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score = 88.2 bits (217), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 64/229 (27%), Positives = 111/229 (48%), Gaps = 30/229 (13%)

Query: 104 EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIK 163
           E  V++ +EYC    + D+L   L  R+   E  ++ + +   V   H LQ   +HRD+K
Sbjct: 100 ETRVWMALEYCPGNELYDYL--LLKQRIPLDETRRLFAQIVSAVFYAHSLQ--CVHRDLK 155

Query: 164 IENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDK--YS 221
           +EN+L+ +NG   + DFG          T + A     + +  TT  Y +PE+I +  Y 
Sbjct: 156 LENILLDKNGYAMLTDFGF---------TRECATKTQLETVCGTTV-YMAPELIKREAYD 205

Query: 222 GYPIDEKSDIWALGVFLYKLCYYTTPF-EKEGENAILNVKFQFPS-YPQY-SDHIRNIIT 278
           GY +    D W+LG+ LY + +   PF E +     L +  + P+   +Y S   +++I 
Sbjct: 206 GYKV----DTWSLGIILYTMLHGYMPFDEDDTVRTGLKIMHEEPAVLDEYTSPQAKDLIV 261

Query: 279 IMLNKDPIKRPNICQVLEQ-------VSKLQGVPCPIENFMLTRIKLQN 320
            +L+K+  +RPN+ +VL+           L+ V C I+      +K Q+
Sbjct: 262 RLLDKNAAQRPNLNEVLQHPFLQPYGALLLETVECLIKRQRRASLKFQS 310

>TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1.271
            YJL095W
          Length = 1434

 Score = 88.6 bits (218), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 72/262 (27%), Positives = 126/262 (48%), Gaps = 38/262 (14%)

Query: 52   GTMACLKRVIVPD-----KSGLNTLRAEVDAMKLLKGNKY--IVSYIDSHAQRSELKQGE 104
            G M  +K++ VP      ++ LNT+ A    +  LK   +  IV Y+       E+K   
Sbjct: 1158 GEMMAVKQIEVPSYGSQSETMLNTVEAMKSEVSTLKDLDHLNIVQYLGF-----EMKHNI 1212

Query: 105  YEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKI 164
            Y +FL  EY + G V   +  R+Y R  +  I  + + V +G++ +H     ++HRD+K 
Sbjct: 1213 YSLFL--EYVAGGSVGSLI--RMYGRFDDKLIRHLTNQVLEGLSYLH--SQGILHRDMKA 1266

Query: 165  ENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYP 224
            +N+L+ ++G  KI DFG +           E  + + ++ +  T  + +PEM+D   GY 
Sbjct: 1267 DNLLLDQDGICKISDFGISKK--------SEDIYSNSEMTMRGTVFWMAPEMVDTKQGY- 1317

Query: 225  IDEKSDIWALGVFLYKLCYYTTPFEK-EGENAILNVKFQFPSYPQYSDHIRNIITI---- 279
             + K DIW+LG  + ++     P+   E   A+  +  Q  S P   +  +++I+     
Sbjct: 1318 -NAKVDIWSLGCVVLEMFAGKRPWSNFEVVTAMYKIG-QSKSAPPIPEDTKDLISPTAKN 1375

Query: 280  MLNK----DPIKRPNICQVLEQ 297
             LN+    DP +RP   Q+LE 
Sbjct: 1376 FLNQCFHIDPKERPTAGQLLEH 1397

>Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL095W
            (REAL)
          Length = 1478

 Score = 88.6 bits (218), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 86/316 (27%), Positives = 138/316 (43%), Gaps = 45/316 (14%)

Query: 28   LACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLN--------TLRAEVDAMK 79
            +  G F  VY    + +       G M  +K+V VP  S  N         LR+EV  +K
Sbjct: 1181 IGKGSFGAVYLCLNVTT-------GEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLK 1233

Query: 80   LLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKI 139
             L  +  IV Y+       E K   Y +FL  EY + G V   +  R+Y R  E  I  +
Sbjct: 1234 DL-DHLNIVQYLGF-----ENKDNIYSLFL--EYVAGGSVGSLI--RMYGRFDEPLIKHL 1283

Query: 140  MSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFI 199
             + V +G+A +H     ++HRD+K +N+L+ ++G  KI DFG    + R  K      + 
Sbjct: 1284 TTQVLKGLAYLH--SKGILHRDMKADNLLLDQDGICKISDFG----ISRKSKD----IYS 1333

Query: 200  HHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEK-EGENAILN 258
            + D+ +  T  + +PEM+D   GY    K DIW+LG  + ++     P+   E   A+  
Sbjct: 1334 NSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFK 1391

Query: 259  V---KFQFP----SYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSKLQGVPCPIENF 311
            +   K   P    + P  S   R  +      +P KRP   ++L     +  V    ++ 
Sbjct: 1392 IGKSKSAPPIPEDTLPLISQVGRGFLDACFEINPEKRPTATELLSHRFSVVNVTFDFKST 1451

Query: 312  MLTRIKLQNSRNNSNK 327
             L +    N + NS+K
Sbjct: 1452 ELAKFIKSNDKLNSSK 1467

>YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}
            BCK1Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway, which
            controls cell integrity; upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1478

 Score = 88.2 bits (217), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 79/284 (27%), Positives = 126/284 (44%), Gaps = 45/284 (15%)

Query: 28   LACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLN--------TLRAEVDAMK 79
            +  G F  VY    + +       G M  +K+V VP  S  N         LR+EV  +K
Sbjct: 1181 IGKGSFGAVYLCLNVTT-------GEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLK 1233

Query: 80   LLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKI 139
             L  +  IV Y+       E K   Y +FL  EY + G V   +  R+Y R  E  I  +
Sbjct: 1234 DL-DHLNIVQYLGF-----ENKNNIYSLFL--EYVAGGSVGSLI--RMYGRFDEPLIKHL 1283

Query: 140  MSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFI 199
             + V +G+A +H     ++HRD+K +N+L+ ++G  KI DFG    + R  K      + 
Sbjct: 1284 TTQVLKGLAYLH--SKGILHRDMKADNLLLDQDGICKISDFG----ISRKSKD----IYS 1333

Query: 200  HHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEK-EGENAILN 258
            + D+ +  T  + +PEM+D   GY    K DIW+LG  + ++     P+   E   A+  
Sbjct: 1334 NSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNLEVVAAMFK 1391

Query: 259  VKFQFPSYPQYSDHI-------RNIITIMLNKDPIKRPNICQVL 295
            +     + P   D +       RN +      +P KRP   ++L
Sbjct: 1392 IGKSKSAPPIPEDTLPLISQIGRNFLDACFEINPEKRPTANELL 1435

>Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}
            complement(18696..23039) [4344 nt, 1448 aa]
          Length = 1447

 Score = 88.2 bits (217), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 78/285 (27%), Positives = 127/285 (44%), Gaps = 47/285 (16%)

Query: 28   LACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGL---------NTLRAEVDAM 78
            +  G F  V+    I +       G M  +K+V VP K GL         + LR EV  +
Sbjct: 1146 IGKGSFGAVFLAMNITT-------GEMMAVKQVEVP-KYGLQNETVVNTVDALRLEVSTL 1197

Query: 79   KLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILK 138
            K L  +  IV Y+   A     K G Y +FL  EY + G V   +  R+Y R  +  I  
Sbjct: 1198 KDL-DHLNIVQYLGFEA-----KNGIYSLFL--EYVAGGSVGSLI--RMYGRFDDILIRH 1247

Query: 139  IMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAF 198
            +   V QG++ +H     ++HRD+K +N+L+ ++G  KI DFG +              +
Sbjct: 1248 LTIQVLQGLSYLH--SRGILHRDMKADNLLLDQDGVCKISDFGIS--------RKSNDIY 1297

Query: 199  IHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEK-EGENAIL 257
             + ++ +  T  + +PEM+D   GY    K DIW+LG  + ++     P+   E   A+ 
Sbjct: 1298 SNSEMTMKGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNFEVVAAMF 1355

Query: 258  NV---KFQFP----SYPQYSDHIRNIITIMLNKDPIKRPNICQVL 295
             +   K   P    + P  S++ +  +      DP KRP   ++L
Sbjct: 1356 KIGQAKSAPPIPEDTLPLISENAKEFLDCCFEIDPEKRPTADKLL 1400

>CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON}
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102w NRK1 ser/thr protein kinase
          Length = 1072

 Score = 87.8 bits (216), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 78/328 (23%), Positives = 150/328 (45%), Gaps = 48/328 (14%)

Query: 9   YEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGL 68
           +++  V+  G   ++ + Y       QVY+++V++  ++ +E+                 
Sbjct: 16  FKRTEVIGRGKFGIVYKGYHVK--TKQVYAIKVLNLDSSEDEV----------------- 56

Query: 69  NTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLY 128
             ++ E+  +  LK    I  Y  S+ + + L       +++MEYC+ G +   L     
Sbjct: 57  EDVQREIQFLASLKQIPNITRYYGSYLRGTSL-------WIIMEYCAGGSLRSLLRP--- 106

Query: 129 HRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLR 188
            ++ E  I  IM ++   +  +H  +  +IHRDIK  NVLI+  G  K+CDFG A  + +
Sbjct: 107 GKIDEKYIGVIMRELLVALKVIH--KDNVIHRDIKAANVLITNEGQVKLCDFGVAAQLNQ 164

Query: 189 PPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPF 248
                Q  A          T  + +PE+I    G   D K DIW+LG+  Y++     P+
Sbjct: 165 TSLRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIATGNPPY 213

Query: 249 -EKEGENAI-LNVKFQFPSYPQ--YSDHIRNIITIMLNKDPIKRPNICQVLEQ--VSKLQ 302
            + E   A+ L +K + P   +  Y+  ++  I + L++DP +R +  ++L+   +   +
Sbjct: 214 CDVEALRAMQLIIKSKPPRLEERNYTPQLKEFIALCLDEDPQERLSAEELLKTKFIKTHK 273

Query: 303 GVPCPIENFMLTRIKLQNSRNNSNKSTS 330
             P  I   +++R  L   +N S K ++
Sbjct: 274 ATPTTILKELISRYLLFRDKNKSYKDSA 301

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score = 87.4 bits (215), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 57/202 (28%), Positives = 102/202 (50%), Gaps = 29/202 (14%)

Query: 104 EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIK 163
           E  V++ +EYC    + ++L   +  R+   E   + S +   V   H ++   +HRD+K
Sbjct: 100 ENSVWMALEYCPGKELYEYL--LIKKRIPLDECSHLFSQIVGAVFYAHSMK--CVHRDLK 155

Query: 164 IENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDK--YS 221
           +EN+L+ + G  K+ DFG            +E A       +  T  Y +PE+I++  Y 
Sbjct: 156 LENILLDKKGQAKLTDFGFT----------RECATKGILETVCGTTVYMAPELIERKPYE 205

Query: 222 GYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILNVKFQFP-SYPQYSDHI-----RN 275
           GY I    D W+LG+ LY + +   PF++E +   +  K++   + P Y D+      ++
Sbjct: 206 GYKI----DTWSLGIILYTMIHGAMPFDEEDD---IKTKYRIVNNEPFYDDNFIDANGKD 258

Query: 276 IITIMLNKDPIKRPNICQVLEQ 297
           +I  +L KDP +RP++ QVL+ 
Sbjct: 259 LIMQLLQKDPSQRPSLTQVLQH 280

>TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa]
           {ON} Anc_1.24 YDR523C
          Length = 468

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 70/241 (29%), Positives = 121/241 (50%), Gaps = 28/241 (11%)

Query: 68  LNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRL 127
           +N L  E+  +  LK + YI +YI +  +       +  ++++MEYC  G   D L    
Sbjct: 57  INLLAQEIFFLAELK-SPYITNYITTMTE-------DVSMWIIMEYCGGGSCADLLRNIY 108

Query: 128 YHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVL 187
              L E +   I  +V +G+  +H  +   IHRDIK  N+L+++ G  K+ DFG +  + 
Sbjct: 109 NCGLPESKSAYITREVLKGLEYLH--EQKKIHRDIKAANILLTDEGKVKLGDFGVSGQIR 166

Query: 188 RPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYS-GYPIDEKSDIWALGVFLYKLCYYTT 246
               T +   F+        T  + +PE++ K S GY  DEK+DIW+LG+ +Y+L   + 
Sbjct: 167 ---ATLKRGTFV-------GTPFWMAPEVVSKDSDGY--DEKADIWSLGITVYELLKGSP 214

Query: 247 PFEK-EGENAILNVKFQFPS--YPQYSDHIRNIITIMLNKDPIKRPNICQVL--EQVSKL 301
           P  K +    ++N+  + P   +  YS   ++ +   L K+P  RP+  ++L  E V+ L
Sbjct: 215 PLYKCDPMKVMVNLPKRKPPVLHGHYSSAAKHFVASCLVKNPKNRPSAVELLNSEFVTNL 274

Query: 302 Q 302
           Q
Sbjct: 275 Q 275

>KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly
           similar to uniprot|Q03306 Saccharomyces cerevisiae
           YDR466W
          Length = 653

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 75/285 (26%), Positives = 130/285 (45%), Gaps = 41/285 (14%)

Query: 22  VIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLL 81
           V +EK L  G ++ V+  R ++ +N         C K+ I+ ++  +  +  E D + LL
Sbjct: 11  VFLEK-LGQGSYSTVF--RAVERANGLRNYAIKVCSKKHIIRERK-VKYVTVEKDLLNLL 66

Query: 82  KGNKY--IVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKI 139
            G  +  +V    +      L       + ++E+ S G ++  +  R   RL E    +I
Sbjct: 67  AGGGHPGVVRLFCTFHDTDNL-------YYVLEFVSGGELLGLV--RRMGRLPEEWCRRI 117

Query: 140 MSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTP----QE 195
            S +   V  MH     +IHRD+K ENVL+S+ G   I DFG+AC        P    + 
Sbjct: 118 ASQLVDTVDYMHAKG--VIHRDLKPENVLLSQEGRIVITDFGAACCASEGGSAPGAADRA 175

Query: 196 AAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE-- 253
           A+F+        TA+Y SPE++           SD+WALG  +Y+L     PF  + E  
Sbjct: 176 ASFV-------GTAEYVSPELLLHSQ---CSFGSDVWALGCIIYQLTQGAPPFRGDTELQ 225

Query: 254 ----NAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQV 294
                  L+ ++ + + P     +++I+ +    DP++RP+  Q+
Sbjct: 226 SFEKIVALDYRWVYAAPPLIVALVQSILVL----DPLQRPSAKQL 266

>Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON}
           (25064..28447) [3384 nt, 1128 aa]
          Length = 1127

 Score = 87.8 bits (216), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 106/229 (46%), Gaps = 27/229 (11%)

Query: 64  DKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFL 123
           D   +  ++ E+  +  LK    I  Y  S+ Q + L       +++MEYC+ G +   L
Sbjct: 80  DSDEVEDVQREIQFLASLKQVPNITRYYGSYLQDTNL-------WIIMEYCAGGSLRTLL 132

Query: 124 NTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSA 183
              +   + E  I  IM ++   +  +H  +  +IHRDIK  NVLI+  G  K+CDFG A
Sbjct: 133 RPGM---IDEKYIGVIMRELLTALQCIH--KDNVIHRDIKAANVLITNEGKVKLCDFGVA 187

Query: 184 CSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCY 243
             + +     Q  A          T  + +PE+I    G   D K DIW+LG+  Y++  
Sbjct: 188 AQLNQTSLRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIAT 236

Query: 244 YTTPF-EKEGENAILNVKFQFPSY---PQYSDHIRNIITIMLNKDPIKR 288
              P+ E E   A+  +    P+     QYS  ++  I + L++DP +R
Sbjct: 237 GNPPYCEIEALRAMQLITKSKPARLEGRQYSSGLKEFIALCLDEDPKER 285

>Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL095W
            (REAL)
          Length = 1481

 Score = 87.8 bits (216), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 68/229 (29%), Positives = 107/229 (46%), Gaps = 37/229 (16%)

Query: 28   LACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLN--------TLRAEVDAMK 79
            +  G F  VY    + +       G M  +K+V VP  S  N         LR+EV  +K
Sbjct: 1184 IGKGSFGAVYLCLNVTT-------GEMMAVKQVEVPKYSSQNEAILGTVEALRSEVSTLK 1236

Query: 80   LLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKI 139
             L  +  IV Y+       E K   Y +FL  EY + G V   +  R+Y R  E  I  +
Sbjct: 1237 DL-DHLNIVQYLGF-----ENKNNIYSLFL--EYVAGGSVGSLI--RMYGRFDESLIRHL 1286

Query: 140  MSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFI 199
             + V +G+A +H     ++HRD+K +N+L+ ++G  KI DFG    + R  K      + 
Sbjct: 1287 TTQVLKGLAYLH--SKGILHRDMKADNLLLDQDGICKISDFG----ISRKSKD----IYS 1336

Query: 200  HHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPF 248
            + D+ +  T  + +PEM+D   GY    K DIW+LG  + ++     P+
Sbjct: 1337 NSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPW 1383

>NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24
          Length = 535

 Score = 86.7 bits (213), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 75/284 (26%), Positives = 135/284 (47%), Gaps = 36/284 (12%)

Query: 19  THQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSG-LNTLRAEVDA 77
            H  I+++ +  G F  VY  R ID +  +     +  +K V + + +  L  L  E+  
Sbjct: 19  AHNYIVKECVGRGNFGDVY--RAIDRTTNK-----VVAIKVVDLENTNERLEVLAQEIFF 71

Query: 78  MKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEIL 137
           +  LK + YI++YI +  + + +       +++MEYC  G   D L     + L E ++ 
Sbjct: 72  LAELK-SPYIINYITTLLEDASM-------WIVMEYCGGGSCSDLLKYYFNNGLPEKKVA 123

Query: 138 KIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAA 197
            I  ++ +G+  +H  +   IHRDIK  N+L++E G  K+ DFG          + Q  +
Sbjct: 124 YITREILKGLQYLH--EQKKIHRDIKAANILLTEEGHVKLGDFGV---------SGQLKS 172

Query: 198 FIHHDIMINTTAQYRSPEMIDK-YSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAI 256
            +    ++  T  + +PE+  +   GY  DEK DIW+LG+ +++L     P  K     +
Sbjct: 173 TLRRGTIVG-TPYWMAPEVASQNIEGY--DEKIDIWSLGITVFELLKGVPPLVKLDPIRV 229

Query: 257 LNVKFQFPSYPQ----YSDHIRNIITIMLNKDPIKRPNICQVLE 296
           L       S P+    YSD  ++ + + L K+P +RP    +L+
Sbjct: 230 L-ANLSRKSAPRLQGAYSDAAKSFVALCLIKNPNERPAAVDLLK 272

>TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5.406
           YHR102W
          Length = 1036

 Score = 87.4 bits (215), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 79/335 (23%), Positives = 151/335 (45%), Gaps = 48/335 (14%)

Query: 9   YEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGL 68
           + +  V+  G   V+ + Y       QVY+++V++  +  +E+                 
Sbjct: 46  FRRTEVIGRGKFGVVYKGYHV--KTQQVYAIKVLNLDSESDEV----------------- 86

Query: 69  NTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLY 128
             ++ EV  +  LK    I+ Y  S+ + + L       +++M+YC+ G +   L     
Sbjct: 87  EDVQREVQFLSSLKQFPNIIRYFGSYLKDTNL-------WIIMDYCAGGSIRTLLRP--- 136

Query: 129 HRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLR 188
            ++ E  I  IM ++   +  +H  +  +IHRDIK  NVL++  G  K+CDFG A  + +
Sbjct: 137 GKIDEKYIGIIMREILIALQYIH--KDNVIHRDIKAANVLVTNEGKVKLCDFGVAAQLNQ 194

Query: 189 PPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPF 248
                Q  A          T  + +PE+I + + Y  D K+DIW+LG+  Y++     P+
Sbjct: 195 TKLRRQTMA---------GTPYWMAPEVIMEGAYY--DTKADIWSLGITAYEIATGNPPY 243

Query: 249 -EKEGENAILNVKFQFPSYPQ---YSDHIRNIITIMLNKDPIKRPNI--CQVLEQVSKLQ 302
            E E   A+  +    P+  +   YS  ++  I + L++DP +R +    Q  + +   +
Sbjct: 244 CEIEALRAMQLITKSKPARLEGRSYSTSLKEFIALCLDEDPKERLSAEELQKTKFIKSQR 303

Query: 303 GVPCPIENFMLTRIKLQNSRNNSNKSTSLNDTTNN 337
            VP  I   +++R  L   ++   + +  +D  NN
Sbjct: 304 AVPTTILKELISRYLLFRDKHTPREHSYADDLGNN 338

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score = 87.0 bits (214), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 73/277 (26%), Positives = 135/277 (48%), Gaps = 33/277 (11%)

Query: 27  YLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKY 86
           +L  GGFA+ + ++     + + ++     + ++ +  +     L +E+   K +K +  
Sbjct: 95  FLGEGGFARCFQMK-----DDKGKVFAAKTVAKLSIKSEKTRRKLLSEIQIHKSMK-HPN 148

Query: 87  IVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQG 146
           IV + D         + +  V++L+E C  G V++ L  R +  L E E+   M  +   
Sbjct: 149 IVQFTDCF-------EDDTNVYILLEICPNGSVMELLRQRKH--LTEPEVRFCMIQIIGA 199

Query: 147 VAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMIN 206
           +  MH  +  +IHRD+K+ N+   +  + KI DFG A +VL   K  +          I 
Sbjct: 200 IRYMHSRR--VIHRDLKLGNIFFDKEYNLKIGDFGLA-AVLANDKERKYT--------IC 248

Query: 207 TTAQYRSPEMI-DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFE-KEGENAILNVK---F 261
            T  Y +PE++  K++G+  +   DIW++GV LY L +   PF+ KE E     +K   F
Sbjct: 249 GTPNYIAPEVLTGKHTGHSYE--VDIWSIGVMLYALLFGKPPFQAKEVETIYERIKCRDF 306

Query: 262 QFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 298
            FP+    S   +N+I+ +L  +P  RP++ ++ + V
Sbjct: 307 IFPADKPVSSDAKNLISHLLQLNPAARPSLYEITDNV 343

>SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 364

 Score = 84.7 bits (208), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 51/152 (33%), Positives = 75/152 (49%), Gaps = 7/152 (4%)

Query: 159 HRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMID 218
           H+DIK  N++ S +G   ICD GS         +  +          + T  +RSPE+++
Sbjct: 212 HKDIKPANIMFSSDGLPVICDLGSCSRAHVDISSRSQLVEFQEWCNEHCTLPFRSPELLN 271

Query: 219 KYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE-------NAILNVKFQFPSYPQYSD 271
                 IDEK DIW+LG  LY +C+  +PFE+E +        AI   KF  P    YS 
Sbjct: 272 VTLNSKIDEKVDIWSLGCTLYCMCFGISPFEREEQLSGASMTYAIATGKFSIPPNTNYSP 331

Query: 272 HIRNIITIMLNKDPIKRPNICQVLEQVSKLQG 303
            +  II   +  D  KRP+I ++L ++  LQG
Sbjct: 332 ELIKIIKDCIEVDSKKRPSIDELLARLQDLQG 363

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 69/143 (48%), Gaps = 17/143 (11%)

Query: 14  VLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRA 73
           VL  G H  I ++ L  GGF+ VY V+    S   N+L     LK++  P       + +
Sbjct: 21  VLINGQHYAI-QRLLGEGGFSFVYLVQ----SRENNDLFA---LKKIHCP----FGNIES 68

Query: 74  EVDAMKLLKGNKYIVSYIDSHAQRSELKQ---GEYEVFLLMEYCSRGGVIDFLNTRLYH- 129
             +AM+ +   K   S   +H   S++ Q   G   VF+L+ Y   G ++D +NT L   
Sbjct: 69  VSEAMREVNSYKKFRSPYITHCVSSQVLQEQDGSKTVFILLPYFPTGSLLDKINTHLLDG 128

Query: 130 -RLQEFEILKIMSDVCQGVAAMH 151
             + E EI++I+  V +G+  MH
Sbjct: 129 TTISEEEIVRILVSVARGLRTMH 151

>KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 843

 Score = 87.0 bits (214), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 63/198 (31%), Positives = 101/198 (51%), Gaps = 25/198 (12%)

Query: 104 EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIK 163
           E  V++++EYCS   + + L      RL   E  K+ S +   V   H L+   +HRD+K
Sbjct: 100 ESRVWMVLEYCSGHELYEHLLKE--QRLSLEESKKLFSQIASAVYYAHELK--CVHRDLK 155

Query: 164 IENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDK--YS 221
           +ENVL+  NG  K+ DFG          T + A     + +  TT  Y +PE+I++  Y 
Sbjct: 156 LENVLLDGNGHAKLTDFGF---------TREMATRSQLETICGTTV-YMAPELIERKCYD 205

Query: 222 GYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE----NAILNVKFQFPSYPQYSDHIRNII 277
           G+    K DIW+LG+ LY +     PF+++ +      I+N +  F +    SD   ++I
Sbjct: 206 GF----KVDIWSLGIILYTMINGYMPFDEDDDIKTKLKIVNDELDF-NQEWISDDAIDLI 260

Query: 278 TIMLNKDPIKRPNICQVL 295
             ML K+P +R ++ QVL
Sbjct: 261 QGMLRKNPNERISLAQVL 278

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score = 87.0 bits (214), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 70/277 (25%), Positives = 133/277 (48%), Gaps = 33/277 (11%)

Query: 27  YLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKY 86
           +L  GGFA+ + ++  D S       T+A   ++ +  +     L +E+   K ++ +  
Sbjct: 78  FLGEGGFARCFQMK--DDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMR-HPN 131

