Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0B064102.531ON44944916890.0
NCAS0J00640na 1ON102542363e-23
Kpol_495.20singletonON486662405e-21
Kpol_1018.352.531ON517592381e-20
NCAS0B05750singletonON505582282e-19
NDAI0B030808.116ON460752245e-19
KAFR0A018402.531ON414672219e-19
NDAI0C06260na 1ON582562202e-18
ZYRO0E02684g8.116ON133642024e-18
TPHA0A04530singletonON501612113e-17
NDAI0B02080singletonON273621973e-16
TDEL0F011708.116ON162571885e-16
KNAG0D022808.117ON435591996e-16
SAKL0A09438g2.531ON441591971e-15
Kpol_541.398.116ON291621931e-15
Suva_16.3388.117ON247601901e-15
Skud_16.2988.116ON317601932e-15
Smik_16.2538.116ON317601932e-15
Skud_16.3008.117ON249601892e-15
YPR013C8.116ON317601922e-15
Suva_16.3358.116ON317601922e-15
YPR015C8.117ON247601882e-15
Smik_16.2558.117ON247601883e-15
KAFR0B019908.116ON410601915e-15
NCAS0C042308.117ON338611887e-15
Ecym_8387na 2ON179671808e-15
AEL077Wna 3ON336621889e-15
NCAS0F00910singletonON350571881e-14
SAKL0H20416g8.116ON317581871e-14
Kwal_26.80112.531ON190541791e-14
KNAG0G011408.117ON519571892e-14
KLTH0D06798g2.531ON111541722e-14
Ecym_1383na 3ON381681853e-14
CAGL0L05786g8.116ON348611843e-14
CAGL0J01595g8.117ON344561834e-14
Kwal_14.22068.117ON254551804e-14
KLLA0F20636gsingletonON285511814e-14
SAKL0H20394g8.117ON359651834e-14
Ecym_8377na 4ON310641806e-14
KLTH0H08800g8.117ON168531729e-14
Ecym_8388na 5ON223571751e-13
ADL050Wna 2ON146511691e-13
NCAS0F009202.531ON354591792e-13
KAFR0B020008.117ON303601772e-13
KNAG0D022908.116ON435561802e-13
KAFR0C031408.117ON370591772e-13
AGL207W3.298ON277561742e-13
SAKL0D02618g3.298ON321561763e-13
ADL051Wna 5ON173581683e-13
NCAS0B046708.116ON266601733e-13
NDAI0B019408.116ON336571754e-13
KAFR0C003403.298ON394531747e-13
ADL040Wna 4ON330541728e-13
NCAS0B046608.117ON256581708e-13
AGR186Cna 6ON287541718e-13
TBLA0E039308.116ON462621741e-12
Ecym_26733.298ON301561701e-12
Ecym_4128na 6ON312541692e-12
KLTH0C04884g3.298ON342611683e-12
Ecym_8011na 7ON276641654e-12
KNAG0J022503.296ON296561655e-12
KLLA0F11682g3.298ON374571676e-12
NDAI0A075403.298ON370581658e-12
ADR308Cna 7ON278561638e-12
Kpol_1052.83.298ON386561641e-11
KLLA0A04609gsingletonON423561632e-11
CAGL0M01870g3.298ON315531593e-11
Ecym_8379na 8ON305511584e-11
NCAS0I014603.298ON330531586e-11
Kwal_27.104673.298ON302661568e-11
TPHA0A039103.298ON351561561e-10
TBLA0G032403.298ON511561571e-10
ADL042Wna 8ON281511531e-10
Kpol_1065.483.298ON364561498e-10
SAKL0A10582gsingletonON288581471e-09
Ecym_8389singletonON251511451e-09
KLLA0F22319gsingletonON203471403e-09
KNAG0H010703.298ON322561434e-09
KAFR0H012903.298ON330531434e-09
TBLA0I020603.298ON833581438e-09
SAKL0D15136gsingletonON271541371e-08
ACR264W2.162ON769561349e-08
NCAS0A091601.326ON773551322e-07
KNAG0I020702.162ON572561303e-07
Ecym_62951.326ON663551294e-07
SAKL0E10714g2.162ON819561276e-07
ZYRO0G20526g1.326ON849551277e-07
Ecym_54242.162ON775561277e-07
TDEL0B052502.162ON714561269e-07
SAKL0A10648gsingletonON261561221e-06
NDAI0G058001.326ON836541251e-06
Kwal_47.178882.162ON786561251e-06
TDEL0D019501.326ON755551251e-06
ZYRO0A02288g2.303ON619551242e-06
KLTH0E09724g2.162ON768541242e-06
TPHA0G03750singletonON346351212e-06
NDAI0B042902.162ON1064541232e-06
TBLA0B012802.162ON823531223e-06
CAGL0K12078g3.281ON463571213e-06
Kpol_1072.582.162ON794561223e-06
TPHA0B029102.162ON717541214e-06
Kpol_1050.193.518ON221541164e-06
KAFR0C04550singletonON467521204e-06
SAKL0E07216g2.303ON548591204e-06
Suva_6.1321.326ON878621215e-06
TPHA0A058203.518ON276521175e-06
Smik_10.1841.326ON885561205e-06
Ecym_33412.303ON560551195e-06
CAGL0L03916g2.162ON642531196e-06
YOR113W (AZF1)2.162ON914561206e-06
KAFR0B045802.162ON729561196e-06
Suva_14.3182.303ON681591197e-06
Skud_15.2762.162ON917561197e-06
ZYRO0B16148g2.162ON930561197e-06
Suva_8.1662.162ON948561197e-06
KLLA0F23782g2.162ON782561198e-06
Smik_15.2912.162ON909561198e-06
TBLA0F013001.326ON985531189e-06
Kwal_14.25431.326ON711561189e-06
Smik_14.3032.303ON673591171e-05
Skud_14.3012.303ON682591171e-05
YNL027W (CRZ1)2.303ON678591171e-05
YJL056C (ZAP1)1.326ON880561171e-05
TPHA0O014401.326ON778591171e-05
CAGL0J05060g1.326ON713561171e-05
Skud_10.1521.326ON879561171e-05
KNAG0E026101.326ON746551171e-05
SAKL0D06776g1.326ON767551171e-05
TDEL0G023302.303ON506551161e-05
ZYRO0E08426g3.518ON171631102e-05
Kpol_489.4na 9ON339431142e-05
KAFR0C004903.281ON224661122e-05
NCAS0G037302.303ON571571152e-05
AEL174W1.326ON661541162e-05
KLTH0H10538g1.326ON682561162e-05
ZYRO0G09438g4.80ON329531142e-05
Kwal_27.109253.281ON264631122e-05
AGL197W8.326ON844511152e-05
Kwal_23.54007.543ON429541133e-05
KLTH0G10802g2.303ON526621133e-05
KNAG0H019302.303ON618711133e-05
NCAS0A018204.80ON455761123e-05
CAGL0I02816gsingletonOFF291551114e-05
KLTH0G01826g3.518ON307531114e-05
CAGL0M06831g2.303ON645551124e-05
NCAS0B069602.162ON839541124e-05
ADL198W2.303ON547551124e-05
KAFR0H032402.303ON519511116e-05
AGR031W3.281ON140591046e-05
Kpol_1035.221.326ON797541116e-05
Kpol_1003.502.303ON614551116e-05
Kwal_47.190453.518ON266531087e-05
Kwal_27.114602.303ON531531108e-05
NDAI0G025608.326ON794551091e-04
ZYRO0C13508g3.281ON189691041e-04
KLLA0E08713g2.303ON596551081e-04
TPHA0G008202.303ON532571081e-04
Ecym_26543.281ON257571061e-04
TDEL0D034303.281ON175581031e-04
ZYRO0F10428g8.326ON813511081e-04
NDAI0I029003.518ON524601081e-04
Skud_5.1373.518ON394541071e-04
TPHA0F018102.162ON425551062e-04
CAGL0E01331g8.326ON689511072e-04
KAFR0H022408.326ON623501062e-04
CAGL0M04323g8.326ON703481062e-04
KNAG0H034802.162ON796521062e-04
SAKL0D03146g3.281ON157561002e-04
AFR471C4.80ON389511052e-04
KNAG0J008703.281ON280701033e-04
Kwal_27.10167na 10ON285561034e-04
SAKL0A09482g2.533ON388521034e-04
KLTH0A00682g7.543ON433531044e-04
YPR186C (PZF1)7.543ON429481035e-04
TDEL0D058603.518ON330521025e-04
KLTH0C07172g3.281ON265631016e-04
TPHA0C041902.533ON417541026e-04
TPHA0A039803.281ON314601017e-04
KLTH0D08734g2.598ON677551027e-04
AEL278W7.543ON476491027e-04
TDEL0B069102.598ON437551017e-04
Kwal_26.83512.598ON698551027e-04
KAFR0A008001.326ON753521028e-04
NCAS0F037403.518ON288531008e-04
TPHA0M011803.281ON350601008e-04
KNAG0D037104.80ON459531019e-04
Suva_4.3053.281ON22061980.001
Suva_13.2062.598ON709541010.001
TBLA0B060502.303ON762591010.001
NCAS0A129102.598ON822561010.001
Klac_YGOB_Anc_3.5183.518ON23957980.001
KLLA0B03454g7.543ON472481000.001
Ecym_14154.80ON504511000.001
KNAG0E016003.518ON33852990.001
Kpol_1036.708.326ON674511000.001
CAGL0C02519g3.518ON31853980.001
NCAS0E00170na 9ON32743980.001
Kpol_1050.116singletonON32959980.001
Smik_2.1993.281ON22060960.001
YBR066C (NRG2)3.281ON22060960.001
TDEL0F026904.80ON35053980.002
ZYRO0F01012g2.598ON58455990.002
NDAI0B013402.598ON76955990.002
Smik_5.1513.518ON38852980.002
NDAI0G007202.303ON70855990.002
AGL071C2.533ON39652980.002
CAGL0M13189g2.598ON54155980.002
Skud_2.1893.281ON22060960.002
Kwal_56.239258.326ON74551990.002
TPHA0K017704.80ON51853980.002
CAGL0A01628g4.80ON42453970.002
TDEL0F045108.326ON74351980.002
KLLA0A10373gna 10ON20661950.002
Kpol_505.152.162ON51056970.002
SAKL0B11330g2.598ON49955970.003
YMR037C (MSN2)2.598ON70454970.003
Skud_16.4907.543ON40748960.003
Smik_16.4507.543ON43248960.003
NCAS0C032408.326ON62071970.003
NCAS0I015603.281ON26658950.003
SAKL0F00242gsingletonON29144950.003
Kpol_1018.332.533ON58952970.003
Kpol_185.32.598ON64755970.003
YKL062W (MSN4)2.598ON63055970.003
NDAI0B060203.518ON42675960.003
ABR089C2.598ON57162960.003
TPHA0N014602.598ON51955960.003
SAKL0H20988g4.80ON54851960.003
TBLA0A089104.80ON39053950.004
KLLA0F01463g1.326ON78148960.004
Suva_7.2404.80ON51553960.004
Ecym_72552.533ON54452960.004
Smik_11.1862.598ON64155960.004
KLTH0E06688g8.144ON39752950.004
Skud_11.1672.598ON62855950.004
SAKL0F16170g7.543ON43748950.004
Suva_7.523.518ON40052950.004
TPHA0D034003.518ON33855940.005
Skud_13.1932.598ON70454950.005
YER028C (MIG3)3.518ON39454940.005
Ecym_23012.598ON76762950.005
KNAG0M023102.598ON66054950.005
Kpol_1065.153.281ON22055920.005
YGL035C (MIG1)4.80ON50453950.005
CAGL0K09372g3.518ON39652940.005
Smik_13.2072.598ON70354950.005
KAFR0J003402.533ON21852920.005
KLLA0E18547g2.533ON43152940.005
SAKL0B12672gsingletonON28544930.005
Kwal_47.172418.144ON40352940.005
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0B06410
         (449 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0B06410 Chr2 (1511970..1513319) [1350 bp, 449 aa] {ON} Anc_2...   655   0.0  
NCAS0J00640 Chr10 complement(98043..98351) [309 bp, 102 aa] {ON}       96   3e-23
Kpol_495.20 s495 (65876..67336) [1461 bp, 486 aa] {ON} (65876..6...    97   5e-21
Kpol_1018.35 s1018 (118605..120158) [1554 bp, 517 aa] {ON} (1186...    96   1e-20
NCAS0B05750 Chr2 complement(1093346..1094863) [1518 bp, 505 aa] ...    92   2e-19
NDAI0B03080 Chr2 complement(785326..786708) [1383 bp, 460 aa] {O...    91   5e-19
KAFR0A01840 Chr1 complement(379714..380958) [1245 bp, 414 aa] {O...    90   9e-19
NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON}             89   2e-18
ZYRO0E02684g Chr5 (208420..208821) [402 bp, 133 aa] {ON} weakly ...    82   4e-18
TPHA0A04530 Chr1 (1027935..1029440) [1506 bp, 501 aa] {ON}             86   3e-17
NDAI0B02080 Chr2 (520660..521481) [822 bp, 273 aa] {ON}                80   3e-16
TDEL0F01170 Chr6 (209707..210195) [489 bp, 162 aa] {ON} Anc_8.11...    77   5e-16
KNAG0D02280 Chr4 (393332..394639) [1308 bp, 435 aa] {ON}               81   6e-16
SAKL0A09438g Chr1 complement(823711..825036) [1326 bp, 441 aa] {...    80   1e-15
Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON...    79   1e-15
Suva_16.338 Chr16 complement(594847..595590) [744 bp, 247 aa] {O...    78   1e-15
Skud_16.298 Chr16 complement(548954..549907) [954 bp, 317 aa] {O...    79   2e-15
Smik_16.253 Chr16 complement(460778..461731) [954 bp, 317 aa] {O...    79   2e-15
Skud_16.300 Chr16 complement(554576..555325) [750 bp, 249 aa] {O...    77   2e-15
YPR013C Chr16 complement(584632..585585) [954 bp, 317 aa] {ON} P...    79   2e-15
Suva_16.335 Chr16 complement(588678..589631) [954 bp, 317 aa] {O...    79   2e-15
YPR015C Chr16 complement(590283..591026) [744 bp, 247 aa] {ON} P...    77   2e-15
Smik_16.255 Chr16 complement(465909..466652) [744 bp, 247 aa] {O...    77   3e-15
KAFR0B01990 Chr2 complement(386456..387688) [1233 bp, 410 aa] {O...    78   5e-15
NCAS0C04230 Chr3 (869169..870185) [1017 bp, 338 aa] {ON}               77   7e-15
Ecym_8387 Chr8 complement(790075..790614) [540 bp, 179 aa] {ON} ...    74   8e-15
AEL077W Chr5 (483028..484038) [1011 bp, 336 aa] {ON} NOHBY506; N...    77   9e-15
NCAS0F00910 Chr6 (183289..184341) [1053 bp, 350 aa] {ON}               77   1e-14
SAKL0H20416g Chr8 (1789596..1790549) [954 bp, 317 aa] {ON} weakl...    77   1e-14
Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON...    74   1e-14
KNAG0G01140 Chr7 complement(251500..253059) [1560 bp, 519 aa] {O...    77   2e-14
KLTH0D06798g Chr4 complement(594639..594974) [336 bp, 111 aa] {O...    71   2e-14
Ecym_1383 Chr1 complement(791514..792659) [1146 bp, 381 aa] {ON}...    76   3e-14
CAGL0L05786g Chr12 complement(638173..639219) [1047 bp, 348 aa] ...    75   3e-14
CAGL0J01595g Chr10 (151584..152618) [1035 bp, 344 aa] {ON} some ...    75   4e-14
Kwal_14.2206 s14 (656346..657110) [765 bp, 254 aa] {ON} YPR015C ...    74   4e-14
KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa] ...    74   4e-14
SAKL0H20394g Chr8 (1787390..1788469) [1080 bp, 359 aa] {ON} weak...    75   4e-14
Ecym_8377 Chr8 complement(764541..765473) [933 bp, 310 aa] {ON} ...    74   6e-14
KLTH0H08800g Chr8 (762417..762923) [507 bp, 168 aa] {ON} some si...    71   9e-14
Ecym_8388 Chr8 complement(794615..795286) [672 bp, 223 aa] {ON} ...    72   1e-13