Query: 87  IVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQG 146
           IV + D         + +  V++L+E C  G ++D L  R   +L E E+    + +   
Sbjct: 132 IVQFTDCF-------EDDTNVYILLEICPNGSLMDLLKQR--KQLTEPEVRFFTTQIVGA 182

Query: 147 VAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMIN 206
           +  MH  +  +IHRD+K+ N+   ++ + KI DFG A  +       +E  +      I 
Sbjct: 183 IKYMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFGLAAVL----ANDRERKY-----TIC 231

Query: 207 TTAQYRSPEMI-DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILN----VKF 261
            T  Y +PE++  K++G+  +   D+W++GV +Y L     PF+ +  N I        F
Sbjct: 232 GTPNYIAPEVLTGKHTGHSFE--VDVWSIGVMIYALLIGKPPFQAKEVNTIYERIKVCDF 289

Query: 262 QFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 298
            FP     S   + +I  +L+ DP++RP++ +++E V
Sbjct: 290 NFPRDKPISSEAKVLIKDILSLDPLERPSLTEIMEYV 326

>Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL101W
           (REAL)
          Length = 1526

 Score = 87.4 bits (215), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 69/228 (30%), Positives = 110/228 (48%), Gaps = 32/228 (14%)

Query: 99  ELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLI 158
           E+ + + E++L++EY   G + D+L +R   +L E E +     + +GV+  H     + 
Sbjct: 181 EVWENKSELYLVLEYVDGGELFDYLVSR--GKLPEREAIHYFKQIVEGVSYCHSFN--IC 236

Query: 159 HRDIKIENVLI-SENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI 217
           HRD+K EN+L+  +N   KI DFG A   L P K  + +    H         Y SPE++
Sbjct: 237 HRDLKPENLLLDKKNKKIKIADFGMAALEL-PNKLLKTSCGSPH---------YASPEIV 286

Query: 218 --DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAIL----NVKFQFPSYPQYSD 271
               Y G P    SD+W+ G+ L+ L     PF  +    +L    + K+Q P     S 
Sbjct: 287 MGRPYHGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPM--NLSL 340

Query: 272 HIRNIITIMLNKDPIKRPNICQVLEQ--VSKLQGVPCPIENFMLTRIK 317
             RN+I+ +L  DP KR    ++LE   + K   +P    N ML ++K
Sbjct: 341 EARNLISKILVIDPEKRITTQEILEHPLIKKYDNLPV---NKMLRKMK 385

>TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1237

 Score = 87.0 bits (214), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 88/184 (47%), Gaps = 22/184 (11%)

Query: 118  GVIDFLN-TRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYK 176
            G ID  +   L   + EFE   I   V  G+  +H  +  ++HRDIK ENV++   G  K
Sbjct: 1069 GSIDLFDLIELKTNMTEFEAKLIFKQVISGIKHLH--EQGIVHRDIKDENVIVDSKGFVK 1126

Query: 177  ICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYSGYPIDEKSDIWAL 234
            + DFGSA  V   P           D+ + T   Y +PE++  + Y G P     DIWA+
Sbjct: 1127 LIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGEPYEGKP----QDIWAV 1171

Query: 235  GVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQV 294
            G+ LY + +   PF    E  I+    +F    + S+   N+I  +LNK+  KRP I  +
Sbjct: 1172 GILLYTIVFKENPFYNIDE--IMEGTLKFSIGSEVSEECVNLIKKILNKNAPKRPTIQDI 1229

Query: 295  LEQV 298
             + V
Sbjct: 1230 YDDV 1233

>CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {ON}
           similar to uniprot|Q12236 Saccharomyces cerevisiae
           YOL100w PKH2
          Length = 965

 Score = 87.0 bits (214), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 63/205 (30%), Positives = 102/205 (49%), Gaps = 21/205 (10%)

Query: 102 QGEYEVFLLMEYCSRGGVIDFLN-TRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHR 160
           Q E  ++ L+EY   G   DFL+  + +  L E   +   + +   + +MH     +IHR
Sbjct: 188 QDEANLYFLLEYAPNG---DFLSLIKKFGTLNEECTIYYSAQIIDAIGSMH--SHGIIHR 242

Query: 161 DIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINT-----TAQYRSPE 215
           DIK EN+L+  N   K+ DFG+A  +L+  K   +    H++++  +     TA+Y SPE
Sbjct: 243 DIKPENILLDGNMKIKLTDFGTA-KLLQ--KKSDKNGKPHYNLLTRSSSFVGTAEYVSPE 299

Query: 216 MI-DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILN--VKFQFPSYPQYSDH 272
           ++ D Y+ Y    K DIWA G  +Y++     PF+   E       +K QF     +   
Sbjct: 300 LLSDNYTDY----KCDIWAFGCLVYQMIAGKPPFKATNEYLTFQKVMKVQFAFTAGFPTI 355

Query: 273 IRNIITIMLNKDPIKRPNICQVLEQ 297
           IR+++  +L K P KR  I Q+ E 
Sbjct: 356 IRDLVKNILVKQPEKRLTIPQIKEH 380

>ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]
           {ON} similar to uniprot|P08458 Saccharomyces cerevisiae
           YDR523C SPS1 dispensable for mitosis involved in
           middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 471

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 79/305 (25%), Positives = 149/305 (48%), Gaps = 37/305 (12%)

Query: 23  IIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV-IVPDKSGLNTLRAEVDAMKLL 81
           II++ +  G F  VY  +  D        G +  +K V +   +  ++ L  E+  +  L
Sbjct: 16  IIQQCVGRGNFGDVY--KACDKVE-----GKVVAVKVVNLEHSEEDIDLLAQEIFFLAEL 68

Query: 82  KGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMS 141
           + + +I +YI +  +       +  ++++MEYC  G   D +     + + E ++  I S
Sbjct: 69  R-SPFITNYITTLTE-------DVSMWIVMEYCGGGSCADLIKHIYINGMPEKKVAFITS 120

Query: 142 DVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHH 201
            V +G+  +H  +   IHRDIK  N+L+++ G  K+ DFG +  +     T +   F+  
Sbjct: 121 QVLRGLVYLH--EQKKIHRDIKAANILLTDEGTVKLGDFGVSGQI---RATLKRGTFV-- 173

Query: 202 DIMINTTAQYRSPEMIDKYS-GYPIDEKSDIWALGVFLYKLCYYTTPFEK-EGENAILNV 259
                 T  + +PE++ K + GY  DEK+DIW+LG+ +Y+L     P  K +    ++N+
Sbjct: 174 -----GTPYWMAPEVVSKENDGY--DEKADIWSLGITVYELLKGAPPLSKCDPMKVMINL 226

Query: 260 KFQFPS--YPQYSDHIRNIITIMLNKDPIKRPNICQVLEQ--VSKLQGVPCPIENFMLTR 315
             + P   +  YS   +N ++  L K+P+ R +  +++E   V++L  VP   E+    +
Sbjct: 227 PKRKPPALHGHYSHSAKNFVSSCLVKNPVGRASAYEMVEHNFVNQL-AVPNLKEDVEYLK 285

Query: 316 IKLQN 320
           IK  N
Sbjct: 286 IKKSN 290

>ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON}
           similar to uniprot|P38990 Saccharomyces cerevisiae
           YER129W PAK1 Upstream kinase for the SNF1 complex
           partially redundant function with Elm1p and Tos3p
           members of this family of kinases have functional
           orthology with LKB1 a mammalian kinase associated with
           Peutz-Jeghers cancer-susceptibility syndrome and some
           similarities with YGL179C uniprot|P43637 Saccharomyces
           cerevisiae YGL179C TOS3 Putative protein kinase, related
           to and redundant with Elm1p and Pak1p in activating the
           SNF1 complex
          Length = 1131

 Score = 86.7 bits (213), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 92/334 (27%), Positives = 147/334 (44%), Gaps = 72/334 (21%)

Query: 9   YEKGRVLPIGTH-QVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSG 67
           YE  + L  G H +V + + L  G   Q+ +++++D    +         +R +V DK  
Sbjct: 115 YELIQELGHGQHGKVKLARELLTG---QLVAIKIVDRHEKKG--------RRFLVLDKKN 163

Query: 68  LNT----LRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI--- 120
             T    +R E+  MK     K++V  ++      +LK    +++L++EYCSRG V    
Sbjct: 164 SLTQNEKIRREIAIMKKCH-YKHVVKLVEV---LDDLKS--RKIYLVLEYCSRGEVKWCP 217

Query: 121 -DFLNTRL-------YHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISEN 172
            D L T         + R +E     I+  V  G+  +HY    +IHRDIK  N+L++E+
Sbjct: 218 GDVLETEARGPPLLNFQRTRE-----IIRGVVLGLEYLHYQG--VIHRDIKPANLLMAED 270

Query: 173 GDYKICDFGSACSVLRP--------------PKTPQEAAFIHHDIMINTTA-QYRSPEMI 217
           G  KI DFG + +   P               KT    AF   +I +   A +  S +  
Sbjct: 271 GTVKISDFGVSLAARDPNGDANLESLDELELAKTAGTPAFFAPEICLGEEAFEKFSIDRS 330

Query: 218 DKYSGYPIDEKSDIWALGVFLYKLCYYTTPF----EKEGENAILNVKFQFPSYPQYSD-- 271
           D + G  +    DIWALGV LY L +   PF    E E    I+N     PS+   ++  
Sbjct: 331 DLFKGSSVSFMIDIWALGVTLYCLLFGMLPFISDYELELFEKIVNQPLTCPSFQNLNNNG 390

Query: 272 --HIR---------NIITIMLNKDPIKRPNICQV 294
             HI          +++T +L K P+ R  I ++
Sbjct: 391 VSHISSKEEYDLAVDLLTRLLKKSPLDRIGIQEI 424

>AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR523C
           (SPS1)
          Length = 440

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 104/195 (53%), Gaps = 18/195 (9%)

Query: 107 VFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIEN 166
           ++++MEYC  G   + L     H++ E +   I+S+V  G+  +H  +   IHRDIK  N
Sbjct: 91  MWIVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVSEVLIGLDYLHSQRK--IHRDIKSAN 148

Query: 167 VLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDK-YSGYPI 225
           +L+++NG  K+ DFG +  ++    T +   F+        T  + +PE+ID+   GY  
Sbjct: 149 ILLTDNGHVKLGDFGVSGQMM---VTRKRDTFV-------GTPFWMAPEVIDRNKQGY-- 196

Query: 226 DEKSDIWALGVFLYKLCYYTTPFEK-EGENAILNVKFQFPSY--PQYSDHIRNIITIMLN 282
           +E +DIW+LG+ + +L     P +K +   A++ +  + P     ++S H R+ +   L 
Sbjct: 197 NEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIPKRDPPKLDKRFSSHARDFVAQCLI 256

Query: 283 KDPIKRPNICQVLEQ 297
           KDP +RP   ++L+ 
Sbjct: 257 KDPSQRPTAAELLKH 271

>NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {ON}
           Anc_8.668
          Length = 883

 Score = 86.7 bits (213), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 55/197 (27%), Positives = 101/197 (51%), Gaps = 23/197 (11%)

Query: 104 EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIK 163
           E +V++  EYC    + D + +    R+     +++ + +   V   H L    +HRD+K
Sbjct: 101 ESKVWMAQEYCPGKDLYDHVLS--LQRVPSSACIELFTQIVGAVYYAHSLN--CVHRDLK 156

Query: 164 IENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDK--YS 221
           +EN+L+ +NG+ K+ DFG     +   KT  E         I  T  Y +PE+I +  Y 
Sbjct: 157 LENILLDKNGNAKLTDFGFTRECM--TKTSLET--------ICGTTVYMAPELIKRESYD 206

Query: 222 GYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAI-LNVKFQFPSYPQ--YSDHIRNIIT 278
           G+ I    DIW+LGV LY +   + PF+++ E      +  + P +     S+  ++++ 
Sbjct: 207 GFKI----DIWSLGVILYTMLNGSMPFDEDDETKTEWKIMNEMPVFNDTILSEDAKDLLI 262

Query: 279 IMLNKDPIKRPNICQVL 295
            +L+KDP +RP++ ++L
Sbjct: 263 KLLSKDPNERPSMQEIL 279

>TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.591
           YDR466W
          Length = 694

 Score = 86.3 bits (212), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 72/284 (25%), Positives = 128/284 (45%), Gaps = 37/284 (13%)

Query: 20  HQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMK 79
           H  + ++ L  G ++ VY  + +D +NA        C K+ I+ +K  +  +  E + + 
Sbjct: 10  HDFVFKQELGHGSYSTVY--KAVDRTNANRVYAIKVCSKQHIIKEKK-VKYVTIEKNTLN 66

Query: 80  LLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKI 139
           LL   ++    +  H    +    E  ++ +++Y   G ++  L     HR++ F  +  
Sbjct: 67  LLTRARH-PGIVKLHYTFHD----EENLYFVLDYAPGGELLSLL-----HRMKTFSEMWA 116

Query: 140 MSDVCQGVAAMHYLQPP-LIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAF 198
               CQ + +M +L    +IHRD+K EN+L++  G   I DFG+A          + ++F
Sbjct: 117 CHFTCQLIDSMQFLHSQGIIHRDLKPENLLLNNEGRLMITDFGTATGT-----DSRGSSF 171

Query: 199 IHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAIL- 257
           +        TA+Y SPE++        D  SDIWALG  +Y+    + PF  E E     
Sbjct: 172 V-------GTAEYVSPELLLHNQ---CDVSSDIWALGCMIYQFLQGSPPFRGENELQTFE 221

Query: 258 -NVKFQFP-SYPQYSDHIRNIITIMLNK-----DPIKRPNICQV 294
             V   +P + PQ +    N + + L +     DP  RP + Q+
Sbjct: 222 KTVSLDYPWNNPQVTPKGINPVVVDLTRRILVLDPSVRPTLQQI 265

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score = 86.3 bits (212), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 78/295 (26%), Positives = 140/295 (47%), Gaps = 33/295 (11%)

Query: 27  YLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKY 86
           +L  GGFA+ + ++  D S       T+A   ++ +  +     L +E+   K +K +  
Sbjct: 82  FLGEGGFARCFQMK--DDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMK-HPN 135

Query: 87  IVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQG 146
           IV +ID         + +  V++L+E C  G ++D L  R    L E E+    + +   
Sbjct: 136 IVQFIDCF-------EDDTNVYILLEICPNGSLMDLLKKR--KVLTEPEVRYFTTQIVGA 186

Query: 147 VAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMIN 206
           +  MH  +  +IHRD+K+ N+    N + KI DFG A  +       +E  +      + 
Sbjct: 187 IKYMHNRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVL----ANDRERKY-----TVC 235

Query: 207 TTAQYRSPEMI-DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAIL-NVK---F 261
            T  Y +PE++  K+SG+  +   DIW++GV +Y L     PF+ +  N I   +K   +
Sbjct: 236 GTPNYIAPEVLAGKHSGHSYE--VDIWSIGVMIYALLIGKPPFQAKEVNIIYERIKSGDY 293

Query: 262 QFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSKLQGVPCPIENFMLTRI 316
            FP     S  +  +I  +L+ DPI+RP++ ++++ V      P  I   +LT +
Sbjct: 294 IFPREKPTSKEVMVLIQDILSIDPIERPSLDEIMDYVWFRGIFPARINGDVLTSV 348

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
           (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score = 86.3 bits (212), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 68/275 (24%), Positives = 131/275 (47%), Gaps = 34/275 (12%)

Query: 27  YLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKY 86
           +L  GGFA+ + ++  D      ++     + ++ +  +   N L +E+   K ++ ++ 
Sbjct: 103 FLGEGGFARCFQMKDDDG-----KVFAAKTVAKISIKSEKARNKLLSEIQIHKNMR-HQN 156

Query: 87  IVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQG 146
           IV +ID         + +  V++L+E C  G ++D L  R    L E E+    + +C  
Sbjct: 157 IVHFIDCF-------EDDINVYILLEICPNGSLMDLLKRR--KILTEPEVRFFTTQICGA 207

Query: 147 VAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMIN 206
           +  MH     +IHRD+K+ N+   ++ + KI DFG A  +        E  +      I 
Sbjct: 208 LDHMH--SRNIIHRDLKLGNIFFDKDFNLKIGDFGLAAII----NNENERKY-----TIC 256

Query: 207 TTAQYRSPEMI--DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILN----VK 260
            T  Y +PE+I   K  G+  +   DIW+LGV ++ +     PF+ +  + I +      
Sbjct: 257 GTPNYIAPEVIMGGKQIGHSFE--VDIWSLGVMIFAMITGKPPFQAKEVSTIYDRIKHCN 314

Query: 261 FQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVL 295
           + FP+    S  ++ +I  +L+ +P++RP I ++L
Sbjct: 315 YSFPTDKYVSKDVKKLIQDILSMNPMERPTIQEIL 349

>CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31 or
            uniprot|Q08217 Saccharomyces cerevisiae YOL045w
          Length = 1206

 Score = 86.7 bits (213), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 57/169 (33%), Positives = 83/169 (49%), Gaps = 19/169 (11%)

Query: 131  LQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPP 190
            + EFE   I   +  G+  +H     ++HRDIK ENV++   G  K+ DFGSA  V   P
Sbjct: 1052 MTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKGFVKLIDFGSAAYVKSGP 1109

Query: 191  KTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKS-DIWALGVFLYKLCYYTTPFE 249
                       D+ + T   Y +PE++    G P + KS DIWA+G+ LY L Y   PF 
Sbjct: 1110 ----------FDVFVGTI-DYAAPEVL---GGNPYEGKSQDIWAIGILLYTLIYKENPFY 1155

Query: 250  KEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 298
               E  IL  + +F      S   + +IT +LN+   KRP I ++ + V
Sbjct: 1156 NIDE--ILEGELRFNDSADVSQECKALITKILNRCVRKRPTIDEICQDV 1202

>KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON} 
          Length = 649

 Score = 85.9 bits (211), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 72/260 (27%), Positives = 119/260 (45%), Gaps = 41/260 (15%)

Query: 58  KRVIVPDKSGLNTLRAEVDAMKLL--KGNKYIVSYIDSHAQRSELKQG-EYEVFLLMEYC 114
           K+V  P+K     +  E++  K++    + +IV      A R   + G E  ++++++YC
Sbjct: 70  KKVHCPNKENKRKIIKELEIYKVICRSHHNHIV------ALRDAFQWGKESCIYMILDYC 123

Query: 115 SRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGD 174
           S   +   L  R    L E E  ++M  +C G+  +H     +IH D+K+ N+L  E   
Sbjct: 124 SNNSLQSILQYR--GSLNEVECKELMIQLCGGIYWLHL--NNVIHGDLKLSNILFDEGQQ 179

Query: 175 YKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKY-----SGYPIDEKS 229
            KICDFGS+      P+ P E         I  T  Y +PE +  +     SG  I   S
Sbjct: 180 LKICDFGSSFIATSSPRGPGE---------IMGTPYYLAPETVYTHKNINKSGMAILLIS 230

Query: 230 ---DIWALGVFLYKLCYYTTPFEK---EGENAILNVKFQ--------FPSYPQYSDHIRN 275
              DIW++G+ LY L Y   PF K   E  N  L+   Q        FP+        + 
Sbjct: 231 FPIDIWSMGIVLYSLLYGINPFIKSVDELHNVSLDELMQRITSGVIEFPTNKAVGAGAQQ 290

Query: 276 IITIMLNKDPIKRPNICQVL 295
           +I  ML+++P++R  + +++
Sbjct: 291 LILKMLSQNPLERITLVEIV 310

>Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to
           Ashbya gossypii AFR724C
          Length = 440

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 76/282 (26%), Positives = 138/282 (48%), Gaps = 34/282 (12%)

Query: 21  QVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSG-LNTLRAEVDAMK 79
           Q  I + +  G F  VY  R +    A NE+     +K V + D    ++ L  E+  + 
Sbjct: 19  QYEILQCIGRGNFGDVYKARYL----ATNEI---VAIKVVNLEDTDEPIDLLAQEIFFLS 71

Query: 80  LLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKI 139
            L+ + YI +Y  +          +  ++++MEYC  G   + L     H+L E +   I
Sbjct: 72  ELR-SPYITNYKTAFLV-------DVSMWIVMEYCGGGSCAELLKYTPEHKLTEDQCAFI 123

Query: 140 MSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFI 199
           +S+V  G+  +H  +   IHRDIK  N+L+++NG  K+ DFG +  ++    T +   F+
Sbjct: 124 VSEVLVGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFGVSGQMM---VTRKRDTFV 178

Query: 200 HHDIMINTTAQYRSPEMIDK-YSGYPIDEKSDIWALGVFLYKLCYYTTPFEK-EGENAIL 257
                   T  + +PE+ID+   GY  +E +DIW+LG+ + +L     P +K +   A++
Sbjct: 179 -------GTPFWMAPEVIDRNKKGY--NEMADIWSLGITVIELLMGHPPLDKYDAMKALM 229

Query: 258 NVKFQFPSY--PQYSDHIRNIITIMLNKDPIKRPNICQVLEQ 297
            +  + P     ++S H ++ +   L KDP +RP   ++L+ 
Sbjct: 230 AIPKRDPPKLDKRFSSHAKDFVAQCLIKDPSQRPTASELLKH 271

>Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074
           aa] {ON} YHR102W (REAL)
          Length = 1074

 Score = 86.3 bits (212), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 74/268 (27%), Positives = 124/268 (46%), Gaps = 29/268 (10%)

Query: 64  DKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFL 123
           D   +  ++ E+  +  LK    I  Y  S+ + + L       +++MEYC+ G +   L
Sbjct: 59  DSDEVEDVQREIQFLASLKQIHNITRYYGSYLKDTSL-------WIIMEYCAGGSLRSLL 111

Query: 124 NTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSA 183
                 ++ E  I  IM +V   +  +H  +  +IHRDIK  NVLI+  G+ K+CDFG A
Sbjct: 112 RP---GKIDEKYIGVIMREVLVALKCIH--KDNVIHRDIKAANVLITNEGNVKLCDFGVA 166

Query: 184 CSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCY 243
             V +     Q  A          T  + +PE+I    G   D K DIW+LG+  Y++  
Sbjct: 167 AQVNQTSLRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEIAT 215

Query: 244 YTTPF-EKEGENAI-LNVKFQFPSYP--QYSDHIRNIITIMLNKDPIKRPNICQVLEQ-- 297
              P+ E E   A+ L +K + P      YS  ++  I + L++DP +R +   +L+   
Sbjct: 216 GNPPYCEVEALRAMQLIIKSKPPRLEGRSYSPSLKEFIALCLDEDPKERLSADDLLKSKF 275

Query: 298 VSKLQGVPCPIENFMLTRIKLQNSRNNS 325
           +   +  P  I   +++R  L   +N S
Sbjct: 276 IKNHKTTPTSILKELISRYLLFRDKNKS 303

>TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8.141
           YGL180W
          Length = 1154

 Score = 86.3 bits (212), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 84/313 (26%), Positives = 143/313 (45%), Gaps = 51/313 (16%)

Query: 21  QVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKL 80
           + I+EK +  G FA VY  R   + +   +L   +  K  +  +K  L  L  E+  +K 
Sbjct: 131 EYILEKEIGKGSFAVVY--RGYSNEDPNFKLAVKSVPKSKL-KNKKILENLEIEISILKK 187

Query: 81  LKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTR---------LYHRL 131
           L  +K+IV+ ID    +++         L+MEYCS G +   +  R         L    
Sbjct: 188 L-NHKHIVNLIDCQRNKNDF-------LLIMEYCSLGDLTFLIKKRNELIINHPLLNQIF 239

Query: 132 QEF----------EILKIMSDVCQGVAAMHYLQPP-LIHRDIKIENVLISE-NGDY---- 175
           Q+F           I  +++ + Q  +A+ +L+   LIHRDIK +N+L+S    DY    
Sbjct: 240 QKFPSPNPDCNGLNIAFVLNYLQQLASALKFLRSRNLIHRDIKPQNLLLSTPYTDYHDQQ 299

Query: 176 ---KICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQ---YRSPEMIDKYSGYPIDEKS 229
              K+   G +C  +        A F+ +  +  T      Y +PE+++ Y  Y  + K+
Sbjct: 300 TFKKLGYIGISCLPILKIADFGFARFLPNTSLAETLCGSPLYMAPEILN-YQKY--NAKA 356

Query: 230 DIWALGVFLYKLCYYTTPFEKEGENAIL------NVKFQFPSYPQYSDHIRNIITIMLNK 283
           D+W++G  LY++ Y   PF+      +L      N    FPSY +  D ++ +I+ +L  
Sbjct: 357 DLWSVGTVLYEMVYGKPPFKANNHLELLKKIKRTNDNIPFPSYIEIDDDMKFLISRLLKF 416

Query: 284 DPIKRPNICQVLE 296
           DPIKR +  +  E
Sbjct: 417 DPIKRMSFQEFFE 429

>TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1391

 Score = 86.3 bits (212), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 74/298 (24%), Positives = 137/298 (45%), Gaps = 42/298 (14%)

Query: 9   YEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGL 68
           ++ G  L +G+   +   Y +  G  Q  +++VI  +   N+    A    ++ PD    
Sbjct: 20  WKLGETLGLGSTGKVQLAYNSSTG--QQAAIKVISKAVFNND-NANASDSALLTPDSLPY 76

Query: 69  NTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLY 128
              R E+  MKLL     +  Y        ++ + +  +++++EY  +G + + L  R  
Sbjct: 77  GIER-EIIIMKLLNHPNVLRLY--------DVWETDSNLYMVLEYAEKGELFNLLVER-- 125

Query: 129 HRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLR 188
             L E E ++    +  G++  H L   ++HRD+K EN+L+    + KI DFG       
Sbjct: 126 GPLPENEAIRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKYNIKIADFGM------ 177