ADL050W Chr4 (597226..597666) [441 bp, 146 aa] {ON} NOHBY403; No...    70   1e-13
NCAS0F00920 Chr6 (185346..186410) [1065 bp, 354 aa] {ON} Anc_2.531     74   2e-13
KAFR0B02000 Chr2 complement(392263..393174) [912 bp, 303 aa] {ON...    73   2e-13
KNAG0D02290 Chr4 complement(397174..398481) [1308 bp, 435 aa] {O...    74   2e-13
KAFR0C03140 Chr3 (629556..630668) [1113 bp, 370 aa] {ON}               73   2e-13
AGL207W Chr7 (310750..311583) [834 bp, 277 aa] {ON} NOHBY712; No...    72   2e-13
SAKL0D02618g Chr4 complement(208093..209058) [966 bp, 321 aa] {O...    72   3e-13
ADL051W Chr4 (595493..596014) [522 bp, 173 aa] {ON} NOHBY404; No...    69   3e-13
NCAS0B04670 Chr2 (852849..853649) [801 bp, 266 aa] {ON}                71   3e-13
NDAI0B01940 Chr2 complement(472594..473604) [1011 bp, 336 aa] {O...    72   4e-13
KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}...    72   7e-13
ADL040W Chr4 (618852..619844) [993 bp, 330 aa] {ON} Syntenic hom...    71   8e-13
NCAS0B04660 Chr2 (850607..851377) [771 bp, 256 aa] {ON}                70   8e-13
AGR186C Chr7 complement(1099507..1100370) [864 bp, 287 aa] {ON} ...    70   8e-13
TBLA0E03930 Chr5 complement(990944..992332) [1389 bp, 462 aa] {O...    72   1e-12
Ecym_2673 Chr2 complement(1297046..1297951) [906 bp, 301 aa] {ON...    70   1e-12
Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to...    70   2e-12
KLTH0C04884g Chr3 complement(422344..423372) [1029 bp, 342 aa] {...    69   3e-12
Ecym_8011 Chr8 complement(26472..27302) [831 bp, 276 aa] {ON} si...    68   4e-12
KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON}               68   5e-12
KLLA0F11682g Chr6 complement(1068992..1070116) [1125 bp, 374 aa]...    69   6e-12
NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON} Anc_3...    68   8e-12
ADR308C Chr4 complement(1241867..1242703) [837 bp, 278 aa] {ON} ...    67   8e-12
Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON...    68   1e-11
KLLA0A04609g Chr1 complement(411494..412765) [1272 bp, 423 aa] {...    67   2e-11
CAGL0M01870g Chr13 complement(219813..220760) [948 bp, 315 aa] {...    66   3e-11
Ecym_8379 Chr8 complement(768914..769831) [918 bp, 305 aa] {ON} ...    65   4e-11
NCAS0I01460 Chr9 complement(268223..269215) [993 bp, 330 aa] {ON...    65   6e-11
Kwal_27.10467 s27 complement(354071..354979) [909 bp, 302 aa] {O...    65   8e-11
TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {O...    65   1e-10
TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298     65   1e-10
ADL042W Chr4 (615815..616660) [846 bp, 281 aa] {ON} Syntenic hom...    64   1e-10
Kpol_1065.48 s1065 complement(127243..128337) [1095 bp, 364 aa] ...    62   8e-10
SAKL0A10582g Chr1 complement(930343..931209) [867 bp, 288 aa] {O...    61   1e-09
Ecym_8389 Chr8 (797626..798381) [756 bp, 251 aa] {ON} similar to...    60   1e-09
KLLA0F22319g Chr6 complement(2086613..2087224) [612 bp, 203 aa] ...    59   3e-09
KNAG0H01070 Chr8 complement(178080..179048) [969 bp, 322 aa] {ON...    60   4e-09
KAFR0H01290 Chr8 complement(243463..244455) [993 bp, 330 aa] {ON...    60   4e-09
TBLA0I02060 Chr9 (465675..468176) [2502 bp, 833 aa] {ON} Anc_3.298     60   8e-09
SAKL0D15136g Chr4 (1255926..1256741) [816 bp, 271 aa] {ON} some ...    57   1e-08
ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic ho...    56   9e-08
NCAS0A09160 Chr1 (1811448..1813769) [2322 bp, 773 aa] {ON} Anc_1...    55   2e-07
KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.1...    55   3e-07
Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}...    54   4e-07
SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly...    54   6e-07
ZYRO0G20526g Chr7 (1691182..1693731) [2550 bp, 849 aa] {ON} weak...    54   7e-07
Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar t...    54   7e-07
TDEL0B05250 Chr2 complement(922332..924476) [2145 bp, 714 aa] {O...    53   9e-07
SAKL0A10648g Chr1 (934819..935604) [786 bp, 261 aa] {ON} some si...    52   1e-06
NDAI0G05800 Chr7 complement(1436085..1438595) [2511 bp, 836 aa] ...    53   1e-06
Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113...    53   1e-06
TDEL0D01950 Chr4 complement(377508..379775) [2268 bp, 755 aa] {O...    53   1e-06
ZYRO0A02288g Chr1 (181918..183777) [1860 bp, 619 aa] {ON} simila...    52   2e-06
KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly...    52   2e-06
TPHA0G03750 Chr7 complement(794102..795142) [1041 bp, 346 aa] {O...    51   2e-06
NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON} Anc_...    52   2e-06
TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {O...    52   3e-06
CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa...    51   3e-06
Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa] ...    52   3e-06
TPHA0B02910 Chr2 complement(662998..665151) [2154 bp, 717 aa] {O...    51   4e-06
Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON...    49   4e-06
KAFR0C04550 Chr3 (911728..913131) [1404 bp, 467 aa] {ON}               51   4e-06
SAKL0E07216g Chr5 complement(592229..593875) [1647 bp, 548 aa] {...    51   4e-06
Suva_6.132 Chr6 (219016..221652) [2637 bp, 878 aa] {ON} YJL056C ...    51   5e-06
TPHA0A05820 Chr1 complement(1319614..1320444) [831 bp, 276 aa] {...    50   5e-06
Smik_10.184 Chr10 complement(322050..324707) [2658 bp, 885 aa] {...    51   5e-06
Ecym_3341 Chr3 (647938..649620) [1683 bp, 560 aa] {ON} similar t...    50   5e-06
CAGL0L03916g Chr12 complement(450952..452880) [1929 bp, 642 aa] ...    50   6e-06
YOR113W Chr15 (534075..536819) [2745 bp, 914 aa] {ON}  AZF1Zinc-...    51   6e-06
KAFR0B04580 Chr2 (951625..953814) [2190 bp, 729 aa] {ON} Anc_2.1...    50   6e-06
Suva_14.318 Chr14 (561697..562047,562519..564213) [2046 bp, 681 ...    50   7e-06
Skud_15.276 Chr15 (490511..493264) [2754 bp, 917 aa] {ON} YOR113...    50   7e-06
ZYRO0B16148g Chr2 (1308101..1310893) [2793 bp, 930 aa] {ON} weak...    50   7e-06
Suva_8.166 Chr8 (291812..294658) [2847 bp, 948 aa] {ON} YOR113W ...    50   7e-06
KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weak...    50   8e-06
Smik_15.291 Chr15 (495292..498021) [2730 bp, 909 aa] {ON} YOR113...    50   8e-06
TBLA0F01300 Chr6 (326311..329268) [2958 bp, 985 aa] {ON} Anc_1.3...    50   9e-06
Kwal_14.2543 s14 (807668..809803) [2136 bp, 711 aa] {ON} YJL056C...    50   9e-06
Smik_14.303 Chr14 (542116..544137) [2022 bp, 673 aa] {ON} YNL027...    50   1e-05
Skud_14.301 Chr14 (550283..552331) [2049 bp, 682 aa] {ON} YNL027...    50   1e-05
YNL027W Chr14 (579580..581616) [2037 bp, 678 aa] {ON}  CRZ1Trans...    50   1e-05
YJL056C Chr10 complement(330431..333073) [2643 bp, 880 aa] {ON} ...    50   1e-05
TPHA0O01440 Chr15 (289051..291387) [2337 bp, 778 aa] {ON} Anc_1....    50   1e-05
CAGL0J05060g Chr10 (481253..483394) [2142 bp, 713 aa] {ON} simil...    50   1e-05
Skud_10.152 Chr10 (285800..288439) [2640 bp, 879 aa] {ON} YJL056...    50   1e-05
KNAG0E02610 Chr5 complement(517056..519296) [2241 bp, 746 aa] {O...    50   1e-05
SAKL0D06776g Chr4 (561887..564190) [2304 bp, 767 aa] {ON} weakly...    50   1e-05
TDEL0G02330 Chr7 (449585..451105) [1521 bp, 506 aa] {ON} Anc_2.3...    49   1e-05
ZYRO0E08426g Chr5 complement(673465..673980) [516 bp, 171 aa] {O...    47   2e-05
Kpol_489.4 s489 (17106..18125) [1020 bp, 339 aa] {ON} (17106..18...    49   2e-05
KAFR0C00490 Chr3 complement(97556..98230) [675 bp, 224 aa] {ON} ...    48   2e-05
NCAS0G03730 Chr7 (688768..690483) [1716 bp, 571 aa] {ON} Anc_2.303     49   2e-05
AEL174W Chr5 (310950..312935) [1986 bp, 661 aa] {ON} Syntenic ho...    49   2e-05
KLTH0H10538g Chr8 (910730..912778) [2049 bp, 682 aa] {ON} weakly...    49   2e-05
ZYRO0G09438g Chr7 complement(752797..753786) [990 bp, 329 aa] {O...    49   2e-05
Kwal_27.10925 s27 complement(559077..559871) [795 bp, 264 aa] {O...    48   2e-05
AGL197W Chr7 (325717..328251) [2535 bp, 844 aa] {ON} Syntenic ho...    49   2e-05
Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa] ...    48   3e-05
KLTH0G10802g Chr7 (908386..909966) [1581 bp, 526 aa] {ON} some s...    48   3e-05
KNAG0H01930 Chr8 (340772..342628) [1857 bp, 618 aa] {ON} Anc_2.3...    48   3e-05
NCAS0A01820 Chr1 (351123..352490) [1368 bp, 455 aa] {ON} Anc_4.80      48   3e-05
CAGL0I02816g Chr9 complement(247817..248692) [876 bp, 291 aa] {O...    47   4e-05
KLTH0G01826g Chr7 (135376..136299) [924 bp, 307 aa] {ON} some si...    47   4e-05
CAGL0M06831g Chr13 (695162..697099) [1938 bp, 645 aa] {ON} weakl...    48   4e-05
NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON} Anc_2...    48   4e-05
ADL198W Chr4 (349068..350711) [1644 bp, 547 aa] {ON} Syntenic ho...    48   4e-05
KAFR0H03240 Chr8 (619580..621139) [1560 bp, 519 aa] {ON} Anc_2.3...    47   6e-05
AGR031W Chr7 (769920..770342) [423 bp, 140 aa] {ON} Syntenic hom...    45   6e-05
Kpol_1035.22 s1035 (53205..55598) [2394 bp, 797 aa] {ON} (53205....    47   6e-05
Kpol_1003.50 s1003 (114648..116492) [1845 bp, 614 aa] {ON} (1146...    47   6e-05
Kwal_47.19045 s47 complement(1074829..1075629) [801 bp, 266 aa] ...    46   7e-05
Kwal_27.11460 s27 complement(810736..812331) [1596 bp, 531 aa] {...    47   8e-05
NDAI0G02560 Chr7 (585170..587554) [2385 bp, 794 aa] {ON} Anc_8.326     47   1e-04
ZYRO0C13508g Chr3 complement(1068164..1068733) [570 bp, 189 aa] ...    45   1e-04
KLLA0E08713g Chr5 (777005..778795) [1791 bp, 596 aa] {ON} some s...    46   1e-04
TPHA0G00820 Chr7 (153365..154963) [1599 bp, 532 aa] {ON} Anc_2.3...    46   1e-04
Ecym_2654 Chr2 (1266751..1267524) [774 bp, 257 aa] {ON} similar ...    45   1e-04
TDEL0D03430 Chr4 (635293..635820) [528 bp, 175 aa] {ON} Anc_3.28...    44   1e-04
ZYRO0F10428g Chr6 complement(846822..849263) [2442 bp, 813 aa] {...    46   1e-04
NDAI0I02900 Chr9 complement(684980..686554) [1575 bp, 524 aa] {O...    46   1e-04
Skud_5.137 Chr5 complement(208578..209762) [1185 bp, 394 aa] {ON...    46   1e-04
TPHA0F01810 Chr6 (416859..418136) [1278 bp, 425 aa] {ON} Anc_2.1...    45   2e-04
CAGL0E01331g Chr5 (124599..126668) [2070 bp, 689 aa] {ON} some s...    46   2e-04
KAFR0H02240 Chr8 (426388..428259) [1872 bp, 623 aa] {ON} Anc_8.3...    45   2e-04
CAGL0M04323g Chr13 complement(474158..476269) [2112 bp, 703 aa] ...    45   2e-04
KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.1...    45   2e-04
SAKL0D03146g Chr4 complement(256292..256765) [474 bp, 157 aa] {O...    43   2e-04
AFR471C Chr6 complement(1287518..1288687) [1170 bp, 389 aa] {ON}...    45   2e-04
KNAG0J00870 Chr10 complement(148421..149263) [843 bp, 280 aa] {O...    44   3e-04
Kwal_27.10167 s27 (225940..226797) [858 bp, 285 aa] {ON} YGL254W...    44   4e-04
SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some s...    44   4e-04
KLTH0A00682g Chr1 (69084..70385) [1302 bp, 433 aa] {ON} similar ...    45   4e-04
YPR186C Chr16 complement(909733..911022) [1290 bp, 429 aa] {ON} ...    44   5e-04
TDEL0D05860 Chr4 complement(1064492..1065484) [993 bp, 330 aa] {...    44   5e-04
KLTH0C07172g Chr3 complement(620315..621112) [798 bp, 265 aa] {O...    44   6e-04
TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.5...    44   6e-04
TPHA0A03980 Chr1 (885841..886785) [945 bp, 314 aa] {ON} Anc_3.28...    44   7e-04
KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {...    44   7e-04
AEL278W Chr5 (117043..118473) [1431 bp, 476 aa] {ON} Syntenic ho...    44   7e-04
TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa] ...    44   7e-04
Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {O...    44   7e-04
KAFR0A00800 Chr1 complement(144493..146754) [2262 bp, 753 aa] {O...    44   8e-04
NCAS0F03740 Chr6 complement(752361..753227) [867 bp, 288 aa] {ON...    43   8e-04
TPHA0M01180 Chr13 complement(237368..238420) [1053 bp, 350 aa] {...    43   8e-04
KNAG0D03710 Chr4 (675160..676539) [1380 bp, 459 aa] {ON} Anc_4.8...    44   9e-04
Suva_4.305 Chr4 complement(536954..537616) [663 bp, 220 aa] {ON}...    42   0.001
Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {...    44   0.001
TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON} Anc_2...    44   0.001
NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa] ...    44   0.001
Klac_YGOB_Anc_3.518 Chr2 complement(46736..47455) [720 bp, 239 a...    42   0.001
KLLA0B03454g Chr2 complement(314015..315433) [1419 bp, 472 aa] {...    43   0.001
Ecym_1415 Chr1 complement(863049..864563) [1515 bp, 504 aa] {ON}...    43   0.001
KNAG0E01600 Chr5 complement(319141..320157) [1017 bp, 338 aa] {O...    43   0.001
Kpol_1036.70 s1036 complement(192400..194424) [2025 bp, 674 aa] ...    43   0.001
CAGL0C02519g Chr3 (253051..254007) [957 bp, 318 aa] {ON} some si...    42   0.001
NCAS0E00170 Chr5 (20556..21539) [984 bp, 327 aa] {ON}                  42   0.001
Kpol_1050.116 s1050 complement(264361..265350) [990 bp, 329 aa] ...    42   0.001
Smik_2.199 Chr2 complement(351916..352578) [663 bp, 220 aa] {ON}...    42   0.001
YBR066C Chr2 complement(370037..370699) [663 bp, 220 aa] {ON}  N...    42   0.001
TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.8...    42   0.002
ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar ...    43   0.002
NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598     43   0.002
Smik_5.151 Chr5 complement(215590..216756) [1167 bp, 388 aa] {ON...    42   0.002
NDAI0G00720 Chr7 complement(155060..157186) [2127 bp, 708 aa] {O...    43   0.002
AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON} S...    42   0.002
CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa...    42   0.002
Skud_2.189 Chr2 complement(338427..339089) [663 bp, 220 aa] {ON}...    42   0.002
Kwal_56.23925 s56 complement(779625..781862) [2238 bp, 745 aa] {...    43   0.002
TPHA0K01770 Chr11 (374701..376257) [1557 bp, 518 aa] {ON} Anc_4....    42   0.002
CAGL0A01628g Chr1 (161327..162601) [1275 bp, 424 aa] {ON} simila...    42   0.002
TDEL0F04510 Chr6 complement(846575..848806) [2232 bp, 743 aa] {O...    42   0.002
KLLA0A10373g Chr1 complement(907244..907864) [621 bp, 206 aa] {O...    41   0.002
Kpol_505.15 s505 (42259..43791) [1533 bp, 510 aa] {ON} (42259..4...    42   0.002
SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {...    42   0.003
YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON} ...    42   0.003
Skud_16.490 Chr16 complement(852079..853302) [1224 bp, 407 aa] {...    42   0.003
Smik_16.450 Chr16 complement(772259..773557) [1299 bp, 432 aa] {...    42   0.003
NCAS0C03240 Chr3 (636172..638034) [1863 bp, 620 aa] {ON} Anc_8.326     42   0.003
NCAS0I01560 Chr9 (291561..292361) [801 bp, 266 aa] {ON} Anc_3.281      41   0.003
SAKL0F00242g Chr6 (16275..17150) [876 bp, 291 aa] {ON} similar t...    41   0.003
Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {O...    42   0.003
Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON} co...    42   0.003
YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}  MSN4Trans...    42   0.003
NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa] ...    42   0.003
ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON} S...    42   0.003
TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {...    42   0.003
SAKL0H20988g Chr8 complement(1832478..1834124) [1647 bp, 548 aa]...    42   0.003
TBLA0A08910 Chr1 complement(2188408..2189580) [1173 bp, 390 aa] ...    41   0.004
KLLA0F01463g Chr6 (140343..142688) [2346 bp, 781 aa] {ON} some s...    42   0.004
Suva_7.240 Chr7 complement(423254..423364,423482..424918) [1548 ...    42   0.004
Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}...    42   0.004
Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062...    42   0.004
KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly...    41   0.004
Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062...    41   0.004
SAKL0F16170g Chr6 complement(1310627..1311940) [1314 bp, 437 aa]...    41   0.004
Suva_7.52 Chr7 (92333..93535) [1203 bp, 400 aa] {ON} YGL209W (REAL)    41   0.004
TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {O...    41   0.005
Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {...    41   0.005
YER028C Chr5 complement(210692..211876) [1185 bp, 394 aa] {ON}  ...    41   0.005
Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar t...    41   0.005
KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {...    41   0.005
Kpol_1065.15 s1065 (43237..43899) [663 bp, 220 aa] {ON} (43237.....    40   0.005
YGL035C Chr7 complement(431548..433062) [1515 bp, 504 aa] {ON}  ...    41   0.005
CAGL0K09372g Chr11 complement(925647..926837) [1191 bp, 396 aa] ...    41   0.005
Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {...    41   0.005
KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON}       40   0.005
KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]...    41   0.005
SAKL0B12672g Chr2 complement(1096894..1097751) [858 bp, 285 aa] ...    40   0.005
Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130...    41   0.005
KNAG0H00550 Chr8 (87275..89137) [1863 bp, 620 aa] {ON} Anc_2.598...    41   0.006
TBLA0H02830 Chr8 complement(659893..662133) [2241 bp, 746 aa] {O...    41   0.006
NCAS0B03600 Chr2 complement(637749..639656) [1908 bp, 635 aa] {O...    41   0.006
Smik_7.251 Chr7 complement(423105..424622) [1518 bp, 505 aa] {ON...    41   0.006
KLLA0D16456g Chr4 complement(1387846..1390410) [2565 bp, 854 aa]...    41   0.006
Skud_7.249 Chr7 complement(434181..435689) [1509 bp, 502 aa] {ON...    41   0.006
KNAG0B00590 Chr2 (96235..97554) [1320 bp, 439 aa] {ON} Anc_3.518...    40   0.007
Kpol_1026.8 s1026 (16151..16525,16527..17390) [1239 bp, 412 aa] ...    40   0.007
KLLA0F26961g Chr6 (2486804..2488888) [2085 bp, 694 aa] {ON} weak...    41   0.007
KLTH0G12254g Chr7 (1040230..1042470) [2241 bp, 746 aa] {ON} weak...    41   0.007
CAGL0F05995g Chr6 complement(598819..600612) [1794 bp, 597 aa] {...    40   0.007
Suva_11.164 Chr11 (305916..307835) [1920 bp, 639 aa] {ON} YKL062...    40   0.007
KAFR0F04150 Chr6 complement(816551..817801) [1251 bp, 416 aa] {O...    40   0.007
SAKL0H24816g Chr8 complement(2158299..2159531) [1233 bp, 410 aa]...    40   0.007
NCAS0E00610 Chr5 (105009..106214) [1206 bp, 401 aa] {ON} Anc_3.518     40   0.008
TPHA0G00270 Chr7 (43982..45400) [1419 bp, 472 aa] {ON} Anc_7.543...    40   0.009
SAKL0F01980g Chr6 (165916..167073) [1158 bp, 385 aa] {ON} some s...    40   0.009
Kpol_344.4 s344 complement(5351..7621) [2271 bp, 756 aa] {ON} co...    40   0.009
Suva_16.518 Chr16 complement(892114..893397) [1284 bp, 427 aa] {...    40   0.009
Kpol_423.15 s423 (33422..34600) [1179 bp, 392 aa] {ON} (33422..3...    40   0.010
SAKL0H15488g Chr8 (1347432..1349828) [2397 bp, 798 aa] {ON} simi...    40   0.010
TDEL0H00280 Chr8 (38901..40175) [1275 bp, 424 aa] {ON} Anc_7.543...    40   0.010
TPHA0G03510 Chr7 (750272..751435) [1164 bp, 387 aa] {ON} Anc_2.5...    40   0.010
ACL057W Chr3 (264934..266496) [1563 bp, 520 aa] {ON} Syntenic ho...    40   0.010
Kwal_14.2278 s14 complement(686159..687550) [1392 bp, 463 aa] {O...    40   0.011
KNAG0A07040 Chr1 (1102385..1103443) [1059 bp, 352 aa] {ON} Anc_2...    40   0.011
Smik_7.54 Chr7 (90713..91861) [1149 bp, 382 aa] {ON} YGL209W (REAL)    40   0.012
Suva_13.246 Chr13 (390482..391741) [1260 bp, 419 aa] {ON} YMR070...    40   0.012
KLTH0H09196g Chr8 complement(789919..791301) [1383 bp, 460 aa] {...    40   0.012
TDEL0A03070 Chr1 (549360..550079) [720 bp, 239 aa] {ON} Anc_2.53...    39   0.013
CAGL0G10021g Chr7 complement(959154..960338) [1185 bp, 394 aa] {...    40   0.013
KAFR0J02980 Chr10 complement(567857..568816) [960 bp, 319 aa] {O...    39   0.013
KAFR0F03600 Chr6 (714010..715017) [1008 bp, 335 aa] {ON} Anc_4.8...    39   0.014
YGL209W Chr7 (95858..97006) [1149 bp, 382 aa] {ON}  MIG2Zinc fin...    39   0.015
Skud_7.59 Chr7 (101253..102404) [1152 bp, 383 aa] {ON} YGL209W (...    39   0.016
Ecym_8403 Chr8 complement(832403..834124) [1722 bp, 573 aa] {ON}...    39   0.018
KNAG0I00130 Chr9 (10977..11972) [996 bp, 331 aa] {ON}                  39   0.018
Suva_5.124 Chr5 complement(186591..187811) [1221 bp, 406 aa] {ON...    39   0.019
KLTH0D18062g Chr4 (1493355..1496741) [3387 bp, 1128 aa] {ON} sim...    39   0.019
KAFR0B05740 Chr2 complement(1184382..1186241) [1860 bp, 619 aa] ...    39   0.019
TBLA0H01260 Chr8 (283947..285665) [1719 bp, 572 aa] {ON} Anc_8.3...    39   0.020
Skud_13.226 Chr13 (383462..383482,383520..384161,384207..384971)...    39   0.020
YMR070W Chr13 (409154..410626) [1473 bp, 490 aa] {ON}  MOT3Trans...    39   0.020
TPHA0C02580 Chr3 (572294..573391) [1098 bp, 365 aa] {ON} Anc_2.5...    39   0.021
KLTH0D06842g Chr4 (597659..599179) [1521 bp, 506 aa] {ON} some s...    39   0.023
NDAI0I03330 Chr9 complement(781013..782065) [1053 bp, 350 aa] {O...    39   0.023
TPHA0A01540 Chr1 (306674..308914) [2241 bp, 746 aa] {ON} Anc_8.3...    39   0.023
NCAS0H03080 Chr8 complement(592814..595006) [2193 bp, 730 aa] {O...    39   0.024
CAGL0K03003g Chr11 (277585..279528) [1944 bp, 647 aa] {ON} weakl...    39   0.025
Smik_13.249 Chr13 (393264..393311,393345..394718) [1422 bp, 473 ...    39   0.025
TBLA0C04880 Chr3 complement(1187913..1188932) [1020 bp, 339 aa] ...    39   0.026
KAFR0A02320 Chr1 complement(482194..483525) [1332 bp, 443 aa] {O...    39   0.028
Skud_7.13 Chr7 (26414..27304) [891 bp, 296 aa] {ON} YGL254W (REAL)     38   0.029
KLLA0F18524g Chr6 complement(1701498..1702571) [1074 bp, 357 aa]...    38   0.032
ZYRO0D00902g Chr4 (68162..69379) [1218 bp, 405 aa] {ON} similar ...    39   0.033
ZYRO0G19140g Chr7 complement(1587180..1588853) [1674 bp, 557 aa]...    39   0.034
TBLA0G01920 Chr7 complement(502783..504354) [1572 bp, 523 aa] {O...    39   0.035
NDAI0A07470 Chr1 complement(1702035..1702826) [792 bp, 263 aa] {...    38   0.036
TPHA0C00800 Chr3 (156349..158391) [2043 bp, 680 aa] {ON} Anc_8.3...    39   0.037
Suva_13.70 Chr13 (106147..108480) [2334 bp, 777 aa] {ON} YML081W...    39   0.040
TDEL0G01700 Chr7 complement(334394..335848) [1455 bp, 484 aa] {O...    38   0.042
NCAS0C04070 Chr3 (831321..832190) [870 bp, 289 aa] {ON} Anc_8.144      38   0.043
KNAG0A05170 Chr1 (761499..763436) [1938 bp, 645 aa] {ON} Anc_8.3...    38   0.045
Kpol_1052.18 s1052 (58087..59160) [1074 bp, 357 aa] {ON} (58087....    38   0.049
Kpol_1013.21 s1013 complement(39687..41171) [1485 bp, 494 aa] {O...    38   0.050
SAKL0H25674g Chr8 complement(2249157..2250503) [1347 bp, 448 aa]...    38   0.055
YGL254W Chr7 (22304..23203) [900 bp, 299 aa] {ON}  FZF1Transcrip...    37   0.055
KAFR0B06360 Chr2 (1315900..1317783) [1884 bp, 627 aa] {ON} Anc_8...    38   0.056
Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}...    38   0.059
KLLA0E11023g Chr5 (966805..968229) [1425 bp, 474 aa] {ON} unipro...    37   0.063
TBLA0A03960 Chr1 complement(989886..992438) [2553 bp, 850 aa] {O...    38   0.065
KAFR0F02070 Chr6 (409867..410979) [1113 bp, 370 aa] {ON} Anc_2.5...    37   0.065
YPL038W Chr16 (480535..481068) [534 bp, 177 aa] {ON}  MET31Zinc-...    36   0.069
Kwal_26.8021 s26 (613992..615515) [1524 bp, 507 aa] {ON} YMR070W...    37   0.077
NDAI0G03420 Chr7 (817362..818816) [1455 bp, 484 aa] {ON} Anc_8.1...    37   0.079