Query: 189 PPKTPQEAAFIHHDIMINTTA---QYRSPEMIDKYSGYPIDE-KSDIWALGVFLYKLCYY 244
                  AA    D ++ T+     Y +PE+I   SG P    ++D+W+ G+ L+ L   
Sbjct: 178 -------AALETEDKLLETSCGSPHYAAPEII---SGLPYHGLETDVWSCGIILFALLTG 227

Query: 245 TTPFEKEG---ENAILNV---KFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLE 296
             PF++E     N +L V   +F+ P   + S   +++I+ +L  DP KR    ++L+
Sbjct: 228 RLPFDEEDGNIRNLLLKVQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILK 285

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score = 85.9 bits (211), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 63/201 (31%), Positives = 102/201 (50%), Gaps = 31/201 (15%)

Query: 104 EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEF-EILKIMSDVCQGVAAMHYLQPPLIHRDI 162
           E +V++ +EYC    + D L +     L E  E+   +S       +MH      +HRD+
Sbjct: 104 ESKVWMALEYCPGKELYDHLLSLRRISLLECGELFAQISGAVYYAHSMH-----CVHRDL 158

Query: 163 KIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDK--Y 220
           K+EN+L+ +NG+ K+ DFG     +   KT  E         +  T  Y +PE+I++  Y
Sbjct: 159 KLENILLDKNGNAKLTDFGFTRECM--TKTTLET--------VCGTTVYMAPELIERRTY 208

Query: 221 SGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILNVKFQFPS-YPQYS-----DHIR 274
            G+ I    DIW+LGV LY L     PF+ + E      K++  +  P+Y      D  R
Sbjct: 209 DGFKI----DIWSLGVILYTLITGYLPFDDDDE---AKTKWKIVNEEPKYDAKVIPDDAR 261

Query: 275 NIITIMLNKDPIKRPNICQVL 295
           ++I+ +L K+P +RP++ QVL
Sbjct: 262 DLISRLLAKNPGERPSLSQVL 282

>KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7.86
            YAL017W
          Length = 1055

 Score = 85.9 bits (211), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 80/311 (25%), Positives = 134/311 (43%), Gaps = 46/311 (14%)

Query: 1    MNQPEIPKYEKGRVLPIGTHQ--------VIIEKYLACGGFAQVYSVRVIDSSNARNELG 52
            ++QPE P    G + P G  +        V+++K L  G +  V+           N+  
Sbjct: 768  LSQPEPPTLPNG-INPFGIERRTKRMADFVVLQK-LGDGAYGHVHL--------CMNKKT 817

Query: 53   TMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSH-----AQRSELKQGEYEV 107
                + + I+ ++  ++T   + +    +    YI+S  ++H      Q  +  + +   
Sbjct: 818  KHLVIIKAIIKERILIDTWVRDRE-FGTIPSEIYIMSKFNAHPHDNITQIMDFFEDDDYY 876

Query: 108  FLLMEYCSRGGVIDFLN-TRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIEN 166
            ++ +E     G ID  +   L   + EFE   I   +  G+  +H     ++HRDIK EN
Sbjct: 877  YIELESHGETGSIDLFDLIELKTNMTEFEAKLIFKQIVSGIKYLH--DQGIVHRDIKDEN 934

Query: 167  VLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYSGYP 224
            V++  NG  K+ DFGSA       KT     F+        T  Y +PE++  + Y G P
Sbjct: 935  VIVDSNGFVKLIDFGSAAYT----KTGPFEVFV-------GTIDYAAPEILGGNPYKGKP 983

Query: 225  IDEKSDIWALGVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKD 284
                 DIWALGV LY L Y   PF    E  IL  + +F      +    ++I  +L K 
Sbjct: 984  ----QDIWALGVLLYTLIYKENPFYNVDE--ILEGQLRFDGTCNVTQDCIDLIRWILTKS 1037

Query: 285  PIKRPNICQVL 295
               RP+I +++
Sbjct: 1038 VNDRPSIDEIV 1048

>Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar to
           Ashbya gossypii ACR133C
          Length = 855

 Score = 85.9 bits (211), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 102/202 (50%), Gaps = 29/202 (14%)

Query: 104 EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIK 163
           E +V++ +EYC    + D+L  +   R+   E  K+ + +   V   H LQ   +HRD+K
Sbjct: 100 ESKVWMALEYCPGNELYDYLLQK--QRIPLDETSKLFAQIVGAVFYAHSLQ--CVHRDLK 155

Query: 164 IENVLISENGDYKICDFG--SACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDK-- 219
           +EN+L+ + G   + DFG    C+     KT  E         I  T  Y +PE+I +  
Sbjct: 156 LENILLDKQGYAMLTDFGFTRECAT----KTQLET--------ICGTTVYMAPELIKRES 203

Query: 220 YSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILNVKFQF---PSYPQYSD-HIRN 275
           Y GY    K D W+LG+ LY + +   PF++E +  +  +K      P    Y++ H ++
Sbjct: 204 YDGY----KVDTWSLGIILYTMLHGFMPFDEE-DPTLTGLKIMNEMPPIVDAYTNVHAKD 258

Query: 276 IITIMLNKDPIKRPNICQVLEQ 297
           +I  +L K P +RP++ +VLE 
Sbjct: 259 LILKLLRKTPSERPSLNKVLEH 280

>Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {ON}
           YDR490C (REAL)
          Length = 758

 Score = 85.5 bits (210), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 75/299 (25%), Positives = 134/299 (44%), Gaps = 40/299 (13%)

Query: 14  VLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRA 73
           V+ +G       + L  G ++ V    V+ ++    +   +  L +  +  +  +  +  
Sbjct: 117 VVKMGIKDFKFGEQLGDGSYSSV----VLATARESGKKYAVKVLSKEYLIRQKKVKYVTV 172

Query: 74  EVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLN-TRLYHRLQ 132
           E  A++ L G K I+    +        Q E  ++ L+EY   G   DFL   + Y  L 
Sbjct: 173 EKLALQKLNGTKGIIRLFFTF-------QDEASLYFLLEYAPHG---DFLGLIKKYGSLN 222

Query: 133 EFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKT 192
           E       S +   V ++H +   +IHRDIK EN+L+ ++   K+ DFG+A  +   P+ 
Sbjct: 223 EICARYYASQIIDAVDSLHSIG--IIHRDIKPENILLDKDMKVKLTDFGTAKIL---PEQ 277

Query: 193 PQEAA-------FIHHDIMINTTAQYRSPEMI-DKYSGYPIDEKSDIWALGVFLYKLCYY 244
           P  AA                 TA+Y SPE++ D Y+    D + DIWA G  LY++   
Sbjct: 278 PSNAADGKPCFDLYAKSKSFVGTAEYVSPELLNDSYT----DSRCDIWAFGCILYQMLAG 333

Query: 245 TTPFEKEGE----NAILNVKFQFPS-YPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 298
             PF+   E      ++ +++ F + +PQ    +++++  +L +DP  R  I Q+   V
Sbjct: 334 KPPFKAANEYLTFQKVMKIQYAFTAGFPQI---VKDLVKKLLVRDPNDRLAIEQIKAHV 389

>Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}
           YGL179C (REAL)
          Length = 563

 Score = 85.1 bits (209), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 69/215 (32%), Positives = 102/215 (47%), Gaps = 32/215 (14%)

Query: 106 EVFLLMEYCSRGGVIDFLNTRLYHRLQEFEIL------KIMSDVCQGVAAMHYLQPPLIH 159
           +V+L++EYCSRG V      ++  +     IL      KI+SDV  G+  +H     + H
Sbjct: 130 KVYLVLEYCSRGPVRWCPENQMEIKAVGPSILTFEQSRKILSDVVSGLEHLH--SRGITH 187

Query: 160 RDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTA---QYRSPEM 216
           RDIK  N+LIS NG  KI DFG A          Q +   H  I+ + T     + +PE+
Sbjct: 188 RDIKPSNLLISSNGTVKISDFGVAILSTTGSTNIQSS---HEQILKSKTLGTPAFLAPEL 244

Query: 217 IDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEK----EGENAILNVKFQFPSY------ 266
               S +      DIW+LGV LY L + T PF      E  + I+N   + PSY      
Sbjct: 245 CSTDSEHCCTFAIDIWSLGVTLYCLLFGTLPFNANSVLELFDKIINKSLEVPSYEEMLNR 304

Query: 267 -------PQYSDHIRNIITIMLNKDPIKRPNICQV 294
                   +YSD  +N++  +L K+P KR  + ++
Sbjct: 305 GTSDITIEEYSD-AKNLLYKLLQKNPDKRIALAEI 338

>TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]
           {ON} Anc_3.92 YDR490C
          Length = 1347

 Score = 85.9 bits (211), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 102/201 (50%), Gaps = 17/201 (8%)

Query: 102 QGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRD 161
           Q E  ++ L+EY S G ++  L  + Y    E   +   + +   +  +H +   +IHRD
Sbjct: 329 QDEANLYFLLEYASNGDLLTLL--KKYGSFDETSTIYFTAQIIDSIHYIHSMG--IIHRD 384

Query: 162 IKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINT-----TAQYRSPEM 216
           IK EN+L++++   K+ DFG+A  +L P +  Q  +  H +++  +     TA+Y SPE+
Sbjct: 385 IKPENILLTKDFKIKLTDFGTA-KILDPSQPSQSQSQPHFNLLERSKSFVGTAEYVSPEL 443

Query: 217 I-DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILN--VKFQFPSYPQYSDHI 273
           + D Y+    D + DIWA G  L++L     PF+   E       +K Q+     +   +
Sbjct: 444 LTDSYT----DSRCDIWAFGCILFQLIAGKPPFKATNEYLTFQKIIKLQYAFTAGFPTIL 499

Query: 274 RNIITIMLNKDPIKRPNICQV 294
           R++I  +L K+P  R  I Q+
Sbjct: 500 RDLIKKILIKNPNNRLTIHQI 520

>KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1381

 Score = 85.9 bits (211), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 87/191 (45%), Gaps = 35/191 (18%)

Query: 103  GEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDI 162
            G  ++F L+E+ S               + EFEI  +   V  GV  +H     ++HRDI
Sbjct: 1213 GSIDLFDLIEFTSN--------------MTEFEIKLLFKQVVSGVKHLH--DQGIVHRDI 1256

Query: 163  KIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI--DKY 220
            K EN+++   G  KI DFGSA  V   P           D+ + T   Y +PE++  + Y
Sbjct: 1257 KDENIIVDNKGFIKIIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGNPY 1305

Query: 221  SGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIM 280
             G P     DIWALG+ LY + +   PF    E  IL    +F      S     +I ++
Sbjct: 1306 EGKP----QDIWALGILLYTIVFKENPFYNIDE--ILEGDLKFNDPENISQDCIELIKLI 1359

Query: 281  LNKDPIKRPNI 291
            LN++  KRP I
Sbjct: 1360 LNRNVFKRPTI 1370

>Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045W -
            Hypothetical ORF [contig 47] FULL
          Length = 1213

 Score = 85.9 bits (211), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 59/180 (32%), Positives = 87/180 (48%), Gaps = 22/180 (12%)

Query: 118  GVIDFLN-TRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYK 176
            G ID  +   +   + E E + I   +  G+  +H     ++HRDIK ENV++  NG  K
Sbjct: 1045 GSIDLFDLIEMKTDMTEHEAMLIFKQIASGIKNLH--DNGIVHRDIKDENVIVDCNGFVK 1102

Query: 177  ICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYSGYPIDEKSDIWAL 234
            I DFGSA  V   P           D+ + T   Y +PE++  + Y G P     DIWA+
Sbjct: 1103 IVDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGEPYEGKP----QDIWAI 1147

Query: 235  GVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQV 294
            GV LY + Y   PF    E  IL+   +  S  + SD    +I  +LN+   KRP+I ++
Sbjct: 1148 GVLLYTIIYKENPFYNIDE--ILDADLRVNSSERISDDCIALIRKILNRSVSKRPSIDEI 1205

>NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa] {ON}
            
          Length = 1515

 Score = 85.9 bits (211), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 67/229 (29%), Positives = 107/229 (46%), Gaps = 37/229 (16%)

Query: 28   LACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSG--------LNTLRAEVDAMK 79
            +  G F  VY    + +       G M  +K+V VP  S         +  LR+EV  +K
Sbjct: 1220 IGKGSFGAVYLCLNVTT-------GEMMAVKQVEVPKYSSQDEAIISTVEALRSEVSTLK 1272

Query: 80   LLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKI 139
             L  +  IV Y+       E K   Y +FL  EY + G V   +  R+Y R  E  I  +
Sbjct: 1273 DL-DHLNIVQYLGF-----ENKDNIYSLFL--EYVAGGSVGSLI--RMYGRFDEPLIRHL 1322

Query: 140  MSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFI 199
             + V +G+A +H     ++HRD+K +N+L+ ++G  KI DFG    + R  K      + 
Sbjct: 1323 NTQVLRGLAYLHSRG--ILHRDMKADNLLLDQDGVCKISDFG----ISRKSKD----IYS 1372

Query: 200  HHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPF 248
            + D+ +  T  + +PEM+D   GY    K DIW+LG  + ++     P+
Sbjct: 1373 NSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPW 1419

>TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON} 
          Length = 434

 Score = 84.0 bits (206), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 79/277 (28%), Positives = 124/277 (44%), Gaps = 60/277 (21%)

Query: 47  ARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELK----- 101
            + + G + C+K      +SG       + A+K++K  K IVSY      + E++     
Sbjct: 182 GKGKFGKVYCVKH----KQSGF------ISALKVMK-KKEIVSYNAEKQFKREVEVQNSL 230

Query: 102 ------------QGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQE----FEILKIMSDVCQ 145
                       Q E  V+L+MEY         +N  LY  L+     F  +   + + Q
Sbjct: 231 NHPNIVKIFGFFQDEIFVYLIMEY--------LINGELYKSLKNNNGPFNDILASNYIYQ 282

Query: 146 GVAAMHYLQPP-LIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIM 204
              A+ Y+    +IHRDIK EN+++  N   K+ DFG   S+  PP   ++         
Sbjct: 283 IADALKYMHSKHIIHRDIKPENIVLGFNNKIKLADFG--WSICTPPNLRRKT-------- 332

Query: 205 INTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENA----ILNVK 260
           I  T  Y +PE++  +  Y  D   DIWALG+  Y+L     PFE+E ++     I+NV 
Sbjct: 333 ICGTIDYLAPELVT-FKEY--DYNVDIWALGILTYELIVGNPPFEEETKDLTYKRIINVD 389

Query: 261 FQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQ 297
             FP     S   R++IT +L  DP KR  +  V++ 
Sbjct: 390 LNFPQ--TVSMDARDLITRLLRFDPSKRMPLVDVMKH 424

>AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL209C
           (IPL1)
          Length = 367

 Score = 83.2 bits (204), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 85/283 (30%), Positives = 122/283 (43%), Gaps = 51/283 (18%)

Query: 24  IEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNT---LRAEVDAMKL 80
           I K L  G F +VY VR I+S       G +  LK +   D    N     R EV+    
Sbjct: 111 IGKVLGKGKFGRVYCVRHIES-------GFVCALKAMEKKDIIQYNIEKQFRREVEIQSS 163

Query: 81  LKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIM 140
           L+       Y   H ++         V+LLMEY   G +   L  R       F  +   
Sbjct: 164 LRHPNLTQLYGYFHDEK--------RVYLLMEYLVNGELYKHLKGR-----SHFNDVVAS 210

Query: 141 SDVCQGVAAMHYLQPP-LIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFI 199
             V Q   A+ Y+    ++HRDIK EN++I  N   K+ DFG   SV+ P  + ++    
Sbjct: 211 YYVYQMADALDYMHERNILHRDIKPENIIIGFNNTIKLTDFG--WSVITPKGSKRKT--- 265

Query: 200 HHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENA---- 255
                +  T  Y SPE+I        +EK D+WALGV  Y+L   + PFE+E +      
Sbjct: 266 -----LCGTVDYLSPELIRSRE---YNEKVDVWALGVLTYELLVGSPPFEEESKELTYKR 317

Query: 256 ILNVKFQFPSYPQYSDHI----RNIITIMLNKDPIKRPNICQV 294
           IL     FP      DH+    R++I+ +L  DP  R  + +V
Sbjct: 318 ILKRNLIFP------DHVDTEARHLISRLLEYDPGDRIPLKEV 354

>KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON}
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase
          Length = 1338

 Score = 85.5 bits (210), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 107/229 (46%), Gaps = 37/229 (16%)

Query: 28   LACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVP-----DKSGLN---TLRAEVDAMK 79
            +  G F  VY    + +       G M  +K+V VP     D+S ++    L++EV  +K
Sbjct: 1044 IGKGSFGAVYLALNVTT-------GEMLAVKQVTVPEFSSQDESAISMVEALKSEVSTLK 1096

Query: 80   LLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKI 139
             L  +  IV Y+       E K G Y +FL  EY + G V   +  R+Y R  +  I  +
Sbjct: 1097 DL-NHVNIVQYLGF-----EEKNGIYSLFL--EYVAGGSVGSLI--RMYGRFDDQLIRHL 1146

Query: 140  MSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFI 199
               V +G+A +H     ++HRD+K +N+L+  +G  KI DFG +              + 
Sbjct: 1147 TKQVLEGLAYLH--SKGILHRDMKADNLLLDNDGVCKISDFGISRK--------SNNIYS 1196

Query: 200  HHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPF 248
            + D+ +  T  + +PEM+D   GY    K DIW+LG  + ++     P+
Sbjct: 1197 NSDMTMRGTVFWMAPEMVDTAHGY--SAKVDIWSLGCVVLEMFAGKRPW 1243

>NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa]
           {ON} Anc_1.24
          Length = 489

 Score = 84.0 bits (206), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 64/216 (29%), Positives = 109/216 (50%), Gaps = 25/216 (11%)

Query: 86  YIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQ 145
           YI +YI +  +       +  ++++MEYC  G   D +       L E ++  I  +V +
Sbjct: 78  YITNYITTMLE-------DVSMWIVMEYCGGGSCSDLIRYHYNEGLHEDKVAFITKNVLR 130

Query: 146 GVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMI 205
           G+  +H  +   IHRD+K  NVL++++G  K+ DFG +   LR   T +   F+      
Sbjct: 131 GLQYLH--EQRKIHRDVKAANVLLTDDGLVKLADFGVS-GQLR--STAKRNTFV------ 179

Query: 206 NTTAQYRSPEMIDKYS-GYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAIL-NV--KF 261
             T  + +PE+I   S GY  +EK+DIW+LG+ +Y+L     P+ K     ++ N+  K 
Sbjct: 180 -GTPYWMAPEIISNSSHGY--NEKADIWSLGITVYELLKGCPPYAKYDAGKVMRNIPKKN 236

Query: 262 QFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQ 297
                  +SD  +  I+  L KDP +RP   ++L+Q
Sbjct: 237 LQDCMVSFSDAAKLFISACLIKDPDERPTATELLQQ 272

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score = 85.1 bits (209), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 66/224 (29%), Positives = 110/224 (49%), Gaps = 29/224 (12%)

Query: 99  ELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLI 158
           E+ + + E++L++EY   G + D+L ++   +L E E +   + + QGV+  H     + 
Sbjct: 193 EVWENKSELYLVLEYVDGGELFDYLVSK--GKLSEPEAVHYFTQIIQGVSYCHSFN--IC 248

Query: 159 HRDIKIENVLI-SENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI 217
           HRD+K EN+L+  +N   KI DFG A   L P K  + +    H         Y SPE++
Sbjct: 249 HRDLKPENLLLDKKNKVIKIADFGMAALEL-PNKLLETSCGSPH---------YASPEIV 298

Query: 218 --DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEG-ENAILNV---KFQFPSYPQYSD 271
               Y G P    SD+W+ G+ L+ L     PF  +  +  +L V   +FQ P Y   ++
Sbjct: 299 MGKPYHGGP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQAGRFQLPPY--LTN 352

Query: 272 HIRNIITIMLNKDPIKRPNICQVLEQ--VSKLQGVPCPIENFML 313
             +++IT +L  +P KR  I ++L    + K +  P  I    L
Sbjct: 353 DAKDLITRILVTNPEKRLTINEILNHPLIKKYRNPPAHIRKLNL 396

>KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa]
           {ON} weakly similar to uniprot|P34244 Saccharomyces
           cerevisiae YKL101W HSL1 Nim1p-related protein kinase
           that regulates the morphogenesis and septin checkpoints
           associates with the assembled septin filament required
           along with Hsl7p for bud neck recruitment
           phosphorylation and degradation of Swe1p
          Length = 1267

 Score = 85.1 bits (209), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 74/261 (28%), Positives = 124/261 (47%), Gaps = 49/261 (18%)

Query: 99  ELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLI 158
           E+ + + E++L++EY   G + D+L ++   +L E E +     + Q VA  H     + 
Sbjct: 141 EVWENKSELYLVLEYVEGGELFDYLVSK--GKLPESEAIHYFKQIVQAVAYCHGFN--IC 196

Query: 159 HRDIKIENVLISENG-DYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTA---QYRSP 214
           HRD+K EN+L+ +     KI DFG A             A    D ++ T+     Y SP
Sbjct: 197 HRDLKPENLLLDKKKRSIKIADFGMA-------------ALETSDKLLETSCGSPHYASP 243

Query: 215 EMI--DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAIL----NVKFQFPSYPQ 268
           E++   KY G P    SD+W+ G+ L+ L     PF  +    +L    + K+Q P +  
Sbjct: 244 EIVLGRKYHGSP----SDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQW-- 297

Query: 269 YSDHIRNIITIMLNKDPIKRPNICQVLEQVSKLQGVPCPIENFMLTRIKLQNSRNNSNKS 328
            S   +++I+ +L  DP +R  I Q+L+               +LT+   Q SR+ SN  
Sbjct: 298 LSVEAKDLISRILVVDPNRRITIDQILQHE-------------LLTKYD-QKSRSKSNSD 343

Query: 329 TSLNDTTNN--SFNNELALDQ 347
            +L + T N  SF++E  +D+
Sbjct: 344 LNLLNRTPNIVSFSSERDIDE 364

>KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8.279
           YLR096W
          Length = 1095

 Score = 84.7 bits (208), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 66/214 (30%), Positives = 112/214 (52%), Gaps = 26/214 (12%)

Query: 108 FLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVA-AMHYLQPP-LIHRDIKIE 165
           ++L EY S G ++D++    +  L+E    K      +GVA A+ YL    ++HRD+KIE
Sbjct: 201 YMLFEYVSGGQLLDYIIQ--HGSLREHHARKF----ARGVASALQYLHANNIVHRDLKIE 254

Query: 166 NVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPI 225
           N++IS +G+ KI DFG   +V    K  Q   F         +  + +PE++ K + Y I
Sbjct: 255 NIMISTSGEIKIIDFG-LSNVFDTRK--QLHTFC-------GSLYFAAPELL-KANPY-I 302

Query: 226 DEKSDIWALGVFLYKLCYYTTPFEKEGENA----ILNVKFQFPSYPQYSDHIRNIITIML 281
             + DIW+ GV LY L     PF+ E  +     I   K ++P++   S  + ++++ ML
Sbjct: 303 GPEVDIWSFGVVLYVLVCGKVPFDDENSSVLHEKIKQGKVEYPNH--LSIEVISLLSKML 360

Query: 282 NKDPIKRPNICQVLEQVSKLQGVPCPIENFMLTR 315
             DP+KR N+ +V+E    ++G   P  +++  R
Sbjct: 361 VVDPLKRANLTKVIEHPWMIRGYDFPPPSYLPKR 394

>KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1229

 Score = 84.7 bits (208), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 61/192 (31%), Positives = 88/192 (45%), Gaps = 22/192 (11%)

Query: 108  FLLMEYCSRGGVIDFLN-TRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIEN 166
            +L  E     G ID  +   L   + EFE   +   V  G+  +H     ++HRDIK EN
Sbjct: 1051 YLETEMHGETGSIDLFDLIELKTNMTEFEAKLLFKQVASGIKHLH--DNGIVHRDIKDEN 1108

Query: 167  VLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYSGYP 224
            V++   G  K+ DFGSA  V   P           D+ + T   Y +PE++  + Y G P
Sbjct: 1109 VIVDNKGFVKLIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGEPYEGKP 1157

Query: 225  IDEKSDIWALGVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKD 284
                 DIWA+GV LY + Y   PF    E  IL+   +  S  + S     +I  +LN+ 
Sbjct: 1158 ----QDIWAIGVLLYTIIYKENPFYNIDE--ILDGDLRIQSTHEVSAECVALIRKILNRS 1211

Query: 285  PIKRPNICQVLE 296
              KRP I  ++E
Sbjct: 1212 VSKRPTIDDIME 1223

>KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1095

 Score = 84.7 bits (208), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 126/274 (45%), Gaps = 32/274 (11%)

Query: 28  LACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNKYI 87
           L  G ++ V     IDS   + +       K  ++  K  +  +  E +A++ +  +K I
Sbjct: 185 LGDGAYSTVMLATSIDS---KKQYAVKVLNKEYLIKQKK-VKYVNIEKNALQRINNSKMI 240

Query: 88  VSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLN-TRLYHRLQEFEILKIMSDVCQG 146
           V    +        Q E  ++ L+EYC  G   DFL+  + Y  L E       + V   
Sbjct: 241 VKLFFTF-------QDESSLYFLLEYCPNG---DFLSLMKKYGSLNETVACYYSAQVIDA 290

Query: 147 VAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMIN 206
           +  +H     +IHRDIK EN+L+ +    K+ DFG+A   +    T  +   +       
Sbjct: 291 IDYLH--TNGIIHRDIKPENILLDKEFKIKLTDFGTA--KILDSSTNNKFDLLTRSKSFV 346

Query: 207 TTAQYRSPEMI-DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE----NAILNVKF 261
            TA+Y +PE++ D +    +D + D+WA G  LY++     PF+   E      ++ V++
Sbjct: 347 GTAEYVAPELLNDSF----VDYRCDVWAFGCILYQMIAGKPPFKATNEYLTFQKVMKVQY 402

Query: 262 QFPS-YPQYSDHIRNIITIMLNKDPIKRPNICQV 294
            F + +P     IR+++  +L KD  +RP+I Q+
Sbjct: 403 AFTAGFPLI---IRDLVKKILVKDLNQRPSISQI 433

>YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}
           PKH1Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis; activates Ypk1p and Ykr2p, components of
           signaling cascade required for maintenance of cell wall
           integrity; redundant with Pkh2p
          Length = 766

 Score = 84.3 bits (207), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 102/205 (49%), Gaps = 25/205 (12%)

Query: 102 QGEYEVFLLMEYCSRGGVIDFLN-TRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHR 160
           Q E  ++ L+EY   G   DFL   + Y  L E       S +   V ++H +   +IHR
Sbjct: 194 QDEASLYFLLEYAPHG---DFLGLIKKYGSLNETCARYYASQIIDAVDSLHNIG--IIHR 248

Query: 161 DIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINT-----TAQYRSPE 215
           DIK EN+L+ +N   K+ DFG+A  +   P    +    + D+   +     TA+Y SPE
Sbjct: 249 DIKPENILLDKNMKVKLTDFGTAKILPEEPSNTADGK-PYFDLYAKSKSFVGTAEYVSPE 307

Query: 216 MI-DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE----NAILNVKFQFPS-YPQY 269
           ++ D Y+    D + DIWA G  LY++     PF+   E      ++ +++ F + +PQ 
Sbjct: 308 LLNDNYT----DSRCDIWAFGCILYQMLAGKPPFKAANEYLTFQKVMKIQYAFTAGFPQI 363

Query: 270 SDHIRNIITIMLNKDPIKRPNICQV 294
              +++++  +L +DP  R  I Q+
Sbjct: 364 ---VKDLVKKLLVRDPNDRLTIKQI 385

>KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 993

 Score = 84.3 bits (207), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 102/200 (51%), Gaps = 20/200 (10%)

Query: 102 QGEYEVFLLMEYCSRGGVIDFLNT-RLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHR 160
           Q E  ++ L+EY   G   DFL+  + Y  L +   +   + +   +  +H  Q  +IHR
Sbjct: 232 QDEASLYFLLEYAPNG---DFLSVIKKYGSLNQDCSVYYSAQILDAIDYLH--QKGVIHR 286

Query: 161 DIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI-DK 219
           DIK EN+L+ ++   K+ DFG+A  ++   +T Q    +        TA+Y SPE++ D 
Sbjct: 287 DIKPENILLDKDMKVKLTDFGTA-KLVEKDETTQTYNLLERSKSFVGTAEYVSPELLNDN 345

Query: 220 YSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE----NAILNVKFQFPS-YPQYSDHIR 274
           Y    +D K DIWA G  L+++     PF+   E      ++ V++ F + +P     IR
Sbjct: 346 Y----VDYKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLI---IR 398

Query: 275 NIITIMLNKDPIKRPNICQV 294
           ++I  +L K+P +R +  QV
Sbjct: 399 DLIKQILVKNPEQRLDTLQV 418

>Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}
           similar to Ashbya gossypii AFL143C
          Length = 363

 Score = 81.6 bits (200), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 78/328 (23%), Positives = 131/328 (39%), Gaps = 65/328 (19%)

Query: 31  GGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNK-YIVS 89
           G    +Y V+    S++    G +  LK+V  P        RA  +     + N  YI +
Sbjct: 40  GELTALYQVKCPKRSHS----GGVYALKKVTCPIGRADFVTRAMTEISNYQRFNSPYITN 95

Query: 90  YIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYH--RLQEFEILKIMSDVCQGV 147
            +D   Q ++   G   +++L+ Y   G + D +N  +     L E  ++++M D+C+GV
Sbjct: 96  ILD--FQVAQHDNGTKIIYMLLPYFPAGSLQDLINNMIIRGDSLSESRVVRLMLDICRGV 153

Query: 148 AAMH-------------------------------------YLQPPL--------IHRDI 162
             MH                                      L PPL        +H  +
Sbjct: 154 RCMHEPSESDFRDPYDVAYFDAASLRYSDETHLLVDAMELDLLSPPLTNSEPSAYVHCGL 213

Query: 163 KIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMIN--TTAQYRSPEMIDKY 220
             EN+++S  G   I  +  A  V  P +    +  +     +N  +   Y  PE++D +
Sbjct: 214 NPENIMLSSEGLPVI--YNMASCVRAPLELTSNSKLLGLQEWLNENSCLPYTCPELLDLH 271

Query: 221 SGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE-------NAILNVKFQFPSYPQYSDHI 273
               I  + DIW+LG   Y L Y  + F +E +       ++I    F FP  P+YS  +
Sbjct: 272 PNTSITNRCDIWSLGCICYALMYSISSFAREQQLCGTPIKHSISTGNFSFPDEPRYSQSL 331

Query: 274 RNIITIMLNKDPIKRPNICQVLEQVSKL 301
           + I+   L  DP KRP+I + L Q  +L
Sbjct: 332 KRIVQRCLVIDPHKRPDIYETLAQFQEL 359

>CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507c GIN4
          Length = 1103

 Score = 84.3 bits (207), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 100/201 (49%), Gaps = 30/201 (14%)

Query: 106 EVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIE 165
           +++L++EY  +G + + L  R    L E E ++    +  G++  H L   ++HRD+K E
Sbjct: 103 DLYLVLEYAEKGELFNMLVER--GPLPENEAVRAFRQIIIGISYCHSLG--VVHRDLKPE 158

Query: 166 NVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTA---QYRSPEMIDKYSG 222
           N+L+    + KI DFG              AA    D ++ T+     Y +PE+I   SG
Sbjct: 159 NLLLDNKLNIKIADFGM-------------AALESEDKLLETSCGSPHYAAPEII---SG 202

Query: 223 YPIDE-KSDIWALGVFLYKLCYYTTPFEKEG---ENAILNVK---FQFPSYPQYSDHIRN 275
            P +   SD+W+ GV L+ L     PF++E     N +L V+   F+ P   + +   ++
Sbjct: 203 LPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDDEITKEAQD 262

Query: 276 IITIMLNKDPIKRPNICQVLE 296
           ++  +L  DP KR  I ++L+
Sbjct: 263 LLARLLTVDPSKRITIREILK 283

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score = 84.0 bits (206), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 76/261 (29%), Positives = 121/261 (46%), Gaps = 47/261 (18%)

Query: 50  ELGTMACLKRVIVPDKSGLNT------LRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQG 103
           E G +A +K  IVP      T      +  E+  MKL+     +  Y        E+ + 
Sbjct: 79  ETGKLAAIK--IVPKTKSSRTGSLPYGIEREIIIMKLISHPNVMGLY--------EVWEN 128

Query: 104 EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIK 163
           + E+FL++EY   G + D+L +R   RL E E +     + +G A  H     + HRD+K
Sbjct: 129 KLELFLVLEYVDGGELFDYLVSR--GRLPEKEAIHYFRQIIEGTAYCHGFN--ICHRDLK 184

Query: 164 IENVLI-SENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTA---QYRSPEMI-- 217
            EN+L+  +N   KI DFG              AA    + ++ T+     Y SPE++  
Sbjct: 185 PENLLLDKKNKRIKIADFGM-------------AALQTSNKLLETSCGSPHYASPEIVMG 231

Query: 218 DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILNVKFQFPSY--PQ-YSDHIR 274
             Y+G P    SD+W+ G+ L+ L     PF  +    +L +K Q   Y  PQ  S   +
Sbjct: 232 KNYNGGP----SDVWSCGIILFALLTGHLPFNDDNIKRLL-LKVQAGKYQMPQSVSSGAQ 286

Query: 275 NIITIMLNKDPIKRPNICQVL 295
           ++I+ +L  DP KR +I ++L
Sbjct: 287 DLISRILVVDPDKRISINEIL 307

>TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1315

 Score = 84.0 bits (206), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 66/218 (30%), Positives = 111/218 (50%), Gaps = 28/218 (12%)

Query: 108 FLLMEYCSRGGVIDFLNTRLYH-RLQEFEILKIMSDVCQGVA-AMHYLQPP-LIHRDIKI 164
           ++L EY S G ++D++   + H  L+E    K      +G+A A+ YL    ++HRD+KI
Sbjct: 283 YMLFEYVSGGQLLDYI---IQHGSLREHHARKF----ARGIASALQYLHSNNIVHRDLKI 335

Query: 165 ENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDK--YSG 222
           EN++IS +G+ KI DFG +        T Q   F         +  + +PE++    Y+G
Sbjct: 336 ENIMISTSGEIKIIDFGLSNLY---DTTRQLHTFC-------GSLYFAAPELLKAHPYTG 385

Query: 223 YPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAIL-NVKFQFPSYPQY-SDHIRNIITIM 280
             +    D+W+ GV LY L     PF+ E  + +   +K     YPQ+ S  + ++++ M
Sbjct: 386 PEV----DVWSFGVVLYVLVCGKVPFDDENSSVLHEKIKQGKVDYPQHLSIEVISLLSKM 441

Query: 281 LNKDPIKRPNICQVLEQVSKLQGVPCPIENFMLTRIKL 318
           L  DP KR  + QV+E    ++G   P  +++  RI L
Sbjct: 442 LVVDPKKRATLRQVVEHHWMVRGYDNPSSSYLPNRIPL 479

>NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_1.271
          Length = 1555

 Score = 84.0 bits (206), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 78/284 (27%), Positives = 126/284 (44%), Gaps = 45/284 (15%)

Query: 28   LACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSG--------LNTLRAEVDAMK 79
            +  G F  VY    + +       G M  +K+V VP  S         ++ +++EV  +K
Sbjct: 1260 IGKGSFGAVYLCLNVTT-------GEMMAVKQVEVPKYSSQDEAIMSTVDAIKSEVSTLK 1312

Query: 80   LLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKI 139
             L  +  IV Y+       E K   Y +FL  EY + G V   +  R+Y R  E  I  +
Sbjct: 1313 DL-DHLNIVQYLGF-----ENKDNIYSLFL--EYVAGGSVGSLI--RIYGRFDEPLIRHL 1362

Query: 140  MSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFI 199
               V +G+A +H     ++HRD+K +N+L+ ++G  KI DFG    + R  K      + 
Sbjct: 1363 NIQVLRGLAYLHARG--ILHRDMKADNLLLDQDGVCKISDFG----ISRKSKD----IYS 1412

Query: 200  HHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEK-EGENAILN 258
            + D+ +  T  + +PEM+D   GY    K DIW+LG  + ++     P+   E   A+  
Sbjct: 1413 NSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIVLEMFAGKRPWSNFEVVAAMFK 1470

Query: 259  V---KFQFP----SYPQYSDHIRNIITIMLNKDPIKRPNICQVL 295
            +   K   P    + P  S   R  +      DP KRP   ++L
Sbjct: 1471 IGKSKSAPPIPEDTLPLISAEGREFLDACFEIDPDKRPTADELL 1514

>KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5.406
           YHR102W
          Length = 1008

 Score = 83.6 bits (205), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 70/261 (26%), Positives = 121/261 (46%), Gaps = 29/261 (11%)

Query: 64  DKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFL 123
           D+  +  ++ E+  +  LK    I  Y  S+ + + L       +++MEYC  G +   L
Sbjct: 71  DEDEVEDVQKEIQFLASLKQLPNITRYYGSYLKNTSL-------WIIMEYCGGGSLRSLL 123

Query: 124 NTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSA 183
                 ++ E  I  IM ++   +  +H  +  +IHRDIK  NVLI+ +G  K+CDFG A
Sbjct: 124 RP---GKIDEKYIGVIMREILIALKYIH--KDNVIHRDIKAANVLINNDGSIKLCDFGVA 178

Query: 184 CSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCY 243
             + +     Q  A          T  + +PE+I    G   D K+DIW+ G+  Y++  
Sbjct: 179 AQLNQTKSRRQTMA---------GTPYWMAPEVI--MEGVYYDTKADIWSTGITAYEVTT 227

Query: 244 YTTPF-EKEGENAI-LNVKFQFPSYP--QYSDHIRNIITIMLNKDPIKRPNICQVLEQ-- 297
              P+ + E   A+ L  K + P      YS  I+  I   L++DP +RP   ++L+   
Sbjct: 228 GNPPYCDVEALRAMQLIAKSKPPRLEGRNYSALIKEFIATCLDEDPSERPTADELLKTAF 287

Query: 298 VSKLQGVPCPIENFMLTRIKL 318
           +   + +P  I   +++R  L
Sbjct: 288 IKTYKPLPTSILKELISRYLL 308

>Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W
           (REAL)
          Length = 1076

 Score = 83.6 bits (205), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 66/229 (28%), Positives = 107/229 (46%), Gaps = 27/229 (11%)

Query: 64  DKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFL 123
           D   +  ++ E+  +  LK    I  Y  S+ + + L       ++LMEYC+ G +   L
Sbjct: 59  DSDEVEDVQREIQFLASLKQMPNITRYYGSYLKDTSL-------WILMEYCAGGSLRSLL 111

Query: 124 NTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSA 183
                 ++ E  I  IM ++   +  +H  +  +IHRDIK  NVLI+  G  K+CDFG A
Sbjct: 112 RP---GKIDEKYIGVIMRELLVALKCIH--KDNVIHRDIKAANVLITNEGSVKLCDFGVA 166

Query: 184 CSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCY 243
             V +     Q  A          T  + +PE+I    G   D K DIW+LG+  Y++  
Sbjct: 167 AQVNQTSLRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEIAT 215

Query: 244 YTTPF-EKEGENAI-LNVKFQFPSYP--QYSDHIRNIITIMLNKDPIKR 288
              P+ + E   A+ L +K + P      YS  ++  I + L++DP +R
Sbjct: 216 GNPPYCDVEALRAMQLIIKSKPPRLEGRSYSSSLKEFIALCLDEDPKER 264

>CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096w KIN2 ser/thr protein kinase
          Length = 1192

 Score = 83.6 bits (205), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 65/217 (29%), Positives = 111/217 (51%), Gaps = 26/217 (11%)

Query: 108 FLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVA-AMHYLQPP-LIHRDIKIE 165
           ++L EY + G ++D++    +  L+E    K      +GVA A+ YL    ++HRD+KIE
Sbjct: 208 YMLFEYVAGGQLLDYIIQ--HGSLREHHARKF----ARGVASALQYLHANNIVHRDLKIE 261

Query: 166 NVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDK--YSGY 223
           N++IS +G+ KI DFG   +V    K  Q   F         +  + +PE++    Y+G 
Sbjct: 262 NIMISNSGEIKIIDFG-LSNVYDTRK--QLHTFC-------GSLYFAAPELLKAHPYTGP 311

Query: 224 PIDEKSDIWALGVFLYKLCYYTTPFEKEGENAIL-NVKFQFPSYPQY-SDHIRNIITIML 281
            +    D+W+ GV LY L     PF+ E  + +   +K     YPQ+ S  + ++++ ML
Sbjct: 312 EV----DVWSFGVVLYVLVCGKVPFDDENSSVLHEKIKRGKVEYPQHLSIEVMSLLSKML 367

Query: 282 NKDPIKRPNICQVLEQVSKLQGVPCPIENFMLTRIKL 318
             DP +R ++ QV+E     +G   P  +++  RI L
Sbjct: 368 VVDPSRRASLKQVVEHPWMTKGYDTPAPSYVPNRIPL 404

>KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1223

 Score = 83.6 bits (205), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 58/180 (32%), Positives = 86/180 (47%), Gaps = 22/180 (12%)

Query: 118  GVIDFLN-TRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYK 176
            G +D  +   L   + E E   I   +  G+  +H     ++HRDIK ENV++  NG  K
Sbjct: 1055 GSVDLFDLIELKTDMTEHEAKLIFKQIVSGIKHLH--DNGIVHRDIKDENVIVDSNGFVK 1112

Query: 177  ICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYSGYPIDEKSDIWAL 234
            I DFGSA  V   P           D+ + T   Y +PE++  + Y G P     DIWA+
Sbjct: 1113 IIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGEPYEGKP----QDIWAI 1157

Query: 235  GVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQV 294
            GV LY + +   PF    E  IL+   +  S  + SD    +I  +LN+   KRP+I ++
Sbjct: 1158 GVLLYTIIFKENPFYNIDE--ILDADLRVDSNHRVSDECIALIRKILNRPISKRPSISKI 1215

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score = 83.6 bits (205), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 62/203 (30%), Positives = 102/203 (50%), Gaps = 31/203 (15%)

Query: 104 EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEF-EILKIMSDVCQGVAAMHYLQPPLIHRDI 162
           E +V++ +EYC    + D L +     L E  E+   +S       +MH      +HRD+
Sbjct: 104 ESKVWMALEYCPGKELYDHLLSLRRLSLLECGELFAQISGAVYYAHSMH-----CVHRDL 158

Query: 163 KIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDK--Y 220
           K+EN+L+  NG+ K+ DFG     +   KT  E         +  T  Y +PE+I++  Y
Sbjct: 159 KLENILLDRNGNAKLTDFGFTRECM--TKTTLET--------VCGTTVYMAPELIERKTY 208

Query: 221 SGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILNVKFQFPS-YPQYS-----DHIR 274
            G+ I    DIW+LGV LY L     PF+ + E   +  K++  +  P+Y      D  +
Sbjct: 209 DGFKI----DIWSLGVILYTLITGYLPFDDDDE---VKTKWKIVNEEPKYDSKFIPDDAK 261

Query: 275 NIITIMLNKDPIKRPNICQVLEQ 297
           ++I+ +L K+P +RP++ QVL  
Sbjct: 262 DLISRLLAKNPGERPSLPQVLRH 284

>Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W
           (REAL)
          Length = 716

 Score = 83.2 bits (204), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 70/277 (25%), Positives = 125/277 (45%), Gaps = 32/277 (11%)

Query: 26  KYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKGNK 85
           + L  G   +VY VR  D+    N++  +  L +  +  +  +  +  E + +     + 
Sbjct: 324 RLLGQGDVGKVYLVRERDT----NQIFALKVLSKHEMIKRKKIKRVLTEQEILAT-SDHP 378

Query: 86  YIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQ 145
           +IV+   S        Q E  ++L MEYC  G     L TR   R+ E +     S+V  
Sbjct: 379 FIVTLYHSF-------QTEDFLYLCMEYCMGGEFFRALQTRKSKRITEEDAKFYASEVVA 431

Query: 146 GVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVL--RPPKTPQEAAFIHHDI 203
            +  +H L    I+RD+K EN+L+ ++G   + DF  +      R P T +++ ++   +
Sbjct: 432 ALEYLHLLG--FIYRDLKPENILLHQSGHVMLSDFDLSIQATGSRDP-TMKDSTYLDTKV 488

Query: 204 MINT--------TAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGEN- 254
             +         T +Y +PE+I    G       D W LG+ +Y++ +  TPF+ +  N 
Sbjct: 489 CSDGFRTNSFVGTEEYLAPEVI---RGNGHTAAVDWWTLGILVYEMLFGCTPFKGDNSNE 545

Query: 255 ---AILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKR 288
               IL    +FP   + S H +++I  +LNK+  KR
Sbjct: 546 TFSKILTEDVKFPHDKEISKHCKDLIKRLLNKNESKR 582

>SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1062

 Score = 83.6 bits (205), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 60/213 (28%), Positives = 105/213 (49%), Gaps = 18/213 (8%)

Query: 108 FLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENV 167
           ++L EY S G ++D++    +  L+E    K    +   +  +H     ++HRD+KIEN+
Sbjct: 179 YMLFEYVSGGQLLDYIIQ--HGSLRERHARKFARGIASALQYLHMNN--IVHRDLKIENI 234

Query: 168 LISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDE 227
           +IS +G+ KI DFG   S +  PK  Q   F         +  + +PE++  +    I  
Sbjct: 235 MISTSGEIKIIDFG--LSNMYDPKK-QLHTFC-------GSLYFAAPELLKAHPY--IGP 282

Query: 228 KSDIWALGVFLYKLCYYTTPFEKEGENAIL-NVKFQFPSYPQY-SDHIRNIITIMLNKDP 285
           + D+W+ GV LY L     PF+ E  + +   +K     YPQ+ S  + ++++ ML  DP
Sbjct: 283 EVDVWSFGVVLYVLVCGKVPFDDENASVLHEKIKQGKVEYPQHLSIEVISLLSKMLVVDP 342

Query: 286 IKRPNICQVLEQVSKLQGVPCPIENFMLTRIKL 318
            KR  + QV+      +G   P  +++  R+ L
Sbjct: 343 SKRATLKQVVSHQWMQRGYDFPAPSYLPYRVPL 375

>TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1.24
           YDR523C
          Length = 516

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 74/273 (27%), Positives = 131/273 (47%), Gaps = 34/273 (12%)

Query: 23  IIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV-IVPDKSGLNTLRAEVDAMKLL 81
           ++EK +  G F  VY    I S       G +  +K V +      +  L  E+  +  L
Sbjct: 16  LMEKCVGRGNFGDVYKAVEIKS-------GKIVAIKVVNLEHTNEDIELLSQEIFFLAEL 68

Query: 82  KGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMS 141
           + + Y+  Y+ +  +       +  ++++MEYC  G   D +       L E +   I  
Sbjct: 69  R-SPYVTKYLTTLLE-------DVSIWIVMEYCGGGSCADLIKYAYKRGLPENKASFITK 120

Query: 142 DVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHH 201
           +V +G+  +H  +   IHRDIK  N+L++++G  K+ DFG +  +          A +  
Sbjct: 121 EVLKGLRYLH--EQKKIHRDIKAANILLTDDGMVKLGDFGVSGQI---------KATLKK 169

Query: 202 DIMINTTAQYRSPEMIDK-YSGYPIDEKSDIWALGVFLYKLCYYTTPFEK-EGENAILNV 259
           D  +  T  + +PE++ K  SGY  +EK+DIW+LG+ +Y+L     P  K +    +++V
Sbjct: 170 DTFVG-TPYWMAPEVVKKDESGY--NEKADIWSLGITVYELLKGCPPLAKYDPMKVMISV 226

Query: 260 -KFQFPS-YPQYSDHIRNIITIMLNKDPIKRPN 290
            K + P  +  YS+  ++ I+  L KDP  RPN
Sbjct: 227 PKRRAPKLHGHYSEDAKSFISHCLIKDPNARPN 259

>TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8.279
           YLR096W
          Length = 1126

 Score = 83.2 bits (204), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 64/217 (29%), Positives = 112/217 (51%), Gaps = 26/217 (11%)

Query: 108 FLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVA-AMHYLQPP-LIHRDIKIE 165
           ++L EY S G ++D++    +  L+E    K      +G+A A+ YL    ++HRD+KIE
Sbjct: 178 YMLFEYVSGGQLLDYIIQ--HGSLREHHARKF----TRGIASALQYLHANNIVHRDLKIE 231

Query: 166 NVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDK--YSGY 223
           N++IS +G+ KI DFG +       K+ Q   F         +  + +PE++    Y+G 
Sbjct: 232 NIMISTSGEIKIIDFGLSNLF---DKSKQLHTFC-------GSLYFAAPELLKASPYTGP 281

Query: 224 PIDEKSDIWALGVFLYKLCYYTTPFEKEGENAIL-NVKFQFPSYPQY-SDHIRNIITIML 281
            +    D+W+ GV LY L     PF+ E  + +   +K     YPQ+ S  + ++++ ML
Sbjct: 282 EV----DVWSFGVVLYVLVCGKVPFDDENSSVLHEKIKQGKVEYPQHLSIEVISLLSKML 337

Query: 282 NKDPIKRPNICQVLEQVSKLQGVPCPIENFMLTRIKL 318
             DP +R ++ QV+E    ++G   P  +++  RI L
Sbjct: 338 VVDPHRRASLKQVVEHHWMVRGYDGPPPSYVPNRIPL 374

>KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakly
           similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101W HSL1 Nim1p-related protein kinase that regulates
           the morphogenesis and septin checkpoints associates with
           the assembled septin filament required along with Hsl7p
           for bud neck recruitment phosphorylation and degradation
           of Swe1p
          Length = 1128

 Score = 83.2 bits (204), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 78/263 (29%), Positives = 121/263 (46%), Gaps = 44/263 (16%)

Query: 47  ARN-ELGTMACLKRVIVPDKSGLNTL----RAEVDAMKLLKGNKYIVSYIDSHAQRSELK 101
           A+N E G +A +K V     S  N L      E+  MKL+     +  Y        E+ 
Sbjct: 75  AKNMETGKLAAVKIVPKTKSSRPNALPYGIEREIIIMKLISHPNVMGLY--------EVW 126

Query: 102 QGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRD 161
           + + E+FL++EY   G + D+L +R   RL E E +     + +G A  H     + HRD
Sbjct: 127 ENKLELFLVLEYVDGGELFDYLVSR--GRLSEKEAIHYFRQIIEGTAYCHSFN--ICHRD 182

Query: 162 IKIENVLI-SENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTA---QYRSPEMI 217
           +K EN+L+  +N   KI DFG              AA    + ++ T+     Y SPE++
Sbjct: 183 LKPENLLLDKKNKRIKIADFGM-------------AALQTSNKLLETSCGSPHYASPEIV 229