Smik_16.197 Chr16 (357835..358350) [516 bp, 171 aa] {ON} YPL038W...    36   0.079
KAFR0B06810 Chr2 complement(1416866..1420333) [3468 bp, 1155 aa]...    37   0.083
KAFR0A01090 Chr1 complement(209790..210539) [750 bp, 249 aa] {ON...    37   0.088
KNAG0G02470 Chr7 complement(562235..564445) [2211 bp, 736 aa] {O...    37   0.090
KNAG0A04460 Chr1 complement(619911..623783) [3873 bp, 1290 aa] {...    37   0.096
Skud_13.348 Chr13 complement(598668..599318) [651 bp, 216 aa] {O...    36   0.098
NDAI0D03750 Chr4 (888448..889929) [1482 bp, 493 aa] {ON} Anc_4.80      37   0.099
Skud_16.243 Chr16 (445581..446114) [534 bp, 177 aa] {ON} YPL038W...    36   0.10 
ZYRO0B14894g Chr2 complement(1212853..1216212) [3360 bp, 1119 aa...    37   0.11 
TBLA0E04770 Chr5 complement(1228439..1233406) [4968 bp, 1655 aa]...    37   0.11 
NDAI0A05650 Chr1 (1275925..1276917) [993 bp, 330 aa] {ON} Anc_3....    37   0.12 
Smik_7.7 Chr7 (16965..17897) [933 bp, 310 aa] {ON} YGL254W (REAL)      36   0.12 
Ecym_2817 Chr2 complement(1587029..1588324) [1296 bp, 431 aa] {O...    37   0.12 
CAGL0K02145g Chr11 (190884..191837) [954 bp, 317 aa] {ON} some s...    36   0.13 
CAGL0H07557g Chr8 (738086..739516) [1431 bp, 476 aa] {ON} some s...    37   0.13 
CAGL0L06072g Chr12 complement(681921..682823) [903 bp, 300 aa] {...    36   0.14 
Suva_7.7 Chr7 (16721..17614) [894 bp, 297 aa] {ON} YGL254W (REAL)      36   0.14 
ZYRO0B02002g Chr2 (162068..162952) [885 bp, 294 aa] {ON} some si...    36   0.14 
TBLA0B04960 Chr2 complement(1167778..1169124) [1347 bp, 448 aa] ...    36   0.15 
CAGL0L07480g Chr12 complement(824237..825181) [945 bp, 314 aa] {...    36   0.15 
Kpol_1001.1 s1001 (3077..7102) [4026 bp, 1341 aa] {ON} (3077..71...    37   0.17 
KAFR0I02370 Chr9 (480591..481766) [1176 bp, 391 aa] {ON} Anc_3.5...    36   0.18 
NDAI0C00560 Chr3 (104390..107308) [2919 bp, 972 aa] {ON} Anc_2.598     36   0.19 
Kwal_47.16621 s47 complement(32712..36248) [3537 bp, 1178 aa] {O...    36   0.19 
Smik_4.281 Chr4 complement(509413..510108) [696 bp, 231 aa] {ON}...    35   0.19 
Kwal_55.20634 s55 (498959..500218) [1260 bp, 419 aa] {ON} YHL027...    36   0.20 
TBLA0G02230 Chr7 (580915..581565) [651 bp, 216 aa] {ON} Anc_2.53...    35   0.21 
TBLA0I03280 Chr9 complement(796048..797040) [993 bp, 330 aa] {ON...    36   0.21 
Suva_16.278 Chr16 (483789..484316) [528 bp, 175 aa] {ON} YPL038W...    35   0.21 
TDEL0B04670 Chr2 (830511..831449) [939 bp, 312 aa] {ON} Anc_8.14...    35   0.21 
Suva_5.251 Chr5 complement(396841..398190) [1350 bp, 449 aa] {ON...    35   0.28 
Smik_13.58 Chr13 (102509..106270) [3762 bp, 1253 aa] {ON} YML081...    36   0.28 
Smik_12.194 Chr12 complement(385837..388146) [2310 bp, 769 aa] {...    35   0.28 
KLLA0F07073g Chr6 (675221..676897) [1677 bp, 558 aa] {ON} some s...    35   0.29 
KNAG0G01280 Chr7 complement(286134..287552) [1419 bp, 472 aa] {O...    35   0.30 
KLLA0B04477g Chr2 (400019..404017) [3999 bp, 1332 aa] {ON} simil...    35   0.31 
AER159C Chr5 complement(935544..939119) [3576 bp, 1191 aa] {ON} ...    35   0.32 
KLTH0E05962g Chr5 (539474..540739) [1266 bp, 421 aa] {ON} weakly...    35   0.32 
NCAS0A10650 Chr1 complement(2121866..2122747) [882 bp, 293 aa] {...    35   0.32 
Skud_4.405 Chr4 complement(720227..722350) [2124 bp, 707 aa] {ON...    35   0.33 
KAFR0G03050 Chr7 complement(633014..635263) [2250 bp, 749 aa] {O...    35   0.34 
Suva_2.307 Chr2 complement(544040..546115) [2076 bp, 691 aa] {ON...    35   0.34 
Skud_13.61 Chr13 (104114..107875) [3762 bp, 1253 aa] {ON} YML081...    35   0.35 
KNAG0H01180 Chr8 (200503..201267) [765 bp, 254 aa] {ON} Anc_3.28...    35   0.36 
KNAG0J02850 Chr10 complement(545071..546573) [1503 bp, 500 aa] {...    35   0.38 
NCAS0A15270 Chr1 complement(3003516..3004817) [1302 bp, 433 aa] ...    35   0.39 
Suva_10.224 Chr10 complement(413051..415345) [2295 bp, 764 aa] {...    35   0.40 
Suva_2.200 Chr2 complement(341892..342590) [699 bp, 232 aa] {ON}...    34   0.41 
YER130C Chr5 complement(421115..422446) [1332 bp, 443 aa] {ON} P...    35   0.42 
Skud_5.248 Chr5 (399138..400466) [1329 bp, 442 aa] {ON} YER130C ...    35   0.43 
TPHA0B00380 Chr2 (78891..82823) [3933 bp, 1310 aa] {ON} Anc_4.35...    35   0.43 
Skud_4.297 Chr4 complement(519166..519861) [696 bp, 231 aa] {ON}...    34   0.44 
CAGL0L12562g Chr12 complement(1353174..1353845) [672 bp, 223 aa]...    34   0.47 
Smik_5.276 Chr5 complement(429983..431311) [1329 bp, 442 aa] {ON...    35   0.47 
YDR043C Chr4 complement(542674..543369) [696 bp, 231 aa] {ON}  N...    34   0.48 
YML081W Chr13 (104777..108532) [3756 bp, 1251 aa] {ON}  TDA9DNA-...    35   0.48 
CAGL0M00594g Chr13 (70659..73721) [3063 bp, 1020 aa] {ON} simila...    35   0.49 
NDAI0J00990 Chr10 (226704..228863) [2160 bp, 719 aa] {ON} Anc_8....    35   0.53 
CAGL0H04213g Chr8 (398544..402509) [3966 bp, 1321 aa] {ON} simil...    35   0.54 
TPHA0H01850 Chr8 complement(425548..426633) [1086 bp, 361 aa] {O...    34   0.55 
Kwal_47.16577 s47 complement(9960..12605) [2646 bp, 881 aa] {ON}...    35   0.55 
SAKL0G18062g Chr7 complement(1562943..1566659) [3717 bp, 1238 aa...    35   0.56 
KAFR0A01860 Chr1 (387980..389452) [1473 bp, 490 aa] {ON} Anc_2.5...    35   0.57 
ZYRO0B07568g Chr2 (595114..596964) [1851 bp, 616 aa] {ON} some s...    35   0.58 
KAFR0B00280 Chr2 (65006..66256) [1251 bp, 416 aa] {ON} Anc_7.543...    34   0.62 
Smik_4.390 Chr4 complement(709330..711456) [2127 bp, 708 aa] {ON...    35   0.62 
TDEL0D00670 Chr4 (117923..121522) [3600 bp, 1199 aa] {ON} Anc_4....    35   0.62 
NDAI0H01400 Chr8 complement(340037..341662) [1626 bp, 541 aa] {O...    34   0.62 
TPHA0E02650 Chr5 (554820..555743) [924 bp, 307 aa] {ON} Anc_6.25...    34   0.63 
YLR131C Chr12 complement(404510..406822) [2313 bp, 770 aa] {ON} ...    35   0.63 
TBLA0A08460 Chr1 (2080390..2082015) [1626 bp, 541 aa] {ON} Anc_4...    34   0.65 
Kpol_1031.42 s1031 complement(101434..102513) [1080 bp, 359 aa] ...    34   0.66 
NCAS0J01590 Chr10 (286539..287759) [1221 bp, 406 aa] {ON} Anc_4....    34   0.80 
ZYRO0G07964g Chr7 (645949..647400) [1452 bp, 483 aa] {ON} weakly...    34   0.80 
KLLA0C17072g Chr3 (1494101..1495525) [1425 bp, 474 aa] {ON} weak...    34   0.81 
Suva_13.363 Chr13 complement(604738..605373) [636 bp, 211 aa] {O...    33   0.82 
NDAI0C04860 Chr3 (1123119..1127171) [4053 bp, 1350 aa] {ON} Anc_...    34   0.84 
KNAG0M00350 Chr13 (51209..54439) [3231 bp, 1076 aa] {ON} Anc_4.3...    34   0.84 
KNAG0F03980 Chr6 complement(754914..756041) [1128 bp, 375 aa] {O...    34   0.90 
Skud_12.200 Chr12 complement(387195..389498) [2304 bp, 767 aa] {...    34   0.92 
YDR146C Chr4 complement(748613..750742) [2130 bp, 709 aa] {ON}  ...    34   0.97 
KNAG0C05810 Chr3 complement(1127391..1129055) [1665 bp, 554 aa] ...    34   1.0  
Kpol_1050.109 s1050 complement(246366..247520) [1155 bp, 384 aa]...    33   1.2  
TBLA0A01605 Chr1 (376599..377273) [675 bp, 224 aa] {ON}                33   1.2  
KLLA0F13046g Chr6 (1201353..1205492) [4140 bp, 1379 aa] {ON} wea...    33   1.3  
TPHA0C02160 Chr3 complement(486620..490747) [4128 bp, 1375 aa] {...    33   1.3  
SAKL0H11440g Chr8 (982180..982797) [618 bp, 205 aa] {ON} similar...    33   1.4  
KAFR0I01440 Chr9 complement(300092..301702) [1611 bp, 536 aa] {O...    33   1.4  
TBLA0H00660 Chr8 complement(139075..143010) [3936 bp, 1311 aa] {...    33   1.5  
CAGL0E03762g Chr5 complement(351240..352994) [1755 bp, 584 aa] {...    33   1.5  
TBLA0A08200 Chr1 complement(2024809..2025861) [1053 bp, 350 aa] ...    33   1.6  
NCAS0B02840 Chr2 complement(483481..486939) [3459 bp, 1152 aa] {...    33   1.7  
YMR182C Chr13 complement(624532..625167) [636 bp, 211 aa] {ON}  ...    32   1.7  
Kpol_1002.25 s1002 (79397..80281) [885 bp, 294 aa] {ON} (79397.....    33   1.8  
Skud_8.17 Chr8 (39078..40961) [1884 bp, 627 aa] {ON} YHL027W (REAL)    33   1.9  
Suva_16.76 Chr16 (124796..125974) [1179 bp, 392 aa] {ON} YPL230W...    33   1.9  
AFR190C Chr6 complement(783107..784405) [1299 bp, 432 aa] {ON} S...    33   2.0  
Ecym_2159 Chr2 (304191..305573) [1383 bp, 460 aa] {ON} similar t...    33   2.1  
Smik_13.387 Chr13 complement(609003..609641) [639 bp, 212 aa] {O...    32   2.1  
NDAI0K01860 Chr11 complement(417678..419870) [2193 bp, 730 aa] {...    33   2.3  
TBLA0I01970 Chr9 complement(446033..446899) [867 bp, 288 aa] {ON...    32   2.4  
NDAI0D03240 Chr4 complement(769306..773394) [4089 bp, 1362 aa] {...    33   2.6  
NDAI0I00990 Chr9 complement(236716..237945) [1230 bp, 409 aa] {O...    32   2.6  
Smik_8.14 Chr8 (34679..36568) [1890 bp, 629 aa] {ON} YHL027W (REAL)    32   2.7  
Suva_8.24 Chr8 (53077..54972) [1896 bp, 631 aa] {ON} YHL027W (REAL)    32   2.7  
NCAS0F00900 Chr6 complement(179873..181450) [1578 bp, 525 aa] {O...    32   2.7  
Kpol_529.13 s529 complement(28325..32557) [4233 bp, 1410 aa] {ON...    32   2.8  
Suva_1.89 Chr1 complement(157170..157334) [165 bp, 55 aa] {ON} Y...    29   2.8  
KLLA0E00793g Chr5 (80516..82069) [1554 bp, 517 aa] {ON} weakly s...    32   2.9  
NCAS0D02520 Chr4 (478610..479341) [732 bp, 243 aa] {ON}                32   2.9  
SAKL0A03476g Chr1 (319246..320214) [969 bp, 322 aa] {ON} some si...    32   3.1  
YHL027W Chr8 (51111..52988) [1878 bp, 625 aa] {ON}  RIM101Transc...    32   3.3  
KAFR0B02160 Chr2 complement(422203..423564) [1362 bp, 453 aa] {O...    32   3.4  
CAGL0K02343g Chr11 (209474..212962) [3489 bp, 1162 aa] {ON} simi...    32   3.6  
TBLA0C01990 Chr3 complement(466321..467190) [870 bp, 289 aa] {ON...    32   3.8  
NDAI0J00160 Chr10 (19695..21068) [1374 bp, 457 aa] {ON} Anc_7.543      32   3.9  
KNAG0D04190 Chr4 complement(754846..757878) [3033 bp, 1010 aa] {...    32   4.0  
NCAS0A04800 Chr1 complement(959067..960602) [1536 bp, 511 aa] {O...    32   4.1  
CAGL0K04631g Chr11 complement(441550..444591) [3042 bp, 1013 aa]...    32   4.3  
SAKL0H12958g Chr8 complement(1112324..1115713) [3390 bp, 1129 aa...    32   4.7  
TDEL0E01590 Chr5 (312468..314780) [2313 bp, 770 aa] {ON} Anc_4.2...    32   4.7  
KNAG0D02120 Chr4 (359406..360614) [1209 bp, 402 aa] {ON} Anc_8.1...    31   5.1  
Skud_4.478 Chr4 (849367..853338) [3972 bp, 1323 aa] {ON} YDR216W...    32   5.1  
TBLA0B06160 Chr2 (1454045..1458199) [4155 bp, 1384 aa] {ON} Anc_...    32   5.2  
NCAS0G01270 Chr7 (228699..229523) [825 bp, 274 aa] {ON} Anc_6.256      31   5.2  
Kpol_1060.35 s1060 (84889..85725) [837 bp, 278 aa] {ON} (84889.....    31   5.3  
Ecym_6216 Chr6 (406161..407630) [1470 bp, 489 aa] {ON} similar t...    31   5.6  
ZYRO0B12738g Chr2 (1027933..1030119) [2187 bp, 728 aa] {ON} some...    31   6.2  
NCAS0A06250 Chr1 complement(1234566..1238591) [4026 bp, 1341 aa]...    31   6.3  
AFR580C Chr6 complement(1478501..1481017) [2517 bp, 838 aa] {ON}...    31   6.8  
NCAS0F01370 Chr6 complement(270474..270977) [504 bp, 167 aa] {ON}      30   7.1  
YDR216W Chr4 (895035..899006) [3972 bp, 1323 aa] {ON}  ADR1Carbo...    31   7.4  
KAFR0F01210 Chr6 (232343..233278) [936 bp, 311 aa] {ON} Anc_6.25...    31   7.6  
Skud_16.48 Chr16 (88821..90017) [1197 bp, 398 aa] {ON} YPL230W (...    31   8.2  
Suva_2.383 Chr2 (674568..678527) [3960 bp, 1319 aa] {ON} YDR216W...    31   8.3  
Smik_4.463 Chr4 (838900..842874) [3975 bp, 1324 aa] {ON} YDR216W...    31   8.9  
KLTH0E03124g Chr5 complement(280411..283056) [2646 bp, 881 aa] {...    31   9.0  
NCAS0B02480 Chr2 (414819..415418) [600 bp, 199 aa] {ON} Anc_8.48...    30   9.5  
NDAI0H00300 Chr8 (52362..54269) [1908 bp, 635 aa] {ON}                 30   9.7  
TBLA0I02700 Chr9 complement(630467..632680) [2214 bp, 737 aa] {O...    30   10.0 