Query: 218 --DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILNVKFQFPSY--PQ-YSDH 272
               Y+G P    SD+W+ G+ L+ L     PF  +    +L +K Q   Y  PQ  S  
Sbjct: 230 MGKTYNGGP----SDVWSCGIILFALLTGHLPFNDDNIKRLL-LKVQAGKYQMPQAISLE 284

Query: 273 IRNIITIMLNKDPIKRPNICQVL 295
            +++I+ +L  DP KR  I  +L
Sbjct: 285 AQDLISRILVVDPNKRITINDIL 307

>Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa]
           {ON} YDR507C (REAL)
          Length = 1135

 Score = 83.2 bits (204), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 82/305 (26%), Positives = 139/305 (45%), Gaps = 49/305 (16%)

Query: 6   IPKYEKGRVLPIG-THQVIIEKYLACGGFAQVYSVRVIDSS--NARNELGTMACLKRVIV 62
           I  ++ G  L +G T +V + +  + G   Q  +V+VI  +  NA N  GT   +   I 
Sbjct: 16  IGPWKLGETLGLGSTGKVQLARNKSTG---QEAAVKVISKAVFNAGNMSGT--SIVGSIT 70

Query: 63  PDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDF 122
           PD       R E+  MKLL     +  Y        ++ +   +++L++EY  +G + + 
Sbjct: 71  PDALPYGIER-EIIIMKLLNHPNVLRLY--------DVWETNTDLYLVLEYAEKGELFNL 121

Query: 123 LNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGS 182
           L  R    L E E ++    +  GV+  H L   ++HRD+K EN+L+    + KI DFG 
Sbjct: 122 LVER--GPLPENEAIRFFRQIIIGVSYCHALG--IVHRDLKPENLLLDHKYNIKIADFGM 177

Query: 183 ACSVLRPPKTPQEAAFIHHDIMINTTA---QYRSPEMIDK--YSGYPIDEKSDIWALGVF 237
                        AA      ++ T+     Y +PE++    Y G+     SD+W+ GV 
Sbjct: 178 -------------AALETEGKLLETSCGSPHYAAPEIVSGIPYQGFA----SDVWSCGVI 220

Query: 238 LYKLCYYTTPFEKEGEN---AILNV---KFQFPSYPQYSDHIRNIITIMLNKDPIKRPNI 291
           L+ L     PF++E  N    +L V   +F+ PS  + S   +++I  +L  DP +R   
Sbjct: 221 LFALLTGRLPFDEEDGNIRTLLLKVQKGQFELPSDDEVSREAQDLICKILTVDPKRRIKA 280

Query: 292 CQVLE 296
             +L+
Sbjct: 281 RDILK 285

>Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W
           (REAL)
          Length = 1073

 Score = 83.2 bits (204), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 108/229 (47%), Gaps = 27/229 (11%)

Query: 64  DKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFL 123
           D   +  ++ E+  +  LK    I  Y  S+ + + L       +++MEYC+ G +   L
Sbjct: 59  DSDEVEDVQREIQFLASLKQISNITRYYGSYLKDTSL-------WIIMEYCAGGSLRSLL 111

Query: 124 NTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSA 183
                 ++ E  I  IM ++   +  +H  +  +IHRDIK  NVLI+  G+ K+CDFG A
Sbjct: 112 RP---GKIDEKYIGVIMRELLVALKCIH--KDNVIHRDIKAANVLITNEGNVKLCDFGVA 166

Query: 184 CSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCY 243
             V +     Q  A          T  + +PE+I    G   D K DIW+LG+  Y++  
Sbjct: 167 AQVNQTSLRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEIAT 215

Query: 244 YTTPF-EKEGENAI-LNVKFQFPSYP--QYSDHIRNIITIMLNKDPIKR 288
              P+ + E   A+ L +K + P      YS  ++  I + L++DP +R
Sbjct: 216 GNPPYCDVEALRAMQLIIKSKPPRLEGRSYSPSLKEFIALCLDEDPKER 264

>KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1117

 Score = 83.2 bits (204), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 98/202 (48%), Gaps = 32/202 (15%)

Query: 107 VFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIEN 166
           +++++EY  +G + + L  +    LQE E ++    +  G++  H L   ++HRD+K EN
Sbjct: 102 LYMVLEYAEKGELFNLLVEK--GPLQEQEAIRFFRQIIIGISYCHALG--IVHRDLKPEN 157

Query: 167 VLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTA---QYRSPEMIDK--YS 221
           +L+    + KI DFG              AA    D ++ T+     Y +PE++    Y 
Sbjct: 158 LLLDHKYNIKIADFGM-------------AALETEDKLLETSCGSPHYAAPEIVSGIPYH 204

Query: 222 GYPIDEKSDIWALGVFLYKLCYYTTPFEKEG---ENAILNVK---FQFPSYPQYSDHIRN 275
           G+     SD+W+ GV L+ L     PF++E     N +L V+   F+ PS  + S   ++
Sbjct: 205 GFA----SDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEISHEAQD 260

Query: 276 IITIMLNKDPIKRPNICQVLEQ 297
           ++  +L  DP KR     +L+ 
Sbjct: 261 LLAKILTVDPEKRIRARDILKH 282

>TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1057

 Score = 83.2 bits (204), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 99/201 (49%), Gaps = 21/201 (10%)

Query: 102 QGEYEVFLLMEYCSRGGVIDFLN-TRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHR 160
           Q E  ++ L+EY   G   DFL+  + Y  L E       + +   +  +H     ++HR
Sbjct: 236 QDESSLYFLLEYAPNG---DFLSIMKKYGSLNEDCACYYSAQIIDAIDFLH--SKGIVHR 290

Query: 161 DIKIENVLISENGDYKICDFGSACSVLRP-PKTPQEAAFIHHDIMINTTAQYRSPEMI-D 218
           DIK EN+L+ ++   K+ DFG+A  +L P P T      +        TA+Y SPE++ D
Sbjct: 291 DIKPENILLDKDFKVKLTDFGTA-KILEPKPNTTDSYDLLSRSKSFVGTAEYVSPELLND 349

Query: 219 KYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE----NAILNVKFQFPS-YPQYSDHI 273
            Y    +D + DIWA G  L+++     PF+   E      ++ V++ F + +P     +
Sbjct: 350 NY----VDYRCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLV---V 402

Query: 274 RNIITIMLNKDPIKRPNICQV 294
           R+++  +L K P +R  I Q+
Sbjct: 403 RDLVKGILIKQPAQRLTIPQI 423

>NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1411

 Score = 83.2 bits (204), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 75/278 (26%), Positives = 126/278 (45%), Gaps = 51/278 (18%)

Query: 25   EKYLACGGFAQVYSVRVIDSSNARN-ELGTMACLKRVI--VPDKSGLNTLRAEVDAMKLL 81
            EKY+ C     ++  R++  +  R+ +LGT+    +++  +  K   N LR     +   
Sbjct: 1173 EKYIVC--IKMIFKERILVDTWVRDRKLGTIPSEIQIMATLNKKPHENILRL----LDFF 1226

Query: 82   KGNKYIVSYIDS--HAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKI 139
            + + Y   YI++  H +      G  ++F L+E+ +               + EFE   I
Sbjct: 1227 EDDNYY--YIETPIHGE-----TGCIDLFDLIEFKTN--------------MTEFEAKLI 1265

Query: 140  MSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFI 199
               V  G+  +H+    ++HRDIK ENV++   G  KI DFGSA  V   P         
Sbjct: 1266 FKQVVSGIKHLHH--QGIVHRDIKDENVIVDSKGLVKIIDFGSAAYVKSGP--------- 1314

Query: 200  HHDIMINTTAQYRSPEMIDKYSGYPIDEK-SDIWALGVFLYKLCYYTTPFEKEGENAILN 258
              D+ + T   Y +PE++   SG P + K  DIWALG+ LY + +   PF    E  IL 
Sbjct: 1315 -FDVFVGTI-DYAAPEVL---SGEPYEGKPQDIWALGILLYTIVFKENPFYNIDE--ILE 1367

Query: 259  VKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLE 296
               +F S  + ++    +I  +L +    RP I ++ +
Sbjct: 1368 GDLKFDSNTEVTEDCMELIKKVLIRQVRNRPAIDEIFD 1405

>SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102W KIC1 Protein kinase of the PAK/Ste20 kinase
           family required for cell integrity possibly through
           regulating 1 6-beta-glucan levels in the wall physically
           interacts with Cdc31p (centrin) which is a component of
           the spindle pole body
          Length = 885

 Score = 82.8 bits (203), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 78/285 (27%), Positives = 132/285 (46%), Gaps = 31/285 (10%)

Query: 56  CLKRVIVPDKSG--LNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEY 113
           C  +V+  D S   +  ++ E+  +  LK    I  Y  S+   ++L       +++MEY
Sbjct: 52  CAIKVLNLDTSEDEVEDVQKEIQFLSSLKQVPNITHYYGSYLYDTKL-------WIIMEY 104

Query: 114 CSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENG 173
           C+ G +   L      ++ E  I  IM ++   VA ++  +  +IHRDIK  NVLI+ +G
Sbjct: 105 CAGGSLRTLLRP---GKIDEKYIGVIMRELL--VALLYIHKDNVIHRDIKAANVLITNDG 159

Query: 174 DYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWA 233
             K+CDFG A  + +     Q  A          T  + +PE+I    G   D K DIW+
Sbjct: 160 RVKLCDFGVAAQLTQSNVRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWS 208

Query: 234 LGVFLYKLCYYTTPF-EKEGENAI-LNVKFQFPSYP--QYSDHIRNIITIMLNKDPIKRP 289
           LG+  Y++     P+ + E   A+ L  K + P     QYS  ++  I + L++DP +R 
Sbjct: 209 LGITTYEITTGNPPYCDVEALRAMQLITKSKPPRLEGRQYSPLLKEFIALCLDEDPKERL 268

Query: 290 NICQVLEQ--VSKLQGVPCPIENFMLTRIKLQNSRNNSNKSTSLN 332
               +L+   +   +  P  I   ++TR  L   +N + +S   N
Sbjct: 269 AAEDLLKTRFIKTHKSSPTSILKELITRYLLHRDKNINRESAMAN 313

>ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q7LGU7 Saccharomyces cerevisiae YPL236C
           Hypothetical ORF
          Length = 369

 Score = 80.9 bits (198), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 84/334 (25%), Positives = 140/334 (41%), Gaps = 60/334 (17%)

Query: 15  LPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGT-MACLKRVIVP--DKSGLNTL 71
           L I   +  I+K L    F+ +Y V+ I S  A +   T +  LKR+  P  +   ++  
Sbjct: 26  LSINGRRYSIKKLLGESNFSFIYLVQQIGSVTASSTPRTNLYALKRIRCPFGNIESISGA 85

Query: 72  RAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHR- 130
             EVD  K  + + YI+  +DS  Q ++ + G   V++L+ Y   G + D  +  L +  
Sbjct: 86  MKEVDNYKRFQ-SPYIIHLVDS--QVAQQRDGSKTVYILLPYFPLGSLQDSTSRNLLNGT 142

Query: 131 -LQEFEILKIMSDVCQGVAAMH---------------------------YL--QPPL--- 157
            + E E ++I+  + +G+  +H                           +L    PL   
Sbjct: 143 FISEAECIRIVIGIARGLRCLHDPSARSQDAEQQQEHDAVSMSYSDEAAFLLEDTPLELD 202

Query: 158 -------------IHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIM 204
                         HRDIK  N+L S +G   I + GS         T  +   +   + 
Sbjct: 203 ILSSANTINSNFYAHRDIKPSNILFSSDGLPVISNLGSCSKADLSINTGMQLTELQAWVS 262

Query: 205 INTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE-------NAIL 257
            + T  Y +PE++       +D K DIW+LG   Y + +  +PFE+E +        AI 
Sbjct: 263 DHCTVAYTAPELLHITLNRSVDTKVDIWSLGCTCYFMLFGISPFEREEQISGASLKYAIG 322

Query: 258 NVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNI 291
              F FPS  +YS+ +  +IT  L  +P  RP+I
Sbjct: 323 TGNFSFPSQDRYSEGLLKLITKCLQVNPAARPDI 356

>Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}
           YGL179C (REAL)
          Length = 563

 Score = 82.0 bits (201), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 70/216 (32%), Positives = 104/216 (48%), Gaps = 36/216 (16%)

Query: 106 EVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILK------IMSDVCQGVAAMHYLQPPLIH 159
           +V+L++EYCSRG V      +L  +     IL       I+SDV  G+  +H     +IH
Sbjct: 130 KVYLVLEYCSRGPVKWCPENQLEIKAVGPPILSFQQARNIVSDVVSGLEYLH--SQGIIH 187

Query: 160 RDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIH--HDIMINT----TAQYRS 213
           RDIK  N+LIS NG  KI DFG   S+L    T  E+  I   H+ ++ +    T  + +
Sbjct: 188 RDIKPSNLLISSNGTVKISDFG--VSIL----TAAESTNIQSSHEPILKSKTFGTPAFFA 241

Query: 214 PEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEK----EGENAILNVKFQFPSYPQY 269
           PE+    +        DIW+LGV LY L + T PF      E  + I+N    FPSY + 
Sbjct: 242 PELCSTETYCCRSSAIDIWSLGVTLYCLLFGTLPFNANSGLELFDNIINKPLDFPSYEEI 301

Query: 270 SDHIRNIITI------------MLNKDPIKRPNICQ 293
             H  + +TI            +L K+P +R ++ +
Sbjct: 302 LKHDSSNVTIEEYRDAKDLLYKLLEKNPSRRISLAE 337

>NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON}
           Anc_2.479
          Length = 1461

 Score = 83.2 bits (204), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 70/234 (29%), Positives = 109/234 (46%), Gaps = 39/234 (16%)

Query: 71  LRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHR 130
           +  E+  MKL+     +  Y        E+ + + E++L++EY   G + D+L ++   +
Sbjct: 183 IEREIVIMKLISHPNVMALY--------EVWENKSELYLVLEYVDGGELFDYLVSK--GK 232

Query: 131 LQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLI-SENGDYKICDFGSACSVLRP 189
           L E E +     + QGV+  H     + HRD+K EN+L+  +N   KI DFG A   L P
Sbjct: 233 LSEKEAVHYFKQIIQGVSYCHSFN--ICHRDLKPENLLLDKKNKSIKIADFGMAALEL-P 289

Query: 190 PKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYSGYPIDEKSDIWALGVFLYKLCYYTTP 247
            K  Q +    H         Y SPE++    Y G P    SD+W+ G+ L+ L     P
Sbjct: 290 NKLLQTSCGSPH---------YASPEIVMGKSYHGGP----SDVWSCGIILFALLTGHLP 336

Query: 248 FEKEG-ENAILNV---KFQFPSY--PQYSDHIRNIITIMLNKDPIKRPNICQVL 295
           F  +  +  +L V   KF+ PS   P+  D I  I+ I    DP KR    ++L
Sbjct: 337 FNDDNIKKLLLKVQAGKFRMPSTLSPEAQDLISRILVI----DPSKRITTDRIL 386

>YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}
           HSL1Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints; associates with
           the assembled septin filament; required along with Hsl7p
           for bud neck recruitment, phosphorylation, and
           degradation of Swe1p
          Length = 1518

 Score = 83.2 bits (204), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 69/238 (28%), Positives = 116/238 (48%), Gaps = 33/238 (13%)

Query: 99  ELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLI 158
           E+ + + E++L++EY   G + D+L ++   +L E E +     + +GV+  H     + 
Sbjct: 181 EVWENKSELYLVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQIVEGVSYCHSFN--IC 236

Query: 159 HRDIKIENVLI-SENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI 217
           HRD+K EN+L+  +N   KI DFG A   L P K  + +    H         Y SPE++
Sbjct: 237 HRDLKPENLLLDKKNRRIKIADFGMAALEL-PNKLLKTSCGSPH---------YASPEIV 286

Query: 218 --DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAIL----NVKFQFPSYPQYSD 271
               Y G P    SD+W+ G+ L+ L     PF  +    +L    + K+Q PS    S 
Sbjct: 287 MGRPYHGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPS--NLSS 340

Query: 272 HIRNIITIMLNKDPIKRPNICQVLEQ--VSKLQGVPCPIENFMLTRIKLQN-SRNNSN 326
             R++I+ +L  DP KR    ++L+   + K   +P    N +L +++  N +R  SN
Sbjct: 341 EARDLISKILVIDPEKRITTQEILKHPLIKKYDDLPV---NKVLRKMRKDNMARGKSN 395

>NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON}
           Anc_5.591 YDR466W
          Length = 1117

 Score = 82.8 bits (203), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 113/237 (47%), Gaps = 40/237 (16%)

Query: 71  LRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHR 130
           +  E+  MKLL+ +  ++S  D     S L       ++++EY  +G + + L  +    
Sbjct: 81  IEREIIIMKLLR-HANVLSLYDVWETNSNL-------YMILEYAEKGELFNLLVEK--GP 130

Query: 131 LQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPP 190
           L E E ++    +  G++  H L   ++HRD+K EN+L+    + KI DFG         
Sbjct: 131 LPEKEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNIKIADFGM-------- 180

Query: 191 KTPQEAAFIHHDIMINTTA---QYRSPEMIDK--YSGYPIDEKSDIWALGVFLYKLCYYT 245
                AA    D ++ T+     Y +PE++    Y G+    +SD+W+ GV L+ L    
Sbjct: 181 -----AALETEDKLLETSCGSPHYAAPEIVSGIPYHGF----ESDVWSCGVILFALLTGR 231

Query: 246 TPFEKEG---ENAILNV---KFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLE 296
            PF++E     N +L V   +F+ P   + S   +++I+ +L  DP KR    ++L+
Sbjct: 232 LPFDEEDGNIRNLLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILK 288

>KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1.271
            YJL095W
          Length = 1580

 Score = 83.2 bits (204), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 66/230 (28%), Positives = 110/230 (47%), Gaps = 39/230 (16%)

Query: 28   LACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVP-----DKSGLNT---LRAEVDAMK 79
            +  G F  VY    + +       G M  +K+V VP     D++ L+T   LR+EV  +K
Sbjct: 1281 IGKGSFGAVYLCLNLTT-------GEMMAVKQVEVPKYSAQDQNILDTVEALRSEVSTLK 1333

Query: 80   LLKGNKYIVSYIDSHAQRSELKQGEYEVF-LLMEYCSRGGVIDFLNTRLYHRLQEFEILK 138
             L  +  IV Y+          + +++++ L +EY   G V   +  RLY R  E  I  
Sbjct: 1334 DLD-HLNIVQYLGF--------ENDHDIYSLFLEYVGGGSVGSLI--RLYGRFDEALIRF 1382

Query: 139  IMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAF 198
            +   V +G+A +H     ++HRD+K +N+L+  +G  KI DFG    + R  K      +
Sbjct: 1383 LTVQVLEGLAYLH--SKGILHRDMKADNLLLDLDGVCKISDFG----ISRKSKD----IY 1432

Query: 199  IHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPF 248
             + D+ +  T  + +PEM+D   GY    K DIW+LG  + ++     P+
Sbjct: 1433 SNSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKRPW 1480

>Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {ON}
           YDR490C (PKH1) - Ser/Thr protein kinase [contig 184]
           FULL
          Length = 984

 Score = 82.8 bits (203), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 57/200 (28%), Positives = 101/200 (50%), Gaps = 20/200 (10%)

Query: 102 QGEYEVFLLMEYCSRGGVIDFLNT-RLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHR 160
           Q E  ++ L+EY   G   DFL+  + +  L +   +   + +   +  +H+    ++HR
Sbjct: 227 QDEASLYFLLEYAPNG---DFLSVIKKFGSLSQECAVYYSAQILDAIDYLHHKG--IVHR 281

Query: 161 DIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI-DK 219
           DIK EN+L+ ++   K+ DFG+A  +L   +T Q    +        TA+Y SPE++ D 
Sbjct: 282 DIKPENILLDKDMKVKLTDFGTA-RILEKDETTQTFNLLERSKSFVGTAEYVSPELLNDN 340

Query: 220 YSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE----NAILNVKFQFPS-YPQYSDHIR 274
           Y    +D K DIWA G  L+++     PF+   E      ++ V++ F + +P     IR
Sbjct: 341 Y----VDYKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLV---IR 393

Query: 275 NIITIMLNKDPIKRPNICQV 294
           ++I  +L K P +R +  Q+
Sbjct: 394 DLIKKILVKSPEQRLDASQI 413

>YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Protein
           kinase of the PAK/Ste20 family, required for cell
           integrity; physically interacts with Cdc31p (centrin),
           which is a component of the spindle pole body; part of
           the RAM network that regulates cellular polarity and
           morphogenesis
          Length = 1080

 Score = 82.8 bits (203), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 78/321 (24%), Positives = 145/321 (45%), Gaps = 48/321 (14%)

Query: 9   YEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGL 68
           +++  V+  G   V+ + Y    G  +VY+++V++  +  +E+                 
Sbjct: 23  FKRTEVIGRGKFGVVYKGYNVKTG--RVYAIKVLNLDSDSDEV----------------- 63

Query: 69  NTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLY 128
             ++ E+  +  LK    I  Y  S+ + + L       +++ME+C+ G +   L     
Sbjct: 64  EDVQREIQFLASLKQISNITRYYGSYLKDTSL-------WIIMEHCAGGSLRSLLRP--- 113

Query: 129 HRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLR 188
            ++ E  I  IM ++   +  +H  +  +IHRDIK  NVLI+  G+ K+CDFG A  V +
Sbjct: 114 GKIDEKYIGVIMRELLVALKCIH--KDNVIHRDIKAANVLITNEGNVKLCDFGVAAQVNQ 171

Query: 189 PPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPF 248
                Q  A          T  + +PE+I    G   D K DIW+LG+  Y++     P+
Sbjct: 172 TSLRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEIATGNPPY 220

Query: 249 -EKEGENAI-LNVKFQFPSYP--QYSDHIRNIITIMLNKDPIKRPNICQVLEQ--VSKLQ 302
            + E   A+ L +K + P      YS  ++  I + L++DP +R +   +L+   +   +
Sbjct: 221 CDVEALRAMQLIIKSKPPRLEDRSYSTSLKEFIALCLDEDPKERLSADDLLKSKFIRAHK 280

Query: 303 GVPCPIENFMLTRIKLQNSRN 323
             P  I   +++R  L   +N
Sbjct: 281 ATPTSILKELISRYLLFRDKN 301

>KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {ON}
           Anc_5.406 YHR102W
          Length = 1027

 Score = 82.8 bits (203), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 72/279 (25%), Positives = 128/279 (45%), Gaps = 29/279 (10%)

Query: 64  DKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFL 123
           D+  +  ++ E+  +  LK    +  Y  S+ + + L       +++MEYC+ G +   L
Sbjct: 77  DEDEVEDVQREIQFLASLKQLPNVTRYYGSYLKNTSL-------WIIMEYCAGGSLRSLL 129

Query: 124 NTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSA 183
                 ++ E  I  IM ++   +  +H  +  +IHRDIK  NVLI+  G  K+CDFG A
Sbjct: 130 RP---GKIDEKYIGVIMRELLVALKFIH--KDNIIHRDIKAANVLITNEGGVKLCDFGVA 184

Query: 184 CSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCY 243
             + +     Q  A          T  + +PE+I    G   D K DIW+LG+  Y++  
Sbjct: 185 AQLNQRTLRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIST 233

Query: 244 YTTPF-EKEGENAI-LNVKFQFPSYP--QYSDHIRNIITIMLNKDPIKRPNICQVLEQ-- 297
              P+ + E   A+ L  K + P      Y+  I+  I + L++DP +R +  ++L+   
Sbjct: 234 GNPPYCDVEALRAMQLITKSKPPRLEGRNYTPLIKEFIALCLDEDPNERLSADELLKSKF 293

Query: 298 VSKLQGVPCPIENFMLTRIKLQNSRNNSNKSTSLNDTTN 336
           +   +  P  +   ++TR  L   +NN      ++D  N
Sbjct: 294 IKAHKTTPTIVLKELITRYLLFRDKNNRESVIGVDDDNN 332

>TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1.271
            YJL095W
          Length = 1429

 Score = 82.8 bits (203), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 81/312 (25%), Positives = 132/312 (42%), Gaps = 50/312 (16%)

Query: 23   IIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLN--------TLRAE 74
            I  + +  G F  VY    + +       G M  +K+V VP     N         LRAE
Sbjct: 1125 IKGEMIGKGSFGAVYLCLNVTT-------GEMMAVKQVEVPKYGSQNEQIIHTVEALRAE 1177

Query: 75   VDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEF 134
            +  +K L  +  IV Y+   A+       ++   L +EY + G V   +  R+Y R  E 
Sbjct: 1178 MSTLKNLD-HLNIVQYLGFEAK-------DHMNSLFLEYVAGGSVGSLI--RMYGRFDEV 1227

Query: 135  EILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQ 194
             I  + + V +G++ +H     ++HRD+K +N+L+ + G  KI DFG    + R  K   
Sbjct: 1228 MIKHLTTQVLRGLSYLHSRG--ILHRDMKADNLLLDQEGVCKISDFG----ISRKSKD-- 1279

Query: 195  EAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEK-EGE 253
               + + ++ +  T  + +PEM+D   GY    K DIW++G  + ++     P+   E  
Sbjct: 1280 --IYSNSEMTMRGTVFWMAPEMVDTAQGY--SAKVDIWSMGCVVLEMFAGKRPWSNLEVV 1335

Query: 254  NAILNV---KFQFP----SYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSKLQGVPC 306
             A+  +   K   P    + P  S   R+ I      DP  RP   + L     L+    
Sbjct: 1336 AAMFKIGKSKSAPPIPEDTLPLISQSGRDFIDACFQIDPEARPTADKQLSHPFILEK--- 1392

Query: 307  PIENFMLTRIKL 318
              ENF     KL
Sbjct: 1393 --ENFDFKSTKL 1402

>Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL101W
           (REAL)
          Length = 1534

 Score = 82.8 bits (203), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 73/266 (27%), Positives = 124/266 (46%), Gaps = 41/266 (15%)

Query: 71  LRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHR 130
           +  E+  MKL+     +  +        E+ + + E++L++EY   G + D+L ++   +
Sbjct: 161 IEREIVIMKLISHTNVMALF--------EVWENKSELYLVLEYVDGGELFDYLVSK--GK 210

Query: 131 LQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLI-SENGDYKICDFGSACSVLRP 189
           L E E +     + +GV+  H     + HRD+K EN+L+  +N   KI DFG A   L P
Sbjct: 211 LPEREAIHYFKQIVEGVSYCHSFN--ICHRDLKPENLLLDKKNRRIKIADFGMAALEL-P 267

Query: 190 PKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYSGYPIDEKSDIWALGVFLYKLCYYTTP 247
            K  + +    H         Y SPE++    Y G P    SD+W+ G+ L+ L     P
Sbjct: 268 NKLLKTSCGSPH---------YASPEIVMGRPYHGGP----SDVWSCGIVLFALLTGHLP 314

Query: 248 FEKEGENAIL----NVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQ--VSKL 301
           F  +    +L    + K+Q P     S   R++I+ +L  DP KR    ++L+   + K 
Sbjct: 315 FNDDNIKKLLLKVQSGKYQMPM--NLSAEARDLISKILVIDPAKRITTQEILKHPLIKKY 372

Query: 302 QGVPCPIENFMLTRIKLQN-SRNNSN 326
             +P    N +L ++K  N +R  SN
Sbjct: 373 DDLPV---NKILRKMKRDNMARGKSN 395

>Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {ON}
           complement(61987..64668) [2682 nt, 894 aa]
          Length = 893

 Score = 82.4 bits (202), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 67/259 (25%), Positives = 118/259 (45%), Gaps = 40/259 (15%)

Query: 99  ELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLI 158
           E+ Q    + +++EY S G    ++  +   RL+E    ++ + +  GV  MH     L+
Sbjct: 116 EVLQNSKYIGIVLEYASGGEFYRYIQRK--RRLKETAGCRLFTQLVSGVNYMH--SKGLV 171

Query: 159 HRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQ--YRSPEM 216
           HRD+K+EN+L+ ++ +  I DFG     L+            +D+M  +     Y +PE+
Sbjct: 172 HRDLKLENLLLDKHENLVITDFGFVNEFLK-----------DNDLMKTSCGSPCYAAPEL 220

Query: 217 IDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENA-----------ILNVKFQFPS 265
           +     Y    K+DIW+ G+ LY +     P++ + +N            I     +FP 
Sbjct: 221 VISTKPYEA-RKADIWSCGIILYAMLAGYLPWDDDPQNPEGDDIARLYYFITRTSLKFPE 279

Query: 266 YPQYSDHIRNIITIMLNKDPIKRPNICQVLE------QVSKLQGVPCPIENFMLTRIKLQ 319
           Y   S   R+++  +L  DP KR NI Q+ +          L   P   +N M T + L 
Sbjct: 280 Y--ISPIPRDLLRRLLVSDPRKRLNIRQIQQHEWLRPHSEFLSITPEDWDNKMKTEVALS 337

Query: 320 NSRNNS---NKSTSLNDTT 335
           N + N+   NK++S+  +T
Sbjct: 338 NPQQNNEKLNKASSVESST 356

>YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}
           TOS3Protein kinase, related to and functionally
           redundant with Elm1p and Sak1p for the phosphorylation
           and activation of Snf1p; functionally orthologous to
           LKB1, a mammalian kinase associated with Peutz-Jeghers
           cancer-susceptibility syndrome
          Length = 560

 Score = 81.6 bits (200), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 91/188 (48%), Gaps = 20/188 (10%)

Query: 106 EVFLLMEYCSRGGVIDFLNTRLYHRLQEFEIL------KIMSDVCQGVAAMHYLQPPLIH 159
           +V+L++EYCSRG V      ++  +     IL      K++ DV  G+  +H     + H
Sbjct: 130 KVYLVLEYCSRGPVKWCPENKMEIKAVGPSILTFQQSRKVVLDVVSGLEYLH--SQGITH 187

Query: 160 RDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTA----QYRSPE 215
           RDIK  N+LIS NG  KI DFG A S        Q +    H+ ++ + A     + +PE
Sbjct: 188 RDIKPSNLLISSNGTVKISDFGVAMSTATGSTNIQSS----HEQLLKSRALGTPAFFAPE 243

Query: 216 MIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEK----EGENAILNVKFQFPSYPQYSD 271
           +      Y      DIW+LGV +Y L +   PF      E  ++I+N   +FPSY +  +
Sbjct: 244 LCSTEKEYSCSSAIDIWSLGVTIYCLLFGKLPFNANSGLELFDSIINKPLEFPSYEEMLN 303

Query: 272 HIRNIITI 279
              + IT+
Sbjct: 304 GATSGITM 311

>Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON}
           similar to Ashbya gossypii AGR058W
          Length = 1145

 Score = 82.4 bits (202), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 61/215 (28%), Positives = 106/215 (49%), Gaps = 22/215 (10%)

Query: 108 FLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENV 167
           ++L EY S G ++D++    +  L+E    K    +   +  +H     ++HRD+KIEN+
Sbjct: 217 YMLFEYVSGGQLLDYIIQ--HGSLRERHARKFARGIASALQYLHMNN--IVHRDLKIENI 272

Query: 168 LISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDK--YSGYPI 225
           +IS +G+ +I DFG   S L  PK  Q   F         +  + +PE++    Y+G  +
Sbjct: 273 MISSSGEIRIIDFG--LSNLYDPKK-QLHTFC-------GSLYFAAPELLKAHPYTGPEV 322

Query: 226 DEKSDIWALGVFLYKLCYYTTPFEKEGENAIL-NVKFQFPSYPQY-SDHIRNIITIMLNK 283
               DIW+ GV LY L     PF+ E  + +   +K     YPQ+ S  + ++++ ML  
Sbjct: 323 ----DIWSFGVVLYVLVCGKVPFDDENASVLHEKIKQGKVEYPQHLSIDVISLLSKMLVV 378

Query: 284 DPIKRPNICQVLEQVSKLQGVPCPIENFMLTRIKL 318
           DP+KR  + QV+      +G   P  +++   + L
Sbjct: 379 DPLKRATLKQVVNHQWMQKGYDFPPPSYLPQSVPL 413

>KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1112

 Score = 82.4 bits (202), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 76/302 (25%), Positives = 135/302 (44%), Gaps = 46/302 (15%)

Query: 6   IPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDK 65
           I  ++ G  L +G+   ++  Y    G  Q  +V++I  S    +  TM        PD 
Sbjct: 14  IGPWKLGSTLGVGSTGKVVMAYNETKG--QQAAVKIISKSIFNAQGSTMIGGND---PDV 68

Query: 66  SGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNT 125
                 R E+  MKLL     +  Y        ++ +   ++++++EY  +G + + L  
Sbjct: 69  LPYGIER-EIIIMKLLNHPNVLRLY--------DVWETSKDLYMVLEYVEKGELFNLLVE 119

Query: 126 RLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACS 185
           R    L E E ++    +  G++  H L   ++HRD+K EN+L+    + K+ DFG    
Sbjct: 120 R--GPLPENEAVRFFRQIIIGISYCHALG--IVHRDLKPENLLLDHKFNVKLADFGM--- 172

Query: 186 VLRPPKTPQEAAFIHHDIMINTTA---QYRSPEMIDK--YSGYPIDEKSDIWALGVFLYK 240
                     AA    D ++ T+     Y +PE++    Y G+    +SD+W+ GV LY 
Sbjct: 173 ----------AALESKDKLLETSCGSPHYAAPEIVSGLPYHGF----ESDVWSCGVILYA 218

Query: 241 LCYYTTPFEKEG---ENAILNV---KFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQV 294
           L     PF++E     N +L V   KF+ P   + S   +++I  +L  DP +R    ++
Sbjct: 219 LLTGRLPFDEEDGNIRNLLLKVQSGKFEMPGDDEISSEAQDLIARILTVDPEQRIKTREI 278

Query: 295 LE 296
           L+
Sbjct: 279 LK 280

>KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.140
           YGL179C
          Length = 896

 Score = 82.0 bits (201), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 77/278 (27%), Positives = 120/278 (43%), Gaps = 70/278 (25%)

Query: 71  LRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHR 130
           ++ E+  MK L  +K++V  I+      +LK    +++L++EYCS G  I + N  L  +
Sbjct: 204 IKKEIAIMKKLH-HKHVVKLIEV---LDDLKS--RKIYLVLEYCSNGE-IKWCNDELEMK 256

Query: 131 LQEFEIL------KIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSAC 184
            +   +L      +I+  V  G+  +HY    +IHRDIK  N+L+ E+G  KI DFG + 
Sbjct: 257 AKGPPVLSFQATREIIRGVIMGLEYLHY--QGIIHRDIKPANLLVDEDGIVKISDFGVSL 314

Query: 185 SV-----------------------LRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKY- 220
           +                        L   KT    AF   +I +         E+ +KY 
Sbjct: 315 ASTTIMQQSTHNLDDSKDENDNVDELELAKTAGTPAFFAPEICL-------GDEVFEKYN 367

Query: 221 -------SGYPIDEKSDIWALGVFLYKLCYYTTPF----EKEGENAILNVKFQFPSYPQY 269
                  SG  +    DIWALGV LY L +   PF    E E    I+N    +P+Y + 
Sbjct: 368 FDRSELFSGSCVSLMIDIWALGVTLYCLLFGKLPFISDYELELFEKIVNDAVTYPTYDEI 427

Query: 270 S-------------DHIRNIITIMLNKDPIKRPNICQV 294
           +             D   +++  +L KDP KR  IC +
Sbjct: 428 ANNGISNVSGKEEYDMAIDLLNKLLEKDPSKRIRICDI 465

>TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {ON}
           Anc_8.652 YOR231W
          Length = 713

 Score = 82.0 bits (201), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 66/231 (28%), Positives = 102/231 (44%), Gaps = 43/231 (18%)

Query: 86  YIVSYIDSHA--QRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHR---LQEFEILKIM 140
           YIV Y    A  QR+        +F+ MEY   GG +D +   L  R   + E  + KI 
Sbjct: 484 YIVRYYGMFADNQRTS-------IFIAMEYMG-GGSLDGIYKHLLERGGRIGEKVLGKIA 535

Query: 141 SDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIH 200
             V +G++ +H  +  +IHRDIK +N+L++E G  K+CDFG +   +    T        
Sbjct: 536 ESVLRGLSYLH--EKKVIHRDIKPQNILLNELGQVKLCDFGVSGEAVNSLAT-------- 585

Query: 201 HDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAIL--- 257
                  T+ Y +PE I    G P     D+W+LG+ L ++     PF  E     L   
Sbjct: 586 ---TFTGTSFYMAPERIQ---GQPYSVTCDVWSLGLTLLEVAEAKFPFGSENLKTNLAPI 639

Query: 258 -----------NVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQ 297
                      N+K +  ++  +S   R+ I   L KDP  RP+  Q++  
Sbjct: 640 DLLMLILTFTPNLKEEPENHIVWSSSFRSFIDYCLKKDPSDRPSPRQMIRH 690

>Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}
           YGL179C (REAL)
          Length = 569

 Score = 81.3 bits (199), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 69/210 (32%), Positives = 100/210 (47%), Gaps = 34/210 (16%)

Query: 106 EVFLLMEYCSRGGVIDFLNTRLYHRLQEFEIL------KIMSDVCQGVAAMHYLQPPLIH 159
           +V+L++EYCSRG V      +L  +     IL      KI+SDV  G+  +H     + H
Sbjct: 130 KVYLVLEYCSRGPVKWCPENQLEIKAVGPSILTFEQARKIVSDVVSGLEYLH--SQGITH 187

Query: 160 RDIKIENVLISENGDYKICDFGSACSVLRPP-----KTPQEAAFIHHDIMINTTAQYRSP 214
           RDIK  N+LIS NG  KI DFG   S+L        ++ QE   I     + T A + +P
Sbjct: 188 RDIKPSNLLISSNGAVKISDFG--VSILTTTGSTNIQSSQEQ--ISKSKTLGTPA-FFAP 242

Query: 215 EMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEK----EGENAILNVKFQFPSYPQYS 270
           E+      Y      DIW+LGV LY + + T PF      E  + I++    FPSY Q S
Sbjct: 243 ELCTADGDYRCSSAIDIWSLGVTLYCMLFGTLPFNANSALELFDNIISKPLSFPSYEQVS 302

Query: 271 ------------DHIRNIITIMLNKDPIKR 288
                       +  ++I+  +L K+P +R
Sbjct: 303 KRGHPNLAREEYNDAKDILNRLLKKNPSER 332

>CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} similar
           to uniprot|P13185 Saccharomyces cerevisiae YDR122w KIN1
           or uniprot|P13186 Saccharomyces cerevisiae YLR096w KIN2
          Length = 944

 Score = 82.0 bits (201), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 57/215 (26%), Positives = 113/215 (52%), Gaps = 22/215 (10%)

Query: 108 FLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPP-LIHRDIKIEN 166
           ++  E+ S G ++D++    +  L+E    K+   +   ++A+ YL    ++HRD+KIEN
Sbjct: 167 YMFFEFISGGQLLDYIIQ--HGSLKENHARKVSRGI---LSALQYLHANNIVHRDLKIEN 221

Query: 167 VLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYP-I 225
           +++S+ G+ K+ DFG   ++  P K+ Q             +  + +PE++     +P +
Sbjct: 222 IMLSKTGEIKLIDFG-LSNMYDPRKSLQ---------TFCGSLYFAAPELL---KAHPYL 268

Query: 226 DEKSDIWALGVFLYKLCYYTTPFEKEGENAIL-NVKFQFPSYPQY-SDHIRNIITIMLNK 283
             + D+W+ GV LY L     PF+ E  +A+   +K    +YPQ+ S  + ++++ +L  
Sbjct: 269 GPEVDVWSFGVVLYVLVCGKVPFDDENSSALHEKIKKGKVTYPQFLSIDVISLLSKILVV 328

Query: 284 DPIKRPNICQVLEQVSKLQGVPCPIENFMLTRIKL 318
           DP KR  + QV+     L+G   P ++++  R+ L
Sbjct: 329 DPQKRATLQQVVNHQWMLKGYDFPPQSYLPRRVPL 363

>TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1745

 Score = 82.4 bits (202), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 61/206 (29%), Positives = 100/206 (48%), Gaps = 31/206 (15%)

Query: 99  ELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLI 158
           E+ + + E++L++EY   G + D+L +R   +L E E +     + QGVA  H     + 
Sbjct: 166 EVWENKSELYLVLEYVDGGELFDYLVSR--GKLPEREAVHYFKQIIQGVAYCHAFN--IC 221

Query: 159 HRDIKIENVLI-SENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTA---QYRSP 214
           HRD+K EN+L+  +N   KI DFG              AA    D +++T+     Y SP
Sbjct: 222 HRDLKPENLLLDKKNKIIKIADFGM-------------AALEVSDKLLSTSCGSPHYASP 268

Query: 215 EMI--DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSD- 271
           E++    Y G P    +D+W+ G+ L+ L     PF  +    +L +K Q   Y   SD 
Sbjct: 269 EIVMGKSYHGSP----TDVWSCGIILFALLTGHLPFNHDNIKKLL-LKVQSGVYHMPSDL 323

Query: 272 --HIRNIITIMLNKDPIKRPNICQVL 295
               +++I+ +L  DP KR    ++L
Sbjct: 324 SPDAKDLISKILVVDPDKRLTTTEIL 349

>Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON}
           (24479..26854) [2376 nt, 792 aa]
          Length = 791

 Score = 81.6 bits (200), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 78/291 (26%), Positives = 137/291 (47%), Gaps = 48/291 (16%)

Query: 28  LACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVP--DKSGLNTLRAEVDAMKLLKGNK 85
           L  GG ++VY V+ + ++        +  LKRV+    D+S +++ + E++ +K L+  K
Sbjct: 475 LGRGGSSKVYKVKNVHNN-------KIFALKRVMFDEFDESSIDSFKGEIELLKKLENEK 527

Query: 86  YIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMS-DVC 144
            +V+ I          Q E  V LL+  C    +   LN R+   L + E ++  + ++ 
Sbjct: 528 RVVTLIQH--------QMESGVLLLIMECGDHDLSQILNQRMNMPL-DIEFIRFHAREML 578

Query: 145 QGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIM 204
           + V  +H     ++H D+K  N +  + G  KI DFG A +V      P     I+ +  
Sbjct: 579 KCVKVVH--DAGIVHSDLKPANFVFVK-GILKIIDFGIANAV------PDHTVNIYRETQ 629

Query: 205 INTTAQYRSPEMI---------DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEK-EGEN 254
           I T   Y +PE +         D+ + + + + SDIW+ G  LY++ Y   P+   +G+N
Sbjct: 630 IGT-PNYMAPEALVAMNSQQDSDQQNKWKVGKPSDIWSCGCILYQMFYGRPPYGSFQGQN 688

Query: 255 AIL-----NVKFQFPSYPQYSDHI-RNIITIM---LNKDPIKRPNICQVLE 296
            +L     NVK  F      ++ I R+ +  M   L ++P KR  + QVLE
Sbjct: 689 RLLAIMNPNVKIVFSEKTSNNERIPRSALETMKACLIRNPDKRWAVDQVLE 739

>KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1.271
            YJL095W
          Length = 1398

 Score = 82.0 bits (201), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 64/229 (27%), Positives = 104/229 (45%), Gaps = 37/229 (16%)

Query: 28   LACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSG--------LNTLRAEVDAMK 79
            +  G F  VY    + +       G M  +K+V VP  S         +  LR+EV  +K
Sbjct: 1102 IGKGSFGAVYLCLNVTT-------GEMMAVKQVEVPKYSSQDENIISTVEALRSEVSTLK 1154

Query: 80   LLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKI 139
             L  +  IV Y+       E K   Y +FL  EY + G V   +  R+Y R  E  I  +
Sbjct: 1155 DL-DHLNIVQYLGF-----ENKDNIYSLFL--EYVAGGSVGSLI--RMYGRFDEAMIRHL 1204

Query: 140  MSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFI 199
               V +G++ +H     ++HRD+K +N+L+ ++G  KI DFG +              + 
Sbjct: 1205 TIQVLRGLSYLHSRG--ILHRDMKADNLLLDQDGVCKISDFGISRK--------SNDIYS 1254

Query: 200  HHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPF 248
            + D+ +  T  + +PEM+D   GY    K DIW+LG  + ++     P+
Sbjct: 1255 NSDMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCVVLEMFAGKRPW 1301

>TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {ON}
           Anc_8.140 YGL179C
          Length = 1130

 Score = 82.0 bits (201), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 68/232 (29%), Positives = 103/232 (44%), Gaps = 50/232 (21%)

Query: 106 EVFLLMEYCSRGGVI----DFLNTRL-------YHRLQEFEILKIMSDVCQGVAAMHYLQ 154
           +++L++EYCS+G V     D + T         + R +E     I+  V  G+  +HY  
Sbjct: 198 KIYLVLEYCSKGEVKWCPGDQMETEARGPPLLTFQRTRE-----ILRGVVLGLEYLHYQG 252

Query: 155 PPLIHRDIKIENVLISENGDYKICDFGSACSV--------------LRPPKTPQEAAFIH 200
             +IHRDIK  N+LISE+   KI DFG + +               L   KT    AF  
Sbjct: 253 --VIHRDIKPANLLISEDNTVKISDFGVSLAATGAEDADNIESDDELELAKTAGTPAFFA 310

Query: 201 HDIMINTTA-QYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPF----EKEGENA 255
            +I +   A +    +  D + G  I    DIWALGV LY L +   PF    E E    
Sbjct: 311 PEICLGNEAFEKYQLKREDLFKGSSISFMIDIWALGVTLYCLLFGMLPFISDYELELFEK 370

Query: 256 ILNVKFQFPSYPQYSDH-------------IRNIITIMLNKDPIKRPNICQV 294
           I+N   +FPSY +   +               +++  +L K+P+KR  I ++
Sbjct: 371 IVNDPVKFPSYEEVKGNRVSMLSSEEEYNMALDLVNRLLEKNPMKRITIAEI 422

>Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {ON}
           YDR122W (KIN1) - Serine/threonine protein kinase [contig
           174] PARTIAL
          Length = 858

 Score = 81.6 bits (200), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 60/215 (27%), Positives = 107/215 (49%), Gaps = 22/215 (10%)

Query: 108 FLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENV 167
           ++L EY S G ++D++    +  L+E    K    +   +  +H     ++HRD+KIEN+
Sbjct: 9   YMLFEYVSGGQLLDYIIQ--HGSLRERSARKFARGIASALQYLHMNN--IVHRDLKIENI 64

Query: 168 LISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDK--YSGYPI 225
           +IS +G+ KI DFG   S +  PK  Q   F         +  + +PE++    Y+G  +
Sbjct: 65  MISTSGEIKIIDFG--LSNMYNPKK-QLHTFC-------GSLYFAAPELLKACPYTGPEV 114

Query: 226 DEKSDIWALGVFLYKLCYYTTPFEKEGENAIL-NVKFQFPSYPQY-SDHIRNIITIMLNK 283
               D+W+ GV L+ L     PF+ E  + +   +K     YPQ+ S  + ++++ ML  
Sbjct: 115 ----DVWSFGVVLFVLVCGKVPFDDENSSVLHEKIKQGKVEYPQHLSIEVISLLSKMLVV 170

Query: 284 DPIKRPNICQVLEQVSKLQGVPCPIENFMLTRIKL 318
           DP KR ++ QV+      +G   P  +++  R+ L
Sbjct: 171 DPTKRASLKQVVNHQWMQRGYDFPAPSYIPHRVPL 205

>TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa]
           {ON} Anc_8.668 YPL150W
          Length = 861

 Score = 81.6 bits (200), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 99/203 (48%), Gaps = 35/203 (17%)

Query: 104 EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVC-----QGVAAMHYLQP-PL 157
           E +V++ +EYC            LY  L    + +I  D C     Q V A++Y      
Sbjct: 100 ETKVWMALEYCP--------GKELYEHL--LALKRISLDECSRLFAQIVGAIYYAHSLNC 149

Query: 158 IHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI 217
           +HRD+K+EN+L+ + G+ K+ DFG     +   +          D +  TT  Y +PE+ 
Sbjct: 150 VHRDLKLENILLDKKGNAKLTDFGFTRECVSKSQL---------DTICGTTV-YMAPELT 199

Query: 218 DK--YSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAI-LNVKFQFPSYPQ--YSDH 272
           ++  Y G+ I    DIWALGV LY +   + PF+++ E      +  + P   +   S  
Sbjct: 200 ERKSYDGFKI----DIWALGVILYTMINGSMPFDEDDEAKTKWKIVNEMPEINEDLVSPD 255

Query: 273 IRNIITIMLNKDPIKRPNICQVL 295
            +++I  +L KDP +RP+I ++L
Sbjct: 256 AKDLIEQLLAKDPNERPSIEKIL 278

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score = 82.0 bits (201), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 66/235 (28%), Positives = 109/235 (46%), Gaps = 41/235 (17%)

Query: 71  LRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHR 130
           +  E+  MKLL     +  Y        E+ +   E++L++EY   G + D+L ++   +
Sbjct: 182 IEREIVIMKLLSHPNVMALY--------EVWENNNELYLVLEYVDGGELFDYLVSK--GK 231

Query: 131 LQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDY-KICDFGSACSVLRP 189
           L E E +     +  G++  H     + HRD+K EN+L+ +     KI DFG A      
Sbjct: 232 LTESEAVHYFKQIINGISYCHSFN--ICHRDLKPENLLLDKKRRIIKIADFGMA------ 283

Query: 190 PKTPQEAAFIHHDIMINTTA---QYRSPEMI--DKYSGYPIDEKSDIWALGVFLYKLCYY 244
                  A    + ++ T+     Y SPE++    Y+G P    SDIW+ G+ L+ L   
Sbjct: 284 -------ALQVSNRLLQTSCGSPHYASPEIVMGKCYNGAP----SDIWSCGIILFALLTG 332

Query: 245 TTPFEKEGENAIL----NVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVL 295
             PF  +    +L    N ++Q PSY   S   +N+I+ +L  DP KR +  Q+L
Sbjct: 333 HLPFNDDNIKKLLIKVQNGRYQMPSY--ISQEAKNLISRILVVDPSKRISTEQIL 385

>NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {ON}
           Anc_5.406
          Length = 1020

 Score = 81.6 bits (200), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 72/270 (26%), Positives = 124/270 (45%), Gaps = 29/270 (10%)

Query: 64  DKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFL 123
           D+  +  ++ E+  +  LK    I  Y  S+ + + L       +++MEYC+ G +   L
Sbjct: 78  DEDEVEDVQREIQFLASLKQLPNITRYYGSYLKDTSL-------WIIMEYCAGGSLRTLL 130

Query: 124 NTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSA 183
                 ++ E  I  I  ++   +  +H  +  +IHRDIK  NVLI+  G  K+CDFG A
Sbjct: 131 RP---GKIDEKYIGVITREILIALKYIH--KDNIIHRDIKAANVLITNEGSIKLCDFGVA 185

Query: 184 CSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCY 243
             + +  K  Q  A          T  + +PE+I    G   D K DIW+LG+  Y++  
Sbjct: 186 AQLNQSTKRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITTYEIAT 234