>TBLA0B06410 Chr2 (1511970..1513319) [1350 bp, 449 aa] {ON}
           Anc_2.531
          Length = 449

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/449 (76%), Positives = 342/449 (76%)

Query: 1   MWPHRLRSTQRPASVSNVAATLTLLRLFSAPRYKGHPATSIRLGCDDSHHGMLRSTARSC 60
           MWPHRLRSTQRPASVSNVAATLTLLRLFSAPRYKGHPATSIRLGCDDSHHGMLRSTARSC
Sbjct: 1   MWPHRLRSTQRPASVSNVAATLTLLRLFSAPRYKGHPATSIRLGCDDSHHGMLRSTARSC 60

Query: 61  CPTSCVWPCGMCAPPHYIYVPRRRSPPILPDPFRSHHTSTLHPPAVHARPLYIRPLHAAR 120
           CPTSCVWPCGMCAPPHYIYVPRRRSPPILPDPFRSHHTSTLHPPAVHARPLYIRPLHAAR
Sbjct: 61  CPTSCVWPCGMCAPPHYIYVPRRRSPPILPDPFRSHHTSTLHPPAVHARPLYIRPLHAAR 120

Query: 121 RRHCPPTDXXXXXXXXXXXXXTYIPPLLPHVSASYTHVPYTAAHVTPPVYASPLAQPLFA 180
           RRHCPPTD             TYIPPLLPHVSASYTHVPYTAAHVTPPVYASPLAQPLFA
Sbjct: 121 RRHCPPTDARHSAAAAHAAHSTYIPPLLPHVSASYTHVPYTAAHVTPPVYASPLAQPLFA 180

Query: 181 RTEAVPARKNSIATLLNTAAEQPLFLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 240
           RTEAVPARKNSIATLLNTAAEQPLFLP                                 
Sbjct: 181 RTEAVPARKNSIATLLNTAAEQPLFLPSLHSSSSLHSSSALHSSSSLHSSSTLHSSSSAS 240

Query: 241 XXXXXPLQPRSSLHVAAHLPTLATMFDSQARLSTQPPQKVILPSISSQFLPISNGPATSA 300
                PLQPRSSLHVAAHLPTLATMFDSQARLSTQPPQKVILPSISSQFLPISNGPATSA
Sbjct: 241 SASTSPLQPRSSLHVAAHLPTLATMFDSQARLSTQPPQKVILPSISSQFLPISNGPATSA 300

Query: 301 IITPIXXXXXXXXXXXXXXXXXXXVEFSDSFQTINIXXXXXXXXXXXXXXXXXXXXXXKP 360
           IITPI                   VEFSDSFQTINI                      KP
Sbjct: 301 IITPISSPPQLPLQSPAAAAPPPPVEFSDSFQTINIPNLPAQAASPNSSPSSPASLQSKP 360

Query: 361 IIXXXXXXXXXXXXXXXVARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTF 420
           II               VARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTF
Sbjct: 361 IIRKYKSKSNKKLPKRKVARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTF 420

Query: 421 NVKSNLNRHCKLHLRRQAKTTDDGTGGNK 449
           NVKSNLNRHCKLHLRRQAKTTDDGTGGNK
Sbjct: 421 NVKSNLNRHCKLHLRRQAKTTDDGTGGNK 449

>NCAS0J00640 Chr10 complement(98043..98351) [309 bp, 102 aa] {ON} 
          Length = 102

 Score = 95.5 bits (236), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 43/54 (79%), Positives = 47/54 (87%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           QC ICGK++TRSSSLQTHM VHT  RPFKC W NCGKTFNVKSN+NRH KLHL+
Sbjct: 41  QCPICGKIVTRSSSLQTHMLVHTGDRPFKCKWLNCGKTFNVKSNMNRHYKLHLK 94

>Kpol_495.20 s495 (65876..67336) [1461 bp, 486 aa] {ON}
           (65876..67336) [1461 nt, 487 aa]
          Length = 486

 Score = 97.1 bits (240), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 40/66 (60%), Positives = 53/66 (80%), Gaps = 1/66 (1%)

Query: 379 ARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQA 438
           A ++C +CGK +TR+ SL  HM +HT  RP+KC+WENCGKTFNVKSNLNRH K+HL++Q 
Sbjct: 422 ATYECSVCGKRVTRAYSLHAHMLIHTKVRPYKCDWENCGKTFNVKSNLNRHVKIHLKKQ- 480

Query: 439 KTTDDG 444
           K ++ G
Sbjct: 481 KNSNKG 486

>Kpol_1018.35 s1018 (118605..120158) [1554 bp, 517 aa] {ON}
           (118605..120158) [1554 nt, 518 aa]
          Length = 517

 Score = 96.3 bits (238), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 50/59 (84%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAK 439
           +QC +CGK ++R+SSL +HM++HTN RP+KC WE C KTFNVKSNLNRH KLH+++Q K
Sbjct: 458 YQCPVCGKSVSRASSLHSHMFIHTNARPYKCQWEGCNKTFNVKSNLNRHTKLHIKKQQK 516

>NCAS0B05750 Chr2 complement(1093346..1094863) [1518 bp, 505 aa]
           {ON} 
          Length = 505

 Score = 92.4 bits (228), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 38/58 (65%), Positives = 47/58 (81%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQ 437
           + QCK+CGK++TR+SSLQTHM +HT  RPF C W  C KTFNVKSN+NRH KLHL ++
Sbjct: 446 KKQCKLCGKVVTRTSSLQTHMLIHTGVRPFSCTWPGCKKTFNVKSNMNRHLKLHLIKE 503

>NDAI0B03080 Chr2 complement(785326..786708) [1383 bp, 460 aa] {ON}
           Anc_8.116
          Length = 460

 Score = 90.9 bits (224), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 51/75 (68%), Gaps = 9/75 (12%)

Query: 378 VARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHL--- 434
           + R QC ICGK++TR +SLQTHM +H+ YRP+KC W  C K FNVKSN+NRH K+HL   
Sbjct: 385 IRRRQCPICGKIVTRVNSLQTHMLIHSGYRPYKCKWPACEKMFNVKSNMNRHYKIHLKKN 444

Query: 435 ------RRQAKTTDD 443
                 R++ K  DD
Sbjct: 445 WGNKKTRKELKRNDD 459

>KAFR0A01840 Chr1 complement(379714..380958) [1245 bp, 414 aa] {ON}
           Anc_2.531
          Length = 414

 Score = 89.7 bits (221), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 38/67 (56%), Positives = 49/67 (73%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAK 439
           ++QC ICGK +TRSSSL  HM+VHT  RP+ C W  CGK FNVKSN+NRH KLHL+++ +
Sbjct: 334 KNQCPICGKTVTRSSSLLPHMFVHTGDRPYLCKWPKCGKAFNVKSNMNRHYKLHLKKEKE 393

Query: 440 TTDDGTG 446
             +   G
Sbjct: 394 QREQSDG 400

>NDAI0C06260 Chr3 (1449417..1451165) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score = 89.4 bits (220), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 38/56 (67%), Positives = 45/56 (80%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQ 437
           QC ICGK +TR+S+LQTHM VHT  RPF+C W  C K FNVKSN+NRH KLHL++Q
Sbjct: 492 QCHICGKSVTRTSTLQTHMLVHTGDRPFECVWSGCHKRFNVKSNMNRHYKLHLKKQ 547

>ZYRO0E02684g Chr5 (208420..208821) [402 bp, 133 aa] {ON} weakly
           similar to uniprot|Q6Q5F4 Saccharomyces cerevisiae
           YPR015C Hypothetical ORF
          Length = 133

 Score = 82.4 bits (202), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 45/64 (70%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAK 439
           R QC +CGK+ +R S+L+TH  +HT   PFKC W+NC K+FNVKSN+ RH K H RR AK
Sbjct: 65  RKQCPVCGKICSRPSTLKTHFLIHTGDTPFKCTWQNCQKSFNVKSNMLRHLKSHERRLAK 124

Query: 440 TTDD 443
            T  
Sbjct: 125 QTSQ 128

>TPHA0A04530 Chr1 (1027935..1029440) [1506 bp, 501 aa] {ON} 
          Length = 501

 Score = 85.9 bits (211), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 46/61 (75%)

Query: 379 ARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQA 438
           A HQC IC ++ TRS SL  HM VHT  +PFKC W++CGK F++KSNL+RH K+H+ +Q 
Sbjct: 424 AIHQCPICNRVTTRSYSLHAHMLVHTKDKPFKCEWQDCGKAFSIKSNLSRHMKIHIHKQK 483

Query: 439 K 439
           K
Sbjct: 484 K 484

>NDAI0B02080 Chr2 (520660..521481) [822 bp, 273 aa] {ON} 
          Length = 273

 Score = 80.5 bits (197), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 44/62 (70%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAK 439
           R QC +CGK+ +R S+L+TH  +HT   PFKC+WE C K FNVKSN+ RH K H RR+ K
Sbjct: 208 RKQCSVCGKVCSRPSTLKTHFLIHTGDTPFKCSWEGCHKAFNVKSNMLRHMKSHERRRNK 267