Query: 244 YTTPF-EKEGENAI-LNVKFQFPSYP--QYSDHIRNIITIMLNKDPIKRPNICQVLEQ-- 297
              P+ E E   A+ L  K + P      YS  ++  + + L++DP +R +   +L+   
Sbjct: 235 GNPPYCEIEALRAMQLITKSKPPRLEGRNYSPLLKEFVALCLDEDPKERMSAEDLLKTKF 294

Query: 298 VSKLQGVPCPIENFMLTRIKLQNSRNNSNK 327
           +   +  P  I   +++R  L   RN + K
Sbjct: 295 IKAHKLTPVSILKELISRYLLFRDRNKTLK 324

>ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR102W
           (KIC1)
          Length = 947

 Score = 81.6 bits (200), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 88/355 (24%), Positives = 154/355 (43%), Gaps = 59/355 (16%)

Query: 9   YEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGL 68
           +++  V+  G   V+ + Y A     QVY+V+V++     +E+                 
Sbjct: 25  FKRTEVIGRGKFGVVYKAYHA--KTKQVYAVKVLNLDCPEDEV----------------- 65

Query: 69  NTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLY 128
             ++ E+  +  LK    I  Y  S+   ++L       +++MEYC+ G +   L     
Sbjct: 66  EDVQKEIQFLASLKQVPNITRYYGSYLYDTKL-------WVIMEYCAGGSLRTLLRP--- 115

Query: 129 HRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLR 188
            ++ E  +  I+  +   +  +H  +  +IHRDIK  NVLI+  G  K+CDFG A     
Sbjct: 116 GKIDEKYLGVIVRKLLIALVYIH--KDNVIHRDIKAANVLITNEGHVKLCDFGVAA---- 169

Query: 189 PPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPF 248
                Q  A  H    +  T  + +PE+I    G   + K+DIW+LG+  Y++     P+
Sbjct: 170 -----QLTAANHKRQTMAGTPYWMAPEVI--MEGVYYNTKADIWSLGITAYEIATGNPPY 222

Query: 249 -EKEGENAI-LNVKFQFPSYP--QYSDHIRNIITIMLNKDPIKRPNICQVLEQ--VSKLQ 302
            + E   A+ L  K + P      YS  ++  I + L++DP +RP    +L    V   +
Sbjct: 223 CDVEALRAMQLITKSKPPRLEGRNYSPLLKEFIALCLDEDPEERPTAEDLLSSKFVKAHK 282

Query: 303 GVPCPIENFMLTRIKLQNSRNN----------SNKSTSLNDTTNNSFNN-ELALD 346
           G    I   +++R  L + ++N           +   S N+TTN   N  E+  D
Sbjct: 283 GSSATILKELISRYLLFSEKHNRESVLIPLDEDDPHKSANNTTNGGDNQVEMKWD 337

>TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON}
           Anc_8.140 YGL179C
          Length = 1038

 Score = 81.6 bits (200), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 74/260 (28%), Positives = 118/260 (45%), Gaps = 44/260 (16%)

Query: 71  LRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI----DFLNTR 126
           ++ E++ MK    N++IV  ++      +LK    +++L++EYCSRG V     D + T 
Sbjct: 193 IKREINIMKRCN-NEHIVKLLEV---LDDLK--SKKIYLILEYCSRGEVKWCPGDVMETE 246

Query: 127 LYHR-LQEFE-ILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFG--- 181
                L  F+ + KI+ DV  G+  +H     +IHRDIK  N+L+SE+G  KI DFG   
Sbjct: 247 ARGPPLLSFQRVRKILRDVTLGLEYLH--SRGIIHRDIKPANLLLSEDGSVKISDFGVSV 304

Query: 182 ----------SACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDI 231
                     ++   L   KT    AF   +I + + A+ +     D      +    D+
Sbjct: 305 ISHNKEENGTNSIDELELAKTAGTPAFFAPEICLGSEAKSKFNLKKDPSKDSKLIYMVDV 364

Query: 232 WALGVFLYKLCYYTTPFEKEGE----NAILNVKFQFPSY-------------PQYSDHIR 274
           WALG  LY L +   PF  + E      I+N    FP Y              +  +  +
Sbjct: 365 WALGTTLYCLLFGMLPFISDYELKLFEKIVNDPLIFPDYEIMQKNGTSNIFSEEEYEAAK 424

Query: 275 NIITIMLNKDPIKRPNICQV 294
           NI+  +L K+P KR +I  +
Sbjct: 425 NILKELLTKNPAKRMSIKDI 444

>TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {ON}
            Anc_1.271 YJL095W
          Length = 1643

 Score = 82.0 bits (201), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 79/288 (27%), Positives = 127/288 (44%), Gaps = 47/288 (16%)

Query: 28   LACGGFAQVY-SVRVIDSSNARNELGTMACLKRVIVPD--------KSGLNTLRAEVDAM 78
            +  G F  VY S+ V          G M  +K+V VP+         S +  LR+EV  +
Sbjct: 1344 IGKGSFGSVYLSLNVT--------TGEMMAVKQVEVPEFGSQNEAIVSTVEALRSEVTLL 1395

Query: 79   KLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILK 138
            K L  +  IV Y+       E K   Y +FL  EY + G +   +  R+Y R  E  I  
Sbjct: 1396 KDL-DHINIVQYLGF-----EKKNNIYSLFL--EYVAGGSIGSLI--RMYGRFDESLIRH 1445

Query: 139  IMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAF 198
              + +  G++ +H     ++HRD+K +N+L+   G  KI DFG    + R  K      +
Sbjct: 1446 STTQILAGLSYLH--SKGILHRDMKADNILLDGEGICKISDFG----ISRKSKD----IY 1495

Query: 199  IHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEK-EGENAIL 257
             + ++ +  T  + +PEM+D   GY    K DIW+LG  + ++     P+   E   A+ 
Sbjct: 1496 SNSEMTMRGTVFWMAPEMVDTKQGY--SAKVDIWSLGCIILEMFAGKRPWSNLEVVAAMF 1553

Query: 258  NV---KFQFP----SYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQV 298
             +   K   P    + P  S   R+ +      DP KRP   Q+L+ +
Sbjct: 1554 KIGQSKSAPPIPEDTLPLISQDGRDFLDDCFKIDPEKRPTAEQMLDHL 1601

>ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {ON}
           weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 943

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 72/284 (25%), Positives = 128/284 (45%), Gaps = 46/284 (16%)

Query: 9   YEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGL 68
           +++  V+  G   V+ + + A     QVY+++V++  +  +E+                 
Sbjct: 29  FKRTEVIGTGKFGVVYKGHHAR--TKQVYAIKVLNLDSDEDEV----------------- 69

Query: 69  NTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLY 128
             ++ EV  +  +K    I  Y  S+ + + L       ++++EYC+ G +   L     
Sbjct: 70  EDVQREVQFLASMKQTPNITHYYGSYLKDTTL-------WIIIEYCAGGSLRTLLRP--- 119

Query: 129 HRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLR 188
            ++ E  I  IM +V   +  +H  +  +IHRDIK  NVLI+  G  K+CDFG A  + +
Sbjct: 120 GKIDEKYIGIIMREVLIALKYIH--KDNVIHRDIKAANVLITNEGHVKLCDFGVAAQLNQ 177

Query: 189 PPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPF 248
                Q  A          T  + +PE+I    G   D K DIW+LG+  Y++     P+
Sbjct: 178 SSLKRQTMA---------GTPYWMAPEVI--MEGVSYDTKVDIWSLGITTYEIATGNPPY 226

Query: 249 -EKEGENAI-LNVKFQFPSYP--QYSDHIRNIITIMLNKDPIKR 288
            + E   A+ L  K + P      YS  ++  I + L++DP +R
Sbjct: 227 CDVEALRAMQLITKSKPPRLEGRHYSPMLKEFIALCLDEDPKER 270

>NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {ON}
           Anc_8.279
          Length = 1049

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 57/215 (26%), Positives = 105/215 (48%), Gaps = 28/215 (13%)

Query: 108 FLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENV 167
           ++L EY S G ++D++    +  L+E         +C  +  +H     ++HRD+KIEN+
Sbjct: 176 YMLFEYVSGGQLLDYIIQ--HGSLKESRARTFTRQICSALKYLHSHN--IVHRDLKIENI 231

Query: 168 LISENGDYKICDFG-----SACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSG 222
           +IS++G+ K+ DFG       C+ L+                   +  + +PE++ K + 
Sbjct: 232 MISKDGNIKLIDFGLSNLYDKCNKLK---------------TYCGSLYFAAPELL-KATP 275

Query: 223 YPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAIL-NVKFQFPSYPQY-SDHIRNIITIM 280
           Y I  + D+W+ GV LY L     PF+ E  N +   +K     YPQ+ S  + ++++ M
Sbjct: 276 Y-IGPEIDVWSFGVVLYVLVCGKVPFDDENSNVLHEKIKQGKVFYPQFLSIEVISLLSKM 334

Query: 281 LNKDPIKRPNICQVLEQVSKLQGVPCPIENFMLTR 315
           L  DP KR  + QV+     ++    P ++++  R
Sbjct: 335 LVVDPFKRATLDQVMNHHWMVRDCDGPPKSYIPDR 369

>NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON} 
          Length = 1210

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 59/218 (27%), Positives = 107/218 (49%), Gaps = 28/218 (12%)

Query: 108 FLLMEYCSRGGVIDFLNTRLYH-RLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIEN 166
           ++L EY S G ++D++   + H  L+E    K    +   +  +H     ++HRD+KIEN
Sbjct: 262 YMLFEYVSGGQLLDYI---IQHGSLREHHARKFARGIASALEYIHANN--IVHRDLKIEN 316

Query: 167 VLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDK--YSGYP 224
           ++IS +G+ KI DFG +    R     Q   F         +  + +PE++    Y+G  
Sbjct: 317 IMISTSGEIKIIDFGLSNVFDR---KKQLHTFC-------GSLYFAAPELLKAHPYTGPE 366

Query: 225 IDEKSDIWALGVFLYKLCYYTTPFEKEGENA----ILNVKFQFPSYPQYSDHIRNIITIM 280
           +    D+W+ GV LY L     PF+ E  +     I   K  +P++   S  + ++++ M
Sbjct: 367 V----DVWSFGVVLYVLVCGKVPFDDENSSVLHEKIKQGKVDYPNH--LSIEVISLLSKM 420

Query: 281 LNKDPIKRPNICQVLEQVSKLQGVPCPIENFMLTRIKL 318
           L  DP++R ++ QV+E     +G   P  +++  RI +
Sbjct: 421 LVVDPLRRASLKQVVEHPWMTRGYDYPPPSYVPRRIPM 458

>SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa]
           {ON} similar to uniprot|Q75DQ1 Ashbya gossypii ABL034W
           ABL034Wp and weakly similar to YKL101W uniprot|P34244
           Saccharomyces cerevisiae YKL101W HSL1 Nim1p-related
           protein kinase that regulates the morphogenesis and
           septin checkpoints associates with the assembled septin
           filament required along with Hsl7p for bud neck
           recruitment phosphorylation and degradation of Swe1p
          Length = 1377

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 81/301 (26%), Positives = 137/301 (45%), Gaps = 51/301 (16%)

Query: 9   YEKGRVLPIGTH-QVIIEKYLACGGFAQVYSV--RVIDSSNARNELGTMACLKRVIVPDK 65
           ++ G+ L  G+  +V + K +  G  A +  V  +V+ S+NA          K+    + 
Sbjct: 61  WKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKKVVRSTNAS---------KKSNAANG 111

Query: 66  SGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNT 125
           +    +  E+  MKL+     +  Y        E+ + + E+FL++EY   G + D+L +
Sbjct: 112 NLPYGIEREIIIMKLISHPNIMALY--------EVWENKSELFLVLEYVEGGELFDYLVS 163

Query: 126 RLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLI-SENGDYKICDFGSAC 184
           +   +L E E +     + QGVA  H     + HRD+K EN+L+  +N   KI DFG   
Sbjct: 164 K--GKLPEQEAVHYFRQIIQGVAYCHNYN--ICHRDLKPENLLVDKKNHQIKIADFGM-- 217

Query: 185 SVLRPPKTPQEAAFIHHDIMINTTA---QYRSPEMI--DKYSGYPIDEKSDIWALGVFLY 239
                      AA    + ++ T+     Y SPE++    Y G P    SD+W+ G+ L+
Sbjct: 218 -----------AALETTNKLLETSCGSPHYASPEIVMGKNYHGSP----SDVWSCGIILF 262

Query: 240 KLCYYTTPFEKEGENAILNVKFQFPSY--PQ-YSDHIRNIITIMLNKDPIKRPNICQVLE 296
            L     PF  +    +L +K Q   Y  PQ  S   +++I+ +L  DP  R  I +VL+
Sbjct: 263 ALLTGHLPFNDDNIKKLL-LKVQSGKYHMPQNISSEAQDLISKILIVDPRGRITINEVLQ 321

Query: 297 Q 297
            
Sbjct: 322 H 322

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 59/207 (28%), Positives = 99/207 (47%), Gaps = 33/207 (15%)

Query: 99  ELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLI 158
           E+ + + E++L++EY   G + D+L +R   RL E E +     + QGV+  H     + 
Sbjct: 183 EVWENKSELYLVLEYVDGGELFDYLVSR--GRLCEREAVHYFKQIIQGVSYCHAFN--IC 238

Query: 159 HRDIKIENVLI-SENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTA---QYRSP 214
           HRD+K EN+L+  +N   KI DFG              AA    + ++ T+     Y SP
Sbjct: 239 HRDLKPENLLLDKKNSTIKIADFGM-------------AALEVSNKLLQTSCGSPHYASP 285

Query: 215 EMI--DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAIL----NVKFQFPSYPQ 268
           E++   +Y G P    SD+W+ G+ L+ L     PF  +    +L    + K+Q P    
Sbjct: 286 EIVMGKQYHGGP----SDVWSCGIILFALLTGHLPFNDDSIKKLLLKVQSGKYQMPQ--N 339

Query: 269 YSDHIRNIITIMLNKDPIKRPNICQVL 295
            S   +++I  +L  +P KR    ++L
Sbjct: 340 LSKEAQDLIAKILTVNPAKRLTTEEIL 366

>Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} similar
           to Ashbya gossypii ACL104C
          Length = 1003

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 115/235 (48%), Gaps = 22/235 (9%)

Query: 104 EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIK 163
           E +++++MEYC+ G +   L      ++ E  +  I+ ++   VA ++  +  +IHRDIK
Sbjct: 92  ETKLWVIMEYCAGGSLRTLLRP---GKIDEKYLGVIVRNLL--VALLYIHKDNVIHRDIK 146

Query: 164 IENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGY 223
             NVLI+  G  K+CDFG A          Q     H    +  T  + +PE+I    G 
Sbjct: 147 AANVLITNGGHVKLCDFGVAA---------QLTTANHKRQTMAGTPYWMAPEVI--MEGV 195

Query: 224 PIDEKSDIWALGVFLYKLCYYTTPF-EKEGENAI-LNVKFQFPSYP--QYSDHIRNIITI 279
             + K+DIW+LG+  Y++     P+ + E   A+ L  K + P      YS  ++  I +
Sbjct: 196 YYNTKADIWSLGITTYEIATGNPPYCDVEALRAMQLITKSKPPRLEGRNYSPLLKEFIAL 255

Query: 280 MLNKDPIKRPNICQVL--EQVSKLQGVPCPIENFMLTRIKLQNSRNNSNKSTSLN 332
            L++DP  RP   ++L  + V   +G    I   +++R  L + ++ + +S  +N
Sbjct: 256 CLDEDPEARPTAEELLTTKLVKTHKGSSVTILKELISRYLLFSEKHKNRESVMIN 310

>ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {ON}
           some similarities with uniprot|Q03306 Saccharomyces
           cerevisiae YDR466W
          Length = 890

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 69/288 (23%), Positives = 132/288 (45%), Gaps = 34/288 (11%)

Query: 20  HQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMK 79
           H  + ++ L  G +++VY  + +D S+ +       C KR I+  ++ +  +  E + + 
Sbjct: 10  HDFVFKEELGNGSYSRVY--KAVDRSDPQRVYAVKVCSKRHII-HENKVKYVTIEKNTLN 66

Query: 80  LL-KGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILK 138
           LL + N   +  + S     E       ++ ++++ + G ++  LN     R+ +F    
Sbjct: 67  LLARANHPGIVKLHSTFHDEE------NLYFVLDFAAGGELLSLLN-----RVGKFTEPC 115

Query: 139 IMSDVCQGVAAMHYLQPP-LIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAA 197
               + Q +    ++    +IHRD+K ENVL+  +G   + DFG+A ++ +   T   A+
Sbjct: 116 ARHFIAQLIDTTEFIHSQGVIHRDLKPENVLLHRDGRLMVTDFGTATNITK-ENTEGGAS 174

Query: 198 FIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAIL 257
           F+        TA+Y SPE++  Y+       SD+WALG  LY+      PF  E E    
Sbjct: 175 FV-------GTAEYVSPELL-LYNQ--CQFASDVWALGCMLYQFIEGVPPFRGENELHTF 224

Query: 258 N--VKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQV-----LEQV 298
              V  ++P        + +++  +L  DP +RP++  +      EQV
Sbjct: 225 EKIVALEYPWANNNKGGVVSLVRRILTLDPSQRPSLTSIKQDKWFEQV 272

>ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa]
            {ON} similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095W BCK1 Mitogen-activated protein (MAP) kinase
            kinase kinase acting in the protein kinase C signaling
            pathway which controls cell integrity upon activation by
            Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1487

 Score = 81.3 bits (199), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 61/205 (29%), Positives = 99/205 (48%), Gaps = 30/205 (14%)

Query: 52   GTMACLKRVIVPDKSGLN--------TLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQG 103
            G M  +K+V VP     N         LRAEV  +K L  +  IV Y+       E+K  
Sbjct: 1205 GEMMAVKQVEVPRYGSQNEAIISTVEALRAEVSTLKDLD-HLNIVQYLGF-----EVKDS 1258

Query: 104  EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIK 163
             Y +FL  EY + G V   +  R+Y +  E  I  +   V +G++ +H     ++HRD+K
Sbjct: 1259 IYSLFL--EYVAGGSVGSLI--RMYGKFDEKLIKHLTIQVLRGLSYLHSRG--ILHRDMK 1312

Query: 164  IENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGY 223
             +N+L+ ++G  KI DFG    + R  K      + + ++ +  T  + +PEM+D   GY
Sbjct: 1313 ADNLLLDQDGVCKISDFG----ISRKSKD----IYSNSEMTMRGTVFWMAPEMVDTKQGY 1364

Query: 224  PIDEKSDIWALGVFLYKLCYYTTPF 248
                K DIW+LG  + ++     P+
Sbjct: 1365 --SAKVDIWSLGCVVLEMFAGKRPW 1387

>Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {ON}
            similar to Ashbya gossypii ACR281C
          Length = 1325

 Score = 81.3 bits (199), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 84/177 (47%), Gaps = 22/177 (12%)

Query: 118  GVIDFLN-TRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYK 176
            G ID  +   L   + E+E   +   +  GV  +H     ++HRDIK ENV++   G  K
Sbjct: 1157 GSIDLFDLIELKTNMTEYEAKLLFKQITSGVKHLH--DNGIVHRDIKDENVIVDNKGCVK 1214

Query: 177  ICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYSGYPIDEKSDIWAL 234
            + DFGSA  V R P           D+ + T   Y +PE++  D Y G P     DIWA+
Sbjct: 1215 LIDFGSAAYVKRGP----------FDVFVGTI-DYAAPEVLEGDPYEGKP----QDIWAI 1259

Query: 235  GVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNI 291
            GV LY + Y   PF    E  IL+   +       S+    +IT++L++   KRP +
Sbjct: 1260 GVLLYTIIYKENPFYNVDE--ILDGDLRINPSVIVSEECVALITMVLDRSLSKRPTV 1314

>Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa]
           {ON} YER129W (PAK1) - DNA polymerase alpha suppressing
           protein kinase [contig 211] FULL
          Length = 1127

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 66/230 (28%), Positives = 103/230 (44%), Gaps = 48/230 (20%)

Query: 106 EVFLLMEYCSRGGVI----DFLNTRL-------YHRLQEFEILKIMSDVCQGVAAMHYLQ 154
           +++L++EYCS+G V     D L T         + R +E     I   V  G+  +HY  
Sbjct: 187 KIYLVLEYCSKGEVKWCPGDQLETEARGPPLLTFQRARE-----IFRGVVLGLEYLHYQG 241

Query: 155 PPLIHRDIKIENVLISENGDYKICDFGSACSV------------LRPPKTPQEAAFIHHD 202
             +IHRDIK  N+LISE+G  KI DFG + +             L   KT    AF   +
Sbjct: 242 --IIHRDIKPANLLISESGTVKISDFGVSFAASKSGAGYGSLDELELAKTAGTPAFFAPE 299

Query: 203 IMINTTAQYR-SPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE----NAIL 257
           I +   A  R +P+      G  I    DIWA+GV L+ L +   PF  E E    + I+
Sbjct: 300 ICLGHEASERFAPDRPSSDHGSIISYNIDIWAIGVTLHCLLFGMLPFFSEFELELFDKII 359

Query: 258 NVKFQFPSYPQYS-------------DHIRNIITIMLNKDPIKRPNICQV 294
           N +    +Y + +             +  ++++  +L K+P KR  I ++
Sbjct: 360 NQELVLKTYEEMASNGISKISNQEEYEAAKDLLGRLLTKNPFKRIKIAEI 409

>AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR507C
           (GIN4) and YCL024W (KCC4)
          Length = 1142

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 99/203 (48%), Gaps = 32/203 (15%)

Query: 106 EVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIE 165
           ++++++EY  +G + + L  R    L E E ++    +  G++  H L   ++HRD+K E
Sbjct: 102 DLYMVLEYVEKGELFNLLVQR--GPLPENEAVRFFRQIIIGISYCHALG--IVHRDLKPE 157

Query: 166 NVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTA---QYRSPEMIDK--Y 220
           N+L+    + K+ DFG              AA    D ++ T+     Y +PE++    Y
Sbjct: 158 NLLLDHKFNIKLADFGM-------------AALESKDKLLETSCGSPHYAAPEIVSGLPY 204

Query: 221 SGYPIDEKSDIWALGVFLYKLCYYTTPFEKEG---ENAILNV---KFQFPSYPQYSDHIR 274
            G+    +SD+W+ GV LY L     PF++E     N +L V   K++ P   + S   R
Sbjct: 205 HGF----ESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEISPEAR 260

Query: 275 NIITIMLNKDPIKRPNICQVLEQ 297
           ++I  +L  +P +R    ++L+ 
Sbjct: 261 DLIVQILTVEPEQRIKTREILKH 283

>SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {ON}
           weakly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141C Hypothetical ORF
          Length = 919

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 78/304 (25%), Positives = 129/304 (42%), Gaps = 49/304 (16%)

Query: 23  IIEKYLACGGFAQV-YSVRVIDSSNARNELGTMACLKRVIVPDKSGLNT-LRAEVDAMKL 80
           I+   L  G F +V         SN   +   +  ++R  VP  S     +  E++A+K 
Sbjct: 45  IVGSTLGEGEFGKVKLGWSKTTGSNEVPKQVAIKLIRRDTVPKNSDKEVKIYREINALKH 104

Query: 81  LKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIM 140
           L     +        +  E+ Q    + +++EY S G    ++  +   RL+E    ++ 
Sbjct: 105 LTHPNIV--------RLEEVLQNSKYIGIVLEYASGGEFYRYIQKK--RRLKEHAACRLF 154

Query: 141 SDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIH 200
           + +  GV  MH     L+HRD+K+EN+L+ +N +  I DFG                F H
Sbjct: 155 AQLISGVHYMH--SKGLVHRDLKLENLLLDKNENLLITDFGFVNE------------FNH 200

Query: 201 HDIMINTTAQ---YRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENA-- 255
            + ++ T+     Y +PE++     Y    K+DIW+ GV +Y +     P++ + EN   
Sbjct: 201 KNELMKTSCGSPCYAAPELVVTTKPYEA-RKADIWSCGVIMYAMLAGYLPWDDDSENPEG 259

Query: 256 ---------ILNVKFQFPSY--PQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSKLQGV 304
                    I     +FP Y  P   D +R I+      +P KR N+ QV EQ   LQ  
Sbjct: 260 DDIAKLYHYITKTPLKFPEYINPVPRDLLRRILV----SNPKKRLNLRQV-EQHQWLQPH 314

Query: 305 PCPI 308
            CP 
Sbjct: 315 -CPF 317

>Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W
           (REAL)
          Length = 1017

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 56/196 (28%), Positives = 97/196 (49%), Gaps = 24/196 (12%)

Query: 107 VFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIEN 166
           ++L++EY  +G + + L  R    L E E +K    +   V+  H L   ++HRD+K EN
Sbjct: 102 LYLILEYAEKGELFNLLVDR--GALPEREAMKCFRQIIIAVSYCHALG--IVHRDLKPEN 157

Query: 167 VLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPID 226
           +L+  + + K+ DFG A           +AA +        +  Y +PE++   SG P +
Sbjct: 158 LLLDSDYNIKVADFGMAA-------LQTDAALLETSC---GSPHYAAPEIV---SGLPYE 204

Query: 227 E-KSDIWALGVFLYKLCYYTTPFEKEGEN---AILNV---KFQFPSYPQYSDHIRNIITI 279
              SD+W+ GV L+ L     PF++E  N    +L V   +F+ P   + S   +++I+ 
Sbjct: 205 GFSSDVWSCGVILFALLTGRLPFDEENGNIRTLLLKVQRGQFEMPDDTEISKDAQDLISK 264