Query: 440 TT 441
            T
Sbjct: 268 KT 269

>TDEL0F01170 Chr6 (209707..210195) [489 bp, 162 aa] {ON} Anc_8.117
           YPR015C
          Length = 162

 Score = 77.0 bits (188), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 42/57 (73%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRR 436
           R QC +CGK+ +R S+L+TH  +HT   PFKC+W NC K+FNVKSN+ RH K H R+
Sbjct: 100 RKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCSWGNCTKSFNVKSNMLRHLKSHERK 156

>KNAG0D02280 Chr4 (393332..394639) [1308 bp, 435 aa] {ON} 
          Length = 435

 Score = 81.3 bits (199), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 31/59 (52%), Positives = 45/59 (76%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAKT 440
           QC +CGK+ +R S+L+TH ++HT   PFKC W NCG++FNVKSN+ RH K H ++ A++
Sbjct: 353 QCPVCGKICSRPSTLKTHYFIHTGDTPFKCTWPNCGRSFNVKSNMMRHMKAHAKKAAES 411

>SAKL0A09438g Chr1 complement(823711..825036) [1326 bp, 441 aa] {ON}
           weakly similar to uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 441

 Score = 80.5 bits (197), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 44/59 (74%)

Query: 378 VARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRR 436
           V ++QC  CGK+ +RSSSLQ H  VHT  RPFKC W +C KTFNVKSN+ RH +LH +R
Sbjct: 378 VPKNQCLKCGKVFSRSSSLQAHALVHTGDRPFKCVWPSCEKTFNVKSNMMRHYRLHEKR 436

>Kpol_541.39 s541 complement(124703..125578) [876 bp, 291 aa] {ON}
           complement(124703..125578) [876 nt, 292 aa]
          Length = 291

 Score = 79.0 bits (193), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 34/62 (54%), Positives = 45/62 (72%)

Query: 378 VARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQ 437
           + R QC IC K+ +R ++L+TH+ +HT   PFKC WENC K+FNVKSN+ RH K H R+Q
Sbjct: 146 LLRKQCHICKKICSRPATLKTHLLIHTGDTPFKCPWENCPKSFNVKSNMLRHLKSHQRKQ 205

Query: 438 AK 439
            K
Sbjct: 206 VK 207

>Suva_16.338 Chr16 complement(594847..595590) [744 bp, 247 aa] {ON}
           YPR015C (REAL)
          Length = 247

 Score = 77.8 bits (190), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 44/60 (73%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAK 439
           R QC ICGK+ +R S+L+TH  +HT   PFKC WE+C K+FNVKSN+ RH + H ++ AK
Sbjct: 184 RKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCSKSFNVKSNMLRHLRTHQKKIAK 243

>Skud_16.298 Chr16 complement(548954..549907) [954 bp, 317 aa] {ON}
           YPR013C (REAL)
          Length = 317

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 43/60 (71%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAK 439
           R QC +CGK+ +R S+L+TH  +HT   PFKC WE C K+FNVKSN+ RH K H R++ K
Sbjct: 253 RKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCSKSFNVKSNMLRHLKSHERKRNK 312

>Smik_16.253 Chr16 complement(460778..461731) [954 bp, 317 aa] {ON}
           YPR013C (REAL)
          Length = 317

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 43/60 (71%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAK 439
           R QC +CGK+ +R S+L+TH  +HT   PFKC WE C K+FNVKSN+ RH K H R++ K
Sbjct: 253 RKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCSKSFNVKSNMLRHLKSHERKRNK 312

>Skud_16.300 Chr16 complement(554576..555325) [750 bp, 249 aa] {ON}
           YPR015C (REAL)
          Length = 249

 Score = 77.4 bits (189), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 44/60 (73%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAK 439
           R QC ICGK+ +R S+L+TH  +HT   PFKC WE+C K+FNVKSN+ RH + H ++ AK
Sbjct: 186 RKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKKVAK 245

>YPR013C Chr16 complement(584632..585585) [954 bp, 317 aa] {ON}
           Putative zinc finger protein; YPR013C is not an
           essential gene
          Length = 317

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 43/60 (71%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAK 439
           R QC +CGK+ +R S+L+TH  +HT   PFKC WE C K+FNVKSN+ RH K H R++ K
Sbjct: 253 RKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCTKSFNVKSNMLRHLKSHERKRNK 312

>Suva_16.335 Chr16 complement(588678..589631) [954 bp, 317 aa] {ON}
           YPR013C (REAL)
          Length = 317

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 43/60 (71%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAK 439
           R QC +CGK+ +R S+L+TH  +HT   PFKC WE C K+FNVKSN+ RH K H R++ K
Sbjct: 253 RKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEGCSKSFNVKSNMLRHLKSHERKRNK 312

>YPR015C Chr16 complement(590283..591026) [744 bp, 247 aa] {ON}
           Putative protein of unknown function; overexpression
           causes a cell cycle delay or arrest
          Length = 247

 Score = 77.0 bits (188), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 44/60 (73%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAK 439
           R QC ICGK+ +R S+L+TH  +HT   PFKC WE+C K+FNVKSN+ RH + H ++ AK
Sbjct: 184 RKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKKIAK 243

>Smik_16.255 Chr16 complement(465909..466652) [744 bp, 247 aa] {ON}
           YPR015C (REAL)
          Length = 247

 Score = 77.0 bits (188), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 44/60 (73%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAK 439
           R QC ICGK+ +R S+L+TH  +HT   PFKC WE+C K+FNVKSN+ RH + H ++ AK
Sbjct: 184 RKQCPICGKVCSRPSTLRTHYLIHTGDTPFKCTWEHCNKSFNVKSNMLRHLRTHQKKIAK 243

>KAFR0B01990 Chr2 complement(386456..387688) [1233 bp, 410 aa] {ON}
           Anc_8.116 YPR013C
          Length = 410

 Score = 78.2 bits (191), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 34/60 (56%), Positives = 43/60 (71%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAK 439
           R QC +CGK+ +R S+L+TH  +HT   PFKC WE+C K+FNVKSN+ RH K H RR  K
Sbjct: 339 RKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCTWEDCSKSFNVKSNMLRHLKSHERRLIK 398

>NCAS0C04230 Chr3 (869169..870185) [1017 bp, 338 aa] {ON} 
          Length = 338

 Score = 77.0 bits (188), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 45/61 (73%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAK 439
           R QC +CGK+ +R S+L+TH  +HT   PF+C W++C K+FNVKSN+ RH K H ++ AK
Sbjct: 269 RKQCPVCGKICSRPSTLKTHYLIHTGDTPFRCPWKSCNKSFNVKSNMLRHLKSHQKKGAK 328

Query: 440 T 440
           T
Sbjct: 329 T 329

>Ecym_8387 Chr8 complement(790075..790614) [540 bp, 179 aa] {ON}
           similar to Ashbya gossypii ADL050W
          Length = 179

 Score = 73.9 bits (180), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 45/67 (67%), Gaps = 6/67 (8%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAKTTD 442
           C +C K  TR +SL TH+ +H + RP++C + +C KTFNVKSNLNRH K+H +++ K   
Sbjct: 111 CPVCLKEFTRKTSLNTHLLIHADIRPYRCKYPDCKKTFNVKSNLNRHLKIHKKQELK--- 167

Query: 443 DGTGGNK 449
              GG K
Sbjct: 168 ---GGEK 171

>AEL077W Chr5 (483028..484038) [1011 bp, 336 aa] {ON} NOHBY506; No
           homolog in Saccharomyces cerevisiae'
          Length = 336

 Score = 77.0 bits (188), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 42/62 (67%)

Query: 379 ARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQA 438
            R+QC +CGK+  R SSL+ HMY+HT  RPF C W  C K FNVKSN+ RH +LH  ++ 
Sbjct: 272 VRNQCPVCGKVCHRPSSLRNHMYIHTGRRPFLCEWPGCEKRFNVKSNMVRHYRLHQLQRG 331

Query: 439 KT 440
           K 
Sbjct: 332 KE 333

>NCAS0F00910 Chr6 (183289..184341) [1053 bp, 350 aa] {ON} 
          Length = 350

 Score = 77.0 bits (188), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/57 (57%), Positives = 43/57 (75%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQ 437
           H C +CGK +TRS+SL+THM +HT  RPFKC+W NC  + +VKSN+ RH K HL+ Q
Sbjct: 285 HICVVCGKSLTRSTSLRTHMLIHTGSRPFKCSWPNCKASSSVKSNITRHFKSHLKGQ 341

>SAKL0H20416g Chr8 (1789596..1790549) [954 bp, 317 aa] {ON} weakly
           similar to uniprot|Q6Q5F4 Saccharomyces cerevisiae
           YPR015C Hypothetical ORF
          Length = 317

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 33/58 (56%), Positives = 41/58 (70%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQ 437
           + QC ICGKL +R S+L+TH  +HT   PFKC W NC K+FNVKSN+ RH K H R +
Sbjct: 257 KRQCPICGKLCSRPSTLKTHFLIHTGATPFKCPWLNCNKSFNVKSNMLRHYKSHERNE 314

>Kwal_26.8011 s26 complement(611115..611687) [573 bp, 190 aa] {ON}
           YPR013C - Hypothetical ORF [contig 55] FULL
          Length = 190

 Score = 73.6 bits (179), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 29/54 (53%), Positives = 41/54 (75%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           ++QC++C K+ +RSS+LQ H+  HT  RPF+C + +C KTFNVKSN+ RH K H
Sbjct: 127 KYQCQLCLKIFSRSSALQAHLLTHTGSRPFRCPFASCSKTFNVKSNMVRHLKTH 180

>KNAG0G01140 Chr7 complement(251500..253059) [1560 bp, 519 aa] {ON} 
          Length = 519

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 41/57 (71%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRR 436
           R QC +CGK+ +R S+L+TH  +HT   PFKC WE C K+FNVKSN+ RH K H R+
Sbjct: 454 RKQCPVCGKICSRPSTLKTHYMIHTGDTPFKCPWEGCNKSFNVKSNMFRHLKSHKRK 510

>KLTH0D06798g Chr4 complement(594639..594974) [336 bp, 111 aa] {ON}
           some similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 111

 Score = 70.9 bits (172), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           R+QC  C K+ TRSS+LQ+H+ VHT  RPF C   +C K+FNVKSN+NRH K H
Sbjct: 48  RYQCSRCLKVFTRSSALQSHILVHTGDRPFVCPHSSCSKSFNVKSNMNRHFKTH 101

>Ecym_1383 Chr1 complement(791514..792659) [1146 bp, 381 aa] {ON}
           similar to Ashbya gossypii AEL077W
          Length = 381

 Score = 75.9 bits (185), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 33/68 (48%), Positives = 42/68 (61%)

Query: 379 ARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQA 438
            R+QC +C K+  R SSL+ HMY+HT  RPF C W  C K FNVKSN+ RH +LH  ++ 
Sbjct: 294 VRNQCPVCAKVCHRPSSLRNHMYIHTGRRPFLCEWPGCEKRFNVKSNMVRHYRLHQVQEN 353

Query: 439 KTTDDGTG 446
           K      G
Sbjct: 354 KEKSKREG 361

>CAGL0L05786g Chr12 complement(638173..639219) [1047 bp, 348 aa]
           {ON} some similarities with uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 348

 Score = 75.5 bits (184), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 34/61 (55%), Positives = 44/61 (72%), Gaps = 1/61 (1%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR-RQA 438
           R QC +CGK+ +R S+L+TH  +HT   PFKC W++C K FNVKSN+ RH K H R +QA
Sbjct: 284 RKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCPWKDCKKAFNVKSNMLRHLKCHERKKQA 343

Query: 439 K 439
           K
Sbjct: 344 K 344

>CAGL0J01595g Chr10 (151584..152618) [1035 bp, 344 aa] {ON} some
           similarities with uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c or uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q03825 Saccharomyces
           cerevisiae YMR164c MSS11
          Length = 344

 Score = 75.1 bits (183), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 41/56 (73%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           R QC +CGK+ +R S+L+TH+ +HT   PFKC W++C K FNVKSNL RH K H +
Sbjct: 283 RKQCPVCGKICSRPSTLKTHILIHTGDTPFKCTWKDCRKAFNVKSNLLRHLKSHEK 338

>Kwal_14.2206 s14 (656346..657110) [765 bp, 254 aa] {ON} YPR015C -
           Hypothetical ORF [contig 227] FULL
          Length = 254

 Score = 73.9 bits (180), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 30/55 (54%), Positives = 40/55 (72%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           H+C+ICGK  +R S L TH  +HT ++P+ C+  NCGK FNVKSNL RH K+H +
Sbjct: 194 HECRICGKTFSRPSGLSTHALIHTGHQPYACDAPNCGKRFNVKSNLMRHRKIHAK 248

>KLLA0F20636g Chr6 complement(1914452..1915309) [858 bp, 285 aa]
           {ON} some similarities with uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 285

 Score = 74.3 bits (181), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 32/51 (62%), Positives = 37/51 (72%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           C  CGK  TR S+L+THM VH+  +PF+C WE C K FNVKSNL RH KLH
Sbjct: 234 CAQCGKQFTRPSALRTHMLVHSGDKPFECTWEGCNKKFNVKSNLIRHLKLH 284

>SAKL0H20394g Chr8 (1787390..1788469) [1080 bp, 359 aa] {ON} weakly
           similar to uniprot|Q6Q5F4 Saccharomyces cerevisiae
           YPR015C Hypothetical ORF
          Length = 359

 Score = 75.1 bits (183), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 46/65 (70%)

Query: 378 VARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQ 437
           +AR+QC ICGK+ +R S+L+TH+ VHT  +P+ C W  C ++FNVKSN+ RH K H ++ 
Sbjct: 282 LARNQCHICGKVCSRPSTLRTHVLVHTGVKPYPCEWPGCNRSFNVKSNMIRHYKNHEKKT 341

Query: 438 AKTTD 442
            +  +
Sbjct: 342 KENQE 346

>Ecym_8377 Chr8 complement(764541..765473) [933 bp, 310 aa] {ON}
           similar to Ashbya gossypii ADL040W
          Length = 310