Query: 280 MLNKDPIKRPNICQVL 295
           +L  DP +R  I  +L
Sbjct: 265 ILVVDPAQRIKIRDIL 280

>KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}
           Anc_6.371 YCR091W
          Length = 833

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 93/205 (45%), Gaps = 25/205 (12%)

Query: 102 QGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRD 161
           Q E  V+L MEYC  G     L TR    + E +     S+V   +  +H L    I+RD
Sbjct: 504 QTEDYVYLCMEYCMGGEFFRALQTRKAKSISEDDARFYASEVTAALEYLHLLG--FIYRD 561

Query: 162 IKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINT-------------- 207
           +K EN+L+ ++G   + DF  +       K  +  A      M++T              
Sbjct: 562 LKPENILLHKSGHIMLSDFDLSVQANDAAKPVKRVA--TQSSMVDTKVFSEGFRTNSFVG 619

Query: 208 TAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENA----ILNVKFQF 263
           T +Y +PE+I    G       D W LG+ +Y++ +  TPF+ E  N     IL  +  F
Sbjct: 620 TEEYIAPEVI---RGNGHTAAVDWWTLGILIYEMLFGCTPFKGENTNETFCNILKNEVTF 676

Query: 264 PSYPQYSDHIRNIITIMLNKDPIKR 288
           P + + S H +++I  +L+K+  KR
Sbjct: 677 PEHHEISRHCKDLIRKLLSKNESKR 701

>CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31
          Length = 1336

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 56/177 (31%), Positives = 81/177 (45%), Gaps = 22/177 (12%)

Query: 118  GVIDFLN-TRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYK 176
            G ID  +       + E E   +   V  GV  +H     ++HRDIK EN+++   G  K
Sbjct: 1168 GSIDLFDLIEFKTNMTEIEAKLLFKQVVSGVKHLH--DQGIVHRDIKDENIIVDSQGFVK 1225

Query: 177  ICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDK--YSGYPIDEKSDIWAL 234
            I DFGSA  V   P           D+ + T   Y +PE++    Y G P     DIWA+
Sbjct: 1226 IIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGSPYEGKP----QDIWAI 1270

Query: 235  GVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNI 291
            G+ LY + +   PF    E  IL  + +F S    S+    +I  +LN++  KRP I
Sbjct: 1271 GILLYTIVFKENPFYNIDE--ILEGELKFNSSELVSEQCTTLIAKILNRNVQKRPTI 1325

>NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5.406
          Length = 1015

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 74/272 (27%), Positives = 125/272 (45%), Gaps = 37/272 (13%)

Query: 64  DKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFL 123
           D+  +  ++ EV  +  LK    I  Y  S+ + + L       +++MEYC+ G +   L
Sbjct: 73  DEDEVEDVQREVQFLSSLKQIPNITRYYGSYLKDTSL-------WIIMEYCAGGSLRSLL 125

Query: 124 NTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSA 183
                 ++ E  I  IM ++   +  +H  +  +IHRDIK  NVLI+  G  K+CDFG A
Sbjct: 126 RP---GKIDEKYIGVIMRELLVALKYIH--KDNVIHRDIKAANVLITNEGSVKLCDFGVA 180

Query: 184 CSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCY 243
             + +     Q  A          T  + +PE+I    G   D K DIW+LG+  Y++  
Sbjct: 181 AQLNQSTLRRQTMA---------GTPYWMAPEVI--MEGVYYDTKVDIWSLGITAYEIAT 229

Query: 244 YTTPF-EKEGENAI-LNVKFQFPSYP--QYSDHIRNIITIMLNKDPIKRPNICQVLEQVS 299
              P+ E E   A+ L  K + P      Y+  ++  I + L++DP +R +     E++S
Sbjct: 230 GNPPYCEVEALRAMQLITKSKPPRLESRSYTPLLKEFIALCLDEDPKERLSA----EELS 285

Query: 300 KLQGV------PCPIENFMLTRIKLQNSRNNS 325
           K + +      P  I   +++R  L   RN +
Sbjct: 286 KTKFIKAHKLTPVSILKELISRYLLFRDRNKA 317

>Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095W
            (BCK1) - MEKK serine/threonine kinase [contig 48] FULL
          Length = 1446

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 69/260 (26%), Positives = 114/260 (43%), Gaps = 38/260 (14%)

Query: 52   GTMACLKRVIVPDK--------SGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQG 103
            G M  +K+V VP          S L  LR+EV  +K L  +  IV Y+         +  
Sbjct: 1169 GEMIAVKQVEVPRYGSQDETTLSVLEALRSEVATLKDLD-HTNIVQYLG-------FENK 1220

Query: 104  EYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIK 163
             Y   L +EY + G V   +  RLY +  E  I  +   V +G++ +H  +  ++HRD+K
Sbjct: 1221 NYVYSLFLEYVAGGSVGSLI--RLYGKFDENLIRFLAVQVLRGLSYLHSKK--ILHRDMK 1276

Query: 164  IENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGY 223
             +N+L+  +G  KI DFG +              + + D+ +  T  + +PEM+D   GY
Sbjct: 1277 ADNLLLDVDGICKISDFGIS--------KKSNNIYSNSDMTMRGTVFWMAPEMVDTKQGY 1328

Query: 224  PIDEKSDIWALGVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIIT----- 278
                K DIW+LG  + ++     P+      A +    +F S P   +  + II+     
Sbjct: 1329 --SAKVDIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIGKFKSAPPIPEDTQKIISAEGKE 1386

Query: 279  ---IMLNKDPIKRPNICQVL 295
                    +P KRP   ++L
Sbjct: 1387 FLDACFEINPEKRPTADELL 1406

>Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL101W
           (REAL)
          Length = 1518

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 68/238 (28%), Positives = 114/238 (47%), Gaps = 33/238 (13%)

Query: 99  ELKQGEYEVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLI 158
           E+ + + E++L++EY   G + D+L ++   +L E E +     + +GV+  H     + 
Sbjct: 181 EVWENKSELYLVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQIVEGVSFCHSFN--IC 236

Query: 159 HRDIKIENVLI-SENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI 217
           HRD+K EN+L+  +N   KI DFG A   L P K  + +    H         Y SPE++
Sbjct: 237 HRDLKPENLLLDKKNRKIKIADFGMAALEL-PNKLLKTSCGSPH---------YASPEIV 286

Query: 218 --DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGENAIL----NVKFQFPSYPQYSD 271
               Y G P    SD+W+ G+ L+ L     PF  +    +L    + K+Q P     S 
Sbjct: 287 MGRPYHGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPM--NLSA 340

Query: 272 HIRNIITIMLNKDPIKRPNICQVLEQ--VSKLQGVPCPIENFMLTRIKLQN-SRNNSN 326
             R++I+ +L  +P KR    ++L    + K   +P    N M+ ++K  N +R  SN
Sbjct: 341 EARDLISKILVINPEKRITTQEILNHPLIKKYDNLPI---NKMIRKMKRDNMARGKSN 395

>ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOL045W and
            YAL017W (FUN31)
          Length = 1259

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/181 (32%), Positives = 85/181 (46%), Gaps = 25/181 (13%)

Query: 118  GVIDFLN-TRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYK 176
            G ID  +   L   + E E   +   V  G+  +H  +  ++HRDIK ENV++   G  K
Sbjct: 1091 GSIDLFDLIELKTNMTEHEAKLLFKQVASGLRHLH--ENGIVHRDIKDENVIVDNRGRVK 1148

Query: 177  ICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYSGYPIDEKSDIWAL 234
            I DFGSA  V R P           D+ + T   Y +PE++  D Y G P     D+WA+
Sbjct: 1149 IIDFGSAAYVKRGP----------FDVFVGTI-DYAAPEVLGGDPYEGKP----QDVWAV 1193

Query: 235  GVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRP---NI 291
            GV LY + Y   PF    E  IL+   +       S+    +IT +LN+   +RP   +I
Sbjct: 1194 GVLLYTIIYKENPFYNIDE--ILDGDLRISPAVVVSEECVALITRILNRSVNRRPTVDDI 1251

Query: 292  C 292
            C
Sbjct: 1252 C 1252

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
           YDR507C
          Length = 1125

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 97/201 (48%), Gaps = 32/201 (15%)

Query: 107 VFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIEN 166
           +++++EY  +G + + L  R    L E E ++    +  G++  H L   ++HRD+K EN
Sbjct: 103 LYMVLEYAEKGELFNLLVER--GPLPENEAIRFFRQIIIGISYCHAL--GIVHRDLKPEN 158

Query: 167 VLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTA---QYRSPEMIDK--YS 221
           +L+    + KI DFG              AA    D ++ T+     Y +PE++    Y 
Sbjct: 159 LLLDTKYNIKIADFGM-------------AALETEDKLLETSCGSPHYAAPEIVSGIPYH 205

Query: 222 GYPIDEKSDIWALGVFLYKLCYYTTPFEKEG---ENAILNV---KFQFPSYPQYSDHIRN 275
           G+     SD+W+ GV LY L     PF++E     N +L V   +F+ P   + S   +N
Sbjct: 206 GFA----SDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDEISKEAQN 261

Query: 276 IITIMLNKDPIKRPNICQVLE 296
           +I+ +L  +P +R     +L+
Sbjct: 262 LISKILVVNPAERITARDILK 282

>KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1164

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 53/193 (27%), Positives = 93/193 (48%), Gaps = 32/193 (16%)

Query: 107 VFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIEN 166
           +++++EY  +G + + L  R    L E E ++    +  G++  H L   ++HRD+K EN
Sbjct: 112 LYMVLEYVEKGELFNLLVDR--GPLPENEAVRFFRQIIIGISYCHALG--IVHRDLKPEN 167

Query: 167 VLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTA---QYRSPEMIDK--YS 221
           +L+    + KI DFG              AA    D ++ T+     Y +PE++    Y 
Sbjct: 168 LLLDHKFNIKIADFGM-------------AALESKDKLLETSCGSPHYAAPEIVSGLPYH 214

Query: 222 GYPIDEKSDIWALGVFLYKLCYYTTPFEKEG---ENAILNV---KFQFPSYPQYSDHIRN 275
           G+    +SD+W+ G+ L+ L     PF++E     N +L V   KF+ P   + S   ++
Sbjct: 215 GF----ESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGKFEMPDTNEISGEAQD 270

Query: 276 IITIMLNKDPIKR 288
           +I  +L  DP  R
Sbjct: 271 LIAKILTVDPAAR 283

>NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]
           {ON} Anc_3.92
          Length = 1113

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/201 (29%), Positives = 97/201 (48%), Gaps = 19/201 (9%)

Query: 102 QGEYEVFLLMEYCSRGGVIDFLNT-RLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHR 160
           Q E  ++ L+EY   G   DFL+  + Y  L E       + +   +  MH     +IHR
Sbjct: 239 QDEASLYFLLEYAPNG---DFLSVMKKYGSLNEECACYYGAQILDAIGFMHTRG--IIHR 293

Query: 161 DIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAF--IHHDIMINTTAQYRSPEMI- 217
           DIK EN+L+ ++   KI DFG+A  +        + ++  +        TA+Y SPE++ 
Sbjct: 294 DIKPENILMDKDMKVKITDFGTAKILDEKTNGNNKTSYELLTRSKSFVGTAEYVSPELLN 353

Query: 218 DKYSGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGE----NAILNVKFQFPSYPQYSDHI 273
           D YS    D + DIWA G  LY++     PF+   E      ++ V++ F +   +   I
Sbjct: 354 DNYS----DSRCDIWAFGCILYQMIAGKPPFKATNEYLTFQKVMKVQYAFTA--GFPTII 407

Query: 274 RNIITIMLNKDPIKRPNICQV 294
           R++I  +L K P +R  I Q+
Sbjct: 408 RDLIKRILLKVPEQRLTIGQI 428

>KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1142

 Score = 80.5 bits (197), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/215 (27%), Positives = 107/215 (49%), Gaps = 22/215 (10%)

Query: 108 FLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENV 167
           ++L EY S G ++D++    +  L+E    K    +   +  +H     ++HRD+KIEN+
Sbjct: 284 YMLFEYVSGGQLLDYIIQ--HGSLRERSARKFARGIASALQYLHLNN--IVHRDLKIENI 339

Query: 168 LISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDK--YSGYPI 225
           +IS +G+ KI DFG + ++  P K  Q   F         +  + +PE++    Y+G   
Sbjct: 340 MISTSGEIKIIDFGLS-NMFNPKK--QLHTFC-------GSLYFAAPELLKACPYTG--- 386

Query: 226 DEKSDIWALGVFLYKLCYYTTPFEKEGENAIL-NVKFQFPSYPQY-SDHIRNIITIMLNK 283
             + D+W+ GV LY L     PF+ E  + +   +K     YPQ+ S  + ++++ ML  
Sbjct: 387 -PEVDVWSFGVVLYVLVCGKVPFDDENSSVLHEKIKQGKVEYPQHLSIEVISLLSKMLVV 445

Query: 284 DPIKRPNICQVLEQVSKLQGVPCPIENFMLTRIKL 318
           DP KR  + QV+      +G   P  +++  R+ L
Sbjct: 446 DPSKRATLKQVVNHQWMQRGYDFPAPSYIPHRVPL 480

>NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON} 
          Length = 1258

 Score = 80.5 bits (197), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 60/218 (27%), Positives = 108/218 (49%), Gaps = 28/218 (12%)

Query: 108 FLLMEYCSRGGVIDFLNTRLYH-RLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIEN 166
           ++L EY S G ++D++   + H  L+E    K    +   +  +H     ++HRD+KIEN
Sbjct: 264 YMLFEYVSGGQLLDYI---IQHGSLREHHARKFARGIASALQYLHLNN--IVHRDLKIEN 318

Query: 167 VLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDK--YSGYP 224
           ++IS +G+ KI DFG   +V    K  Q   F         +  + +PE++    Y+G  
Sbjct: 319 IMISNSGEIKIIDFG-LSNVFDNRK--QLHTFC-------GSLYFAAPELLKAHPYTGPE 368

Query: 225 IDEKSDIWALGVFLYKLCYYTTPFEKEGENA----ILNVKFQFPSYPQYSDHIRNIITIM 280
           +    D+W+ G+ LY L     PF+ E  +     I   K ++P++   S  + ++++ M
Sbjct: 369 V----DVWSFGIVLYVLVCGKVPFDDENSSVLHEKIRQGKVEYPNH--LSIEVISLLSKM 422

Query: 281 LNKDPIKRPNICQVLEQVSKLQGVPCPIENFMLTRIKL 318
           +  DP KR ++ QV+E     +G   P  +++  RI L
Sbjct: 423 IVVDPAKRASLRQVVEHPWMTRGYDFPPLSYLPRRIPL 460

>KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {ON}
           Anc_1.182 YJL164C
          Length = 401

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 99/191 (51%), Gaps = 33/191 (17%)

Query: 106 EVFLLMEYCSRGGVIDFLNTRLYHRLQEFE--ILKIMS-DVCQGVAAMHYLQPPLIHRDI 162
           +VF++M+Y   G +   L      + Q F   + K  + +VC  +  +H L   +I+RD+
Sbjct: 163 QVFMVMDYIEGGELFSLLR-----KSQRFPTPVAKFYAAEVCLALEYLHNLD--IIYRDL 215

Query: 163 KIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSG 222
           K EN+L+ +NG  KI DFG A  V  P  T            +  T  Y +PE++   S 
Sbjct: 216 KPENILLDKNGHIKITDFGFAKYV--PDVT----------YTLCGTPDYIAPEVM---ST 260

Query: 223 YPIDEKSDIWALGVFLYKLCYYTTPFE-----KEGENAILNVKFQFPSYPQYSDHIRNII 277
            P ++  D W+ GV +Y++    TPF      K  EN ILN K +FPS+  + D +++++
Sbjct: 261 KPYNKSVDWWSFGVLIYEMLAGHTPFYDSNAMKTYEN-ILNAKLKFPSF--FHDDVKDLL 317

Query: 278 TIMLNKDPIKR 288
           T ++N+D  +R
Sbjct: 318 TRLINRDLSQR 328

>SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} similar
           to uniprot|Q03306 Saccharomyces cerevisiae YDR466W
          Length = 784

 Score = 80.1 bits (196), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 79/294 (26%), Positives = 134/294 (45%), Gaps = 47/294 (15%)

Query: 20  HQVIIEKYLACGGFAQVYSVRVIDSSNARNELG-------TMACLKRVIVPDKSGLNTLR 72
           H  I ++ L  G ++ VY  + +D   ARN  G          C K+ I+  ++ +  + 
Sbjct: 8   HDFIFKEQLGHGSYSTVY--KALD--KARNNSGLPQHFYAIKVCSKKHII-RENKVKYVT 62

Query: 73  AEVDAMKLL-KGN--KYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNTRLYH 129
            E + + LL +GN    +  Y   H Q +        ++ +++Y   G ++  L      
Sbjct: 63  IEKNTLNLLAQGNNPGIVKLYYTFHDQEN--------LYFVLDYAPGGELLHLL-----Q 109

Query: 130 RLQEFEILKIMSDVCQGVAAMHYLQPP-LIHRDIKIENVLISENGDYKICDFGSACSVLR 188
           R   F+ +     +CQ V  + Y+    +IHRD+K ENVL+S++G   + DFG+A SV+ 
Sbjct: 110 RYGTFDEVWSKHFMCQLVDVVEYIHSKGVIHRDLKPENVLLSKDGRLMVTDFGAA-SVVT 168

Query: 189 PPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPF 248
              T  + +          TA+Y SPE++     +     SDIWALG  LY+    + PF
Sbjct: 169 TDGTSSDNSVSERAASFVGTAEYVSPELLLNNQCF---FSSDIWALGCILYQFMQGSPPF 225

Query: 249 EKEGENAI--------LNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQV 294
              GEN +        L+  ++    P   D +R+I+ I    DP +R +I  +
Sbjct: 226 --RGENELQTFEKIVSLDYHWKLAVNPSVMDLVRHILVI----DPHERLSISAI 273

>KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.140
           YGL179C
          Length = 909

 Score = 80.1 bits (196), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 71/271 (26%), Positives = 126/271 (46%), Gaps = 61/271 (22%)

Query: 71  LRAEVDAMKLLKGNKY-----IVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFLNT 125
           +R E++ +K  K NK+     +   +D    R        +++L++EYC  GG I +   
Sbjct: 144 IRKEINILK--KCNKHPNIIKLFEVLDDFKSR--------KIYLILEYCP-GGEIRWCAE 192

Query: 126 RLYHR------LQEFEILK-IMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKIC 178
            ++        L  F+  + ++ DV  G+  +H LQ  +IHRDIK  N+L+S+ G  KI 
Sbjct: 193 NVHELSAKGPPLISFQRSREMLRDVISGLEYLH-LQG-IIHRDIKPANLLLSQEGTVKIS 250

Query: 179 DFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI------DKY------------ 220
           DFG +          ++  F+   I    T  + +PE+       DK+            
Sbjct: 251 DFGVSFMNADKANNTKKEDFLAL-IKTEGTPAFFAPEICLGDEIWDKFHINKSIPGLNAN 309

Query: 221 SGYPIDEKSDIWALGV----FLYKLCYYTTPFEKEGENAILNVKFQFP------------ 264
             Y I EK D+WALGV    FL+ +  +++ FE +  + I+N   +FP            
Sbjct: 310 DEYYITEKIDVWALGVTAFCFLFGMLPFSSNFELKLFDKIVNRSLKFPNCAKLSRCPASK 369

Query: 265 -SYPQYSDHIRNIITIMLNKDPIKRPNICQV 294
            + P   +  +N I ++L K+P++RP++ ++
Sbjct: 370 LTSPHELESAKNFIELLLTKNPMERPSVSEI 400

>TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa]
           {ON} Anc_1.182 YJL164C
          Length = 426

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 73/272 (26%), Positives = 125/272 (45%), Gaps = 43/272 (15%)

Query: 24  IEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRVIVPDKSGLNTLRAEVDAMKLLKG 83
           I + L  G F +V+ VR    SN       M  LK+  V     +     E   + L+  
Sbjct: 118 IMRTLGTGSFGRVHLVR----SNHNGRFYAMKVLKKHTVVKLKQVEHTNDERRMLSLVT- 172

Query: 84  NKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVIDFL--NTRLYHRLQEFEILKIMS 141
           + ++V    +        Q   +VF++M+Y   G +   L  + R  + + +F      +
Sbjct: 173 HPFLVRMWGTF-------QDSQQVFMIMDYIEGGELFSLLRKSQRFPNPVAKF----YAA 221

Query: 142 DVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHH 201
           +VC  +  +H     +I+RD+K EN+L+ +NG  KI DFG A  V  P  T         
Sbjct: 222 EVCLALEYLH--SNDIIYRDLKPENILLDKNGHIKITDFGFAKYV--PDVT--------- 268

Query: 202 DIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYKLCYYTTPFE-----KEGENAI 256
              +  T  Y +PE+I   S  P ++  D W+ G+ +Y++    TPF      K  EN I
Sbjct: 269 -YTLCGTPDYIAPEVI---STKPYNKSVDWWSFGILIYEMLAGYTPFYDSNTMKTYEN-I 323

Query: 257 LNVKFQFPSYPQYSDHIRNIITIMLNKDPIKR 288
           LN   +FPS+  + D ++++++ ++ +D  KR
Sbjct: 324 LNTTLKFPSF--FHDDVKDLLSKLIARDLSKR 353

>YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One of two
            (see also PSK2) PAS domain containing S/T protein
            kinases; coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1356

 Score = 80.1 bits (196), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 82/177 (46%), Gaps = 22/177 (12%)

Query: 118  GVIDFLN-TRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYK 176
            G ID  +       + EFE   I   V  G+  +H     ++HRDIK ENV++   G  K
Sbjct: 1188 GCIDLFDLIEFKTNMTEFEAKLIFKQVVAGIKHLH--DQGIVHRDIKDENVIVDSKGFVK 1245

Query: 177  ICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMI--DKYSGYPIDEKSDIWAL 234
            I DFGSA  V   P           D+ + T   Y +PE++  + Y G P     DIWA+
Sbjct: 1246 IIDFGSAAYVKSGP----------FDVFVGTI-DYAAPEVLGGNPYEGQP----QDIWAI 1290

Query: 235  GVFLYKLCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNI 291
            G+ LY + +   PF    E  IL    +F +  + S+    +I  +LN+   KRP I
Sbjct: 1291 GILLYTVVFKENPFYNIDE--ILEGDLKFNNAEEVSEDCIELIKSILNRCVPKRPTI 1345

>AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR096W (KIN2) and
           YDR122W (KIN1)
          Length = 1071

 Score = 80.1 bits (196), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 62/221 (28%), Positives = 107/221 (48%), Gaps = 22/221 (9%)

Query: 108 FLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENV 167
           ++L EY S G ++D++    +  L+E    K    +   +  +H     ++HRD+KIEN+
Sbjct: 156 YMLFEYVSGGQLLDYIIQ--HGSLRERHARKFARGIASALQYLHLNN--IVHRDLKIENI 211

Query: 168 LISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDK--YSGYPI 225
           +IS +G+ +I DFG   S +  PK  Q   F         +  + +PE++    Y+G  +
Sbjct: 212 MISSSGEIRIIDFG--LSNMYDPKK-QLHTFC-------GSLYFAAPELLKAHPYTGPEV 261

Query: 226 DEKSDIWALGVFLYKLCYYTTPFEKEGENAIL-NVKFQFPSYPQY-SDHIRNIITIMLNK 283
               DIW+ GV LY L     PF+ E  + +   +K     YPQ+ S  + ++++ ML  
Sbjct: 262 ----DIWSFGVVLYVLVCGKVPFDDENASVLHEKIKQGKVEYPQHLSIDVISLLSKMLVV 317

Query: 284 DPIKRPNICQVLEQVSKLQGVPCPIENFMLTRIKLQNSRNN 324
           DP KR  + QV+      +G   P  +++   + L   R N
Sbjct: 318 DPYKRATLKQVVHHQWMQKGYDFPPPSYLPPCVPLTPDRIN 358

>Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa]
           {ON} YDR507C (REAL)
          Length = 1136

 Score = 80.1 bits (196), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 56/202 (27%), Positives = 98/202 (48%), Gaps = 32/202 (15%)

Query: 106 EVFLLMEYCSRGGVIDFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIE 165
           +++L++EY  +G + + L  R    L E E ++    +  GV+  H L   ++HRD+K E
Sbjct: 105 DLYLVLEYAEKGELFNLLVER--GPLPENEAIRFFRQIIIGVSYCHALG--IVHRDLKPE 160

Query: 166 NVLISENGDYKICDFGSACSVLRPPKTPQEAAFIHHDIMINTTA---QYRSPEMIDK--Y 220
           N+L+    + KI DFG              AA      ++ T+     Y +PE++    Y
Sbjct: 161 NLLLDHKYNIKIADFGM-------------AALETEGKLLETSCGSPHYAAPEIVSGIPY 207

Query: 221 SGYPIDEKSDIWALGVFLYKLCYYTTPFEKEGEN---AILNVK---FQFPSYPQYSDHIR 274
            G+     SD+W+ GV L+ L     PF++E  N    +L V+   F+ PS  + S   +
Sbjct: 208 QGFA----SDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFELPSDDEISREAQ 263

Query: 275 NIITIMLNKDPIKRPNICQVLE 296
           ++I+ +L  DP +R     +L+
Sbjct: 264 DLISRILTVDPERRIKTRDILK 285

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.128    0.359 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 126,909,909
Number of extensions: 5123484
Number of successful extensions: 30912
Number of sequences better than 10.0: 2121
Number of HSP's gapped: 30268
Number of HSP's successfully gapped: 2233
Length of query: 1443
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1321
Effective length of database: 39,492,147
Effective search space: 52169126187
Effective search space used: 52169126187
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 72 (32.3 bits)