 Score = 73.9 bits (180), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 42/64 (65%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAK 439
           +  C +CG+  TR S+L+THM +HT   PF+CNW  C K FNV+SN+ RH   H R+  K
Sbjct: 227 KKTCTVCGRHCTRPSTLKTHMLIHTGELPFECNWPGCRKRFNVRSNMKRHLNSHKRKLIK 286

Query: 440 TTDD 443
            TD+
Sbjct: 287 KTDN 290

>KLTH0H08800g Chr8 (762417..762923) [507 bp, 168 aa] {ON} some
           similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 168

 Score = 70.9 bits (172), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 29/53 (54%), Positives = 38/53 (71%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           H+C +CGK  +R S L TH  +HT ++PF C+  +CGK FNVKSNL RH K+H
Sbjct: 111 HECHVCGKTFSRPSGLNTHALIHTGHQPFVCDVPHCGKRFNVKSNLIRHKKIH 163

>Ecym_8388 Chr8 complement(794615..795286) [672 bp, 223 aa] {ON}
           similar to Ashbya gossypii ADL051W
          Length = 223

 Score = 72.0 bits (175), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 30/57 (52%), Positives = 42/57 (73%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAK 439
           C IC K  TR +SLQTHM +HT  +P++C+++ C KTFNVKSNL RH ++H R  ++
Sbjct: 161 CHICLKSFTRKTSLQTHMLIHTKVKPYRCSYQRCNKTFNVKSNLYRHERIHKRNNSR 217

>ADL050W Chr4 (597226..597666) [441 bp, 146 aa] {ON} NOHBY403; No
           homolog in Saccharomyces cerevisiae
          Length = 146

 Score = 69.7 bits (169), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 38/51 (74%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           C +C K  TR +SL TH+ +H + RP+ C++ NC K+FNVKSNLNRH ++H
Sbjct: 78  CPVCLKEFTRKTSLNTHLLIHADIRPYLCDYANCNKSFNVKSNLNRHLRIH 128

>NCAS0F00920 Chr6 (185346..186410) [1065 bp, 354 aa] {ON} Anc_2.531
          Length = 354

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 44/59 (74%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAK 439
           H+C IC K++TRS+SL++H+ +HT  +P+KC W NC  + +VKSN+ RH K HL+ Q +
Sbjct: 296 HKCPICDKIVTRSTSLRSHLLIHTGEKPYKCTWPNCDTSSSVKSNITRHYKSHLKSQNQ 354

>KAFR0B02000 Chr2 complement(392263..393174) [912 bp, 303 aa] {ON}
           Anc_8.117 YPR015C
          Length = 303

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 41/60 (68%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAK 439
           R +C +CGK+ +R S+L+TH  +HT   PFKC W  C K FNVKSN+ RH K H ++ +K
Sbjct: 230 RKKCPVCGKMCSRPSTLKTHYLIHTGDTPFKCTWSGCPKAFNVKSNMLRHVKSHEKKLSK 289

>KNAG0D02290 Chr4 complement(397174..398481) [1308 bp, 435 aa] {ON} 
          Length = 435

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 40/56 (71%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           R QC +CGK+ +R S+L+TH  +HT   PFKC W +C K+FNVKSNL RH K H R
Sbjct: 369 RKQCPVCGKVCSRPSTLKTHYLIHTGDTPFKCTWGDCTKSFNVKSNLMRHLKSHER 424

>KAFR0C03140 Chr3 (629556..630668) [1113 bp, 370 aa] {ON} 
          Length = 370

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 31/59 (52%), Positives = 42/59 (71%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQA 438
           R QC +CGK+ +R S+L+TH  +HT   PFKC W+ C K+FNVKSN+ RH K H ++ A
Sbjct: 297 RKQCPVCGKICSRPSTLKTHYLIHTGDTPFKCPWKGCTKSFNVKSNMLRHFKSHEKKAA 355

>AGL207W Chr7 (310750..311583) [834 bp, 277 aa] {ON} NOHBY712; No
           homolog in Saccharomyces cerevisiae
          Length = 277

 Score = 71.6 bits (174), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 40/56 (71%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           R+ C  CGK   R+SSL+TH  +HT  RPF C ++NCGK+FN +SN+ RH KLH R
Sbjct: 182 RYVCTECGKGFARASSLRTHRNIHTGDRPFTCPFKNCGKSFNARSNMLRHHKLHFR 237

>SAKL0D02618g Chr4 complement(208093..209058) [966 bp, 321 aa] {ON}
           some similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 321

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 40/56 (71%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           +++C  CGK   R SSL THM +HT  +PF C ++NCGKTFN KSN+ RH KLH +
Sbjct: 234 KYECPQCGKGFVRPSSLNTHMNIHTGDKPFVCPFKNCGKTFNAKSNMLRHHKLHFK 289

>ADL051W Chr4 (595493..596014) [522 bp, 173 aa] {ON} NOHBY404; No
           homolog in Saccharomyces cerevisiae
          Length = 173

 Score = 69.3 bits (168), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (68%)

Query: 378 VARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           V+   C IC K  TR +SLQTHM +HT  +P++C +  C KTFNVKSNL RH ++H R
Sbjct: 113 VSGKTCAICRKSFTRKTSLQTHMLIHTKAKPYRCPYRTCNKTFNVKSNLYRHERIHKR 170

>NCAS0B04670 Chr2 (852849..853649) [801 bp, 266 aa] {ON} 
          Length = 266

 Score = 71.2 bits (173), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 31/60 (51%), Positives = 39/60 (65%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAK 439
           R QC  CGK+ +R S+L+ H  +HT   PFKC W NC K FNVKSN+ RH K H ++  K
Sbjct: 199 RKQCPACGKICSRPSTLKAHYLIHTGDTPFKCTWGNCNKAFNVKSNMLRHLKAHEKKVIK 258

>NDAI0B01940 Chr2 complement(472594..473604) [1011 bp, 336 aa] {ON} 
          Length = 336

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 29/57 (50%), Positives = 40/57 (70%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRR 436
           + QC ICGK+ +R S+L+TH  +H+   PFKC W+ C K FNVKSN+ RH K H ++
Sbjct: 254 KKQCDICGKICSRPSTLKTHYLIHSGDTPFKCAWKGCTKAFNVKSNMLRHFKCHEKK 310

>KAFR0C00340 Chr3 complement(65838..67022) [1185 bp, 394 aa] {ON}
           Anc_3.298
          Length = 394

 Score = 71.6 bits (174), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 29/53 (54%), Positives = 38/53 (71%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           CK+C K   R SSL THM +HT Y+P++C + NC K+FN KSN+ RH KLH +
Sbjct: 280 CKVCSKRFKRPSSLSTHMNIHTGYKPYQCPFSNCQKSFNAKSNMLRHYKLHFK 332

>ADL040W Chr4 (618852..619844) [993 bp, 330 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR013C
          Length = 330

 Score = 70.9 bits (172), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 29/54 (53%), Positives = 38/54 (70%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRR 436
           C +CG+  TR S+L+THM +HT   PF+C+W  C K FNV+SN+NRH   H RR
Sbjct: 260 CLVCGRRCTRPSTLKTHMLIHTGELPFQCSWPGCSKRFNVRSNMNRHVNSHKRR 313

>NCAS0B04660 Chr2 (850607..851377) [771 bp, 256 aa] {ON} 
          Length = 256

 Score = 70.1 bits (170), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 41/58 (70%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAK 439
           +C +CGK+ +R S+L+TH  +HT   PFKC +  C K+FNVKSN+ RH K H R++ K
Sbjct: 196 ECPVCGKMCSRPSTLKTHFLIHTGDTPFKCTYHGCKKSFNVKSNMFRHLKCHERKKNK 253

>AGR186C Chr7 complement(1099507..1100370) [864 bp, 287 aa] {ON}
           NOHBY743; No homolog in Saccharomyces cerevisiae
          Length = 287

 Score = 70.5 bits (171), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 30/54 (55%), Positives = 41/54 (75%), Gaps = 2/54 (3%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRR 436
           C +CGK  TR S+LQ H+ +HTN +PFKC++  C K FNVKSNLNRH ++H ++
Sbjct: 169 CPLCGKSFTRRSTLQIHLLIHTNLKPFKCSF--CDKEFNVKSNLNRHERIHRQK 220

>TBLA0E03930 Chr5 complement(990944..992332) [1389 bp, 462 aa] {ON} 
          Length = 462

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 42/62 (67%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAKTT 441
           QC +CGK+ +R S+L+TH  +HT   P+KC W NC K+FNVKSN+ RH K H ++  K  
Sbjct: 356 QCPVCGKVCSRPSTLKTHYLIHTGDTPYKCKWLNCTKSFNVKSNMLRHLKNHEKKLEKMK 415

Query: 442 DD 443
           + 
Sbjct: 416 EQ 417

>Ecym_2673 Chr2 complement(1297046..1297951) [906 bp, 301 aa] {ON}
           similar to Ashbya gossypii AGL207W
          Length = 301

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 30/56 (53%), Positives = 40/56 (71%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           R+ C  CGK   R+SSL+TH  +HT  RPF C ++NCGK+FN +SN+ RH KLH +
Sbjct: 206 RYICSDCGKGFARASSLRTHRNIHTGDRPFTCPFKNCGKSFNARSNMLRHHKLHFK 261

>Ecym_4128 Chr4 (270876..271814) [939 bp, 312 aa] {ON} similar to
           Ashbya gossypii AGR186C
          Length = 312

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 30/54 (55%), Positives = 41/54 (75%), Gaps = 2/54 (3%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRR 436
           C +CGK  TR S+LQ H+ +HTN +PFKC++  C K FNVKSNLNRH ++H ++
Sbjct: 173 CPLCGKSFTRRSTLQIHLLIHTNLKPFKCSF--CEKEFNVKSNLNRHERIHRQK 224

>KLTH0C04884g Chr3 complement(422344..423372) [1029 bp, 342 aa] {ON}
           conserved hypothetical protein
          Length = 342

 Score = 69.3 bits (168), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 37/61 (60%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAK 439
           R+ C  CGK   R SSL TH   HT  +PF C +ENC K FN +SN+ RH KLH + +  
Sbjct: 237 RYVCASCGKCFNRPSSLATHNNTHTGDKPFTCPFENCDKQFNARSNMTRHYKLHFKTEGG 296

Query: 440 T 440
           T
Sbjct: 297 T 297

>Ecym_8011 Chr8 complement(26472..27302) [831 bp, 276 aa] {ON}
           similar to Ashbya gossypii ADR308C
          Length = 276

 Score = 68.2 bits (165), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 30/64 (46%), Positives = 41/64 (64%)

Query: 378 VARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQ 437
           + ++ CK+CG+   R S+L+THM  HT  RPF C    C K+FNV+SN+ RH +LH R  
Sbjct: 210 IRKNVCKVCGRECRRPSTLKTHMLTHTGQRPFCCRHPGCNKSFNVRSNMLRHERLHGRDN 269

Query: 438 AKTT 441
             TT
Sbjct: 270 DSTT 273

>KNAG0J02250 Chr10 (421560..422450) [891 bp, 296 aa] {ON} 
          Length = 296

 Score = 68.2 bits (165), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 39/56 (69%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           + +C +CGK   R SSL TH  +HT ++P+ C +ENC K+FN KSN+ RH KLH +
Sbjct: 207 KFKCCVCGKGFRRPSSLATHSNIHTGFKPYVCPYENCHKSFNAKSNMFRHYKLHFK 262

>KLLA0F11682g Chr6 complement(1068992..1070116) [1125 bp, 374 aa]
           {ON} weakly similar to uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 374

 Score = 68.9 bits (167), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 30/57 (52%), Positives = 40/57 (70%)

Query: 379 ARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           ++++C  CGK   R SSL THM +HT  +P+KC + NC K FN KSN+ RH KLHL+
Sbjct: 302 SKYRCAECGKAFARPSSLSTHMNIHTGDKPYKCLYPNCYKQFNAKSNMLRHYKLHLK 358

>NDAI0A07540 Chr1 (1730558..1731670) [1113 bp, 370 aa] {ON}
           Anc_3.298
          Length = 370

 Score = 68.2 bits (165), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%)

Query: 378 VARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           +A++ CK C K   R SSL THM +HT  +P+ C +E C K+FN KSN+ RH KLH +
Sbjct: 255 IAKYGCKHCNKRFKRPSSLNTHMNIHTGNKPYVCPYEECRKSFNAKSNMLRHYKLHFK 312

>ADR308C Chr4 complement(1241867..1242703) [837 bp, 278 aa] {ON}
           NOHBY437; No homolog in Saccharomyces cerevisiae
          Length = 278

 Score = 67.4 bits (163), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 38/56 (67%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           ++ CK+CG+   R S+L+THM  HT  RPF C    C K+FNV+SN+ RH +LH R
Sbjct: 203 KNVCKVCGRECRRPSTLKTHMLTHTGQRPFSCRHPGCSKSFNVRSNMLRHERLHSR 258

>Kpol_1052.8 s1052 complement(23868..25028) [1161 bp, 386 aa] {ON}
           complement(23868..25028) [1161 nt, 387 aa]
          Length = 386

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 30/56 (53%), Positives = 38/56 (67%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           ++ C ICGK   R SSL THM +HT  +PF C + NC K+FN KSN+ RH KLH +
Sbjct: 304 KYHCSICGKKFKRPSSLSTHMNIHTGNKPFTCPFTNCTKSFNAKSNMLRHYKLHFK 359

>KLLA0A04609g Chr1 complement(411494..412765) [1272 bp, 423 aa] {ON}
           weakly similar to uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C
          Length = 423

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 41/56 (73%)

Query: 378 VARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           + ++QC ICG++ +R S+LQTH+ +HT  +P+KC   NC K FNVKSN+ RH K H
Sbjct: 338 LKKNQCHICGRICSRPSTLQTHLSIHTGDKPYKCPKRNCHKRFNVKSNMLRHYKRH 393

>CAGL0M01870g Chr13 complement(219813..220760) [948 bp, 315 aa] {ON}
           some similarities with uniprot|Q12145 Saccharomyces
           cerevisiae YPR013c or uniprot|Q12531 Saccharomyces
           cerevisiae YPR015c
          Length = 315

 Score = 65.9 bits (159), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 28/53 (52%), Positives = 37/53 (69%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           CK+C K   R SSL THM +HT  +P+ C ++NC K+FN KSN+ RH KLH +
Sbjct: 175 CKVCLKKFKRPSSLSTHMNIHTGEKPYPCPFDNCTKSFNAKSNMLRHYKLHFK 227

>Ecym_8379 Chr8 complement(768914..769831) [918 bp, 305 aa] {ON}
           similar to Ashbya gossypii ADL042W
          Length = 305

 Score = 65.5 bits (158), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 28/51 (54%), Positives = 36/51 (70%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           C+ICGK   R S+L+THM VH N +P+KC   +C K FNVKSN+ RH + H
Sbjct: 251 CEICGKDFKRPSALRTHMVVHNNDKPYKCEHIDCQKRFNVKSNMLRHMRKH 301

>NCAS0I01460 Chr9 complement(268223..269215) [993 bp, 330 aa] {ON}
           Anc_3.298
          Length = 330

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 28/53 (52%), Positives = 36/53 (67%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           C +CGK   R SSL+TH  + +  RP+KC + NC K+FN KSN+ RH KLH R
Sbjct: 241 CDVCGKGFRRPSSLRTHSNIRSGNRPYKCPYSNCTKSFNAKSNMLRHYKLHFR 293

>Kwal_27.10467 s27 complement(354071..354979) [909 bp, 302 aa] {ON}
           YDR043C (NRG1) - transcriptional repressor which can
           bind to UAS-1 in the STA1 promoter and which can
           interact with Ssn6p [contig 36] FULL
          Length = 302

 Score = 64.7 bits (156), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 31/66 (46%), Positives = 40/66 (60%), Gaps = 5/66 (7%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAK 439
           R+ C  CGK+  R SSL TH   HT  +P+ C ++NC K FN +SN+ RH KLH +    
Sbjct: 197 RYTCTKCGKVFNRPSSLATHNNTHTGDKPYCCPFDNCDKQFNARSNMTRHYKLHFK---- 252

Query: 440 TTDDGT 445
            TD GT
Sbjct: 253 -TDIGT 257

>TPHA0A03910 Chr1 complement(862763..863818) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 37/56 (66%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           ++ C ICGK   R SSL THM +HT  +P++C   +C K FN KSN+ RH KLH +
Sbjct: 269 KYDCNICGKKFKRPSSLNTHMNIHTGQKPYRCPHISCSKAFNAKSNMLRHYKLHFK 324

>TBLA0G03240 Chr7 (859142..860677) [1536 bp, 511 aa] {ON} Anc_3.298
          Length = 511

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 37/56 (66%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           ++ C IC K   R SSL+THM +HT  +P+ C + NC K FN KSN+ RH KLH R
Sbjct: 414 KYHCDICHKFFRRPSSLKTHMNIHTGVKPYLCPYNNCYKPFNAKSNMLRHFKLHYR 469

>ADL042W Chr4 (615815..616660) [846 bp, 281 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR015C
          Length = 281

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 34/51 (66%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           C+ICGK   R S+L+THM VH N +P+ C    C K FNVKSN+ RH + H
Sbjct: 227 CEICGKDFKRPSALRTHMVVHNNDKPYNCEHRGCQKRFNVKSNMLRHMRKH 277

>Kpol_1065.48 s1065 complement(127243..128337) [1095 bp, 364 aa]
           {ON} complement(127243..128337) [1095 nt, 365 aa]
          Length = 364

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 34/56 (60%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           ++ C +CGK   R SSL TH  +HT  +P+ C    C K FN KSN+ RH KLH R
Sbjct: 275 KYSCDVCGKKFKRPSSLNTHTNIHTGNKPYSCPAAKCKKAFNAKSNMLRHYKLHFR 330

>SAKL0A10582g Chr1 complement(930343..931209) [867 bp, 288 aa] {ON}
           conserved hypothetical protein
          Length = 288

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQ 437
           +H C  CGK   R S+L+TH  +H    P+ C W  C K FNVK NL RH ++H +++
Sbjct: 217 QHLCPECGKSFRRPSALKTHSIIHVGRSPYACTWNGCSKRFNVKGNLLRHYRIHTKKK 274

>Ecym_8389 Chr8 (797626..798381) [756 bp, 251 aa] {ON} similar to
           Ashbya gossypii ADL050W
          Length = 251

 Score = 60.5 bits (145), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 27/51 (52%), Positives = 32/51 (62%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           C IC K  TR  S+  HM VHTN +P+ C++  C K FNVK NL RH K H
Sbjct: 157 CPICYKTFTRKISVNIHMVVHTNLKPYACDYPGCKKKFNVKGNLQRHSKCH 207

>KLLA0F22319g Chr6 complement(2086613..2087224) [612 bp, 203 aa]
           {ON} some similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 203

 Score = 58.5 bits (140), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 35/47 (74%)

Query: 387 GKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           GK  +R S+L+TH+ VH+  +PFKC + +C K++NVKSNL RH K H
Sbjct: 152 GKEFSRPSTLKTHIVVHSQAKPFKCTYLDCNKSYNVKSNLRRHEKKH 198

>KNAG0H01070 Chr8 complement(178080..179048) [969 bp, 322 aa] {ON}
           Anc_3.298
          Length = 322

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 34/56 (60%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           R+ C ICGK   R SSL TH+  HT  +P+ C   +C K FN +SN+ RH K H +
Sbjct: 236 RYGCSICGKRFARPSSLNTHLNTHTGDKPYTCPHGSCSKVFNARSNMTRHYKTHFK 291

>KAFR0H01290 Chr8 complement(243463..244455) [993 bp, 330 aa] {ON}
           Anc_3.298
          Length = 330

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 32/53 (60%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           C +CGK   R SSL TH  +HT  +PF C    C KTFN +SN+ RH K H +
Sbjct: 235 CNVCGKRFKRPSSLSTHTNIHTGKKPFHCPLAKCTKTFNARSNMLRHYKAHFK 287

>TBLA0I02060 Chr9 (465675..468176) [2502 bp, 833 aa] {ON} Anc_3.298
          Length = 833

 Score = 59.7 bits (143), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 40/58 (68%)

Query: 378 VARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           + +++C+ C K   R SSL+TH+ +HT  +PFKC  + C K+FN +SN+ RH KLH +
Sbjct: 711 LTKNKCEYCLKKFRRPSSLKTHLNIHTGIQPFKCPSKRCDKSFNARSNMLRHYKLHFK 768

>SAKL0D15136g Chr4 (1255926..1256741) [816 bp, 271 aa] {ON} some
           similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 271

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/54 (51%), Positives = 31/54 (57%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRR 436
           C  C K   R S L+THM +H    PF C W NC K FNVKSNL RH + H R 
Sbjct: 218 CPKCKKEFKRPSGLRTHMVIHYGRNPFFCKWPNCSKKFNVKSNLLRHYRSHNRE 271

>ACR264W Chr3 (835313..837622) [2310 bp, 769 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR113W (AZF1)
          Length = 769

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 33/56 (58%), Gaps = 1/56 (1%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRH-CKLHLR 435
           ++C  CGK  +R  +L  HM  H NY+PF+C  ++C K+F    N+  H  + HL+
Sbjct: 543 YECDKCGKRFSRKGNLAAHMLTHENYKPFQCKLDDCNKSFTQLGNMKAHQNRFHLQ 598

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 378 VARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           V +H+C  C K  T+S+ L+ H+  H  Y+PF+C +  CGK F    NL  H +LH
Sbjct: 484 VKQHKCPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLH 537

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 33/52 (63%), Gaps = 2/52 (3%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           QC+ CGK  T+  +L+TH+ +HT  RP++C  + CGK F+ K NL  H   H
Sbjct: 516 QCEYCGKRFTQGGNLRTHVRLHTGERPYEC--DKCGKRFSRKGNLAAHMLTH 565

>NCAS0A09160 Chr1 (1811448..1813769) [2322 bp, 773 aa] {ON}
           Anc_1.326
          Length = 773

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 34/55 (61%), Gaps = 2/55 (3%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRR 436
           +C ICGK    SSSL+ H+  HT  +P  C    CGK FN  SNL++H K HL+R
Sbjct: 696 KCDICGKRFAISSSLKIHIRTHTGEKPLHCKI--CGKAFNESSNLSKHMKTHLKR 748

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 386 CGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           C K+ ++   L  HM VH+ Y+PF+C+   C K F+ +  L +H + H
Sbjct: 644 CHKIFSQRQRLVRHMRVHSGYKPFQCSI--CKKHFSNEETLKQHERTH 689

>KNAG0I02070 Chr9 (402292..404010) [1719 bp, 572 aa] {ON} Anc_2.162
           YOR113W
          Length = 572

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 378 VARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           + +H+C IC KL  + + L+ H+  H   +P+KC W  CGK F    NL  H +LH
Sbjct: 385 IKQHECNICHKLFIQLTHLEVHLRSHLGDKPYKCTW--CGKGFTQGGNLKTHVRLH 438

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           ++C  CGK  T+  +L+TH+ +HT  +PF C +  C K F+ K NL  H   H +
Sbjct: 416 YKCTWCGKGFTQGGNLKTHVRLHTGEKPFSCEF--CSKRFSRKGNLTAHLVTHEK 468

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 4/50 (8%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTF----NVKSNLNR 428
           C+ C K  +R  +L  H+  H   RPF C    C KTF    N+KS+ NR
Sbjct: 446 CEFCSKRFSRKGNLTAHLVTHEKVRPFVCKLNGCMKTFTQLGNMKSHQNR 495

>Ecym_6295 Chr6 complement(553427..555418) [1992 bp, 663 aa] {ON}
           similar to Ashbya gossypii AEL174W
          Length = 663

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRR 436
           +C+ C K  T SSSL+ H+  HT  +P  CN   CGK FN  SNL++H K+H R+
Sbjct: 575 KCQFCDKRFTTSSSLRIHIRTHTGEKPLACNV--CGKRFNESSNLSKHMKIHERK 627

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 33/57 (57%), Gaps = 4/57 (7%)

Query: 379 ARHQCKI--CGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           + +QC+   C K   +   L  H+ VHT Y+PFKC   +C KTF+ +  L++H + H
Sbjct: 514 SSYQCRWDGCTKHFAQRQKLLRHIKVHTGYKPFKC--PHCSKTFSTEDILSQHIRTH 568

>SAKL0E10714g Chr5 (892885..895344) [2460 bp, 819 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 819

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 378 VARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           V +H+C  C K  T+S+ L+ H+  H  Y+PF+C +  CGK F    NL  H +LH
Sbjct: 537 VKQHECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHTRLH 590

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           QC+ CGK  T+  +L+TH  +HT  +P+ C  E CGK F+ K NL  H   H
Sbjct: 569 QCEYCGKRFTQGGNLRTHTRLHTGEKPYSC--EKCGKRFSRKGNLAAHMLTH 618

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRH-CKLHLR 435
           + C+ CGK  +R  +L  HM  H N +P+ C  + C K+F    NL  H  + HL+
Sbjct: 596 YSCEKCGKRFSRKGNLAAHMLTHENLKPYHCKLDGCSKSFTQLGNLKAHQNRFHLQ 651

>ZYRO0G20526g Chr7 (1691182..1693731) [2550 bp, 849 aa] {ON} weakly
           similar to uniprot|P47043 Saccharomyces cerevisiae
           YJL056C ZAP1 Zinc-regulated transcription factor binds
           to zinc-responsive promoter elements to induce
           transcription of certain genes in the presence of zinc
           regulates its own transcription contains seven zinc-
           finger domains
          Length = 849

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRR 436
           +C +CGK  + SSSL+ H+  HT  +P +C    CGK FN  SNLN+H K H ++
Sbjct: 764 KCHLCGKSFSVSSSLKIHIRTHTGEKPLQCKI--CGKRFNESSNLNKHLKTHRKK 816

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 32/52 (61%), Gaps = 2/52 (3%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           +C++C K  +   +L  HM  H+  +PFKC+   CGK+F+V S+L  H + H
Sbjct: 736 KCQVCLKSFSSEDTLNQHMRTHSGEKPFKCHL--CGKSFSVSSSLKIHIRTH 785

 Score = 37.7 bits (86), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 384 KICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           K C +  T+   +  H+ VH+ Y+PFKC  + C K+F+ +  LN+H + H
Sbjct: 710 KGCCRKFTQRQKMVRHLKVHSGYKPFKC--QVCLKSFSSEDTLNQHMRTH 757

 Score = 34.7 bits (78), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 4/48 (8%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRH 429
           QCKICGK    SS+L  H+  H   + +KC+   C ++F+ +     H
Sbjct: 792 QCKICGKRFNESSNLNKHLKTHR--KKYKCSC--CFRSFDTEEKFKAH 835

>Ecym_5424 Chr5 (873049..875376) [2328 bp, 775 aa] {ON} similar to
           Ashbya gossypii ACR264W
          Length = 775

 Score = 53.5 bits (127), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 378 VARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           V +H+C  C K  T+S+ L+ H+  H  Y+PF+C +  CGK F    NL  H +LH
Sbjct: 488 VKQHECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLH 541

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 33/56 (58%), Gaps = 1/56 (1%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRH-CKLHLR 435
           ++C  CGK  +R  +L  HM  H N++PF+C  ++C K+F    N+  H  + HL+
Sbjct: 547 YECDKCGKRFSRKGNLAAHMLTHENHKPFQCKLDDCNKSFTQLGNMKAHQNRFHLQ 602

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 33/52 (63%), Gaps = 2/52 (3%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           QC+ CGK  T+  +L+TH+ +HT  RP++C  + CGK F+ K NL  H   H
Sbjct: 520 QCEYCGKRFTQGGNLRTHVRLHTGERPYEC--DKCGKRFSRKGNLAAHMLTH 569

>TDEL0B05250 Chr2 complement(922332..924476) [2145 bp, 714 aa] {ON}
           Anc_2.162 YOR113W
          Length = 714

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 378 VARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           V +H+C  C +  T+S+ L+ H+  H  Y+PF+C +  CGK F    NL  H +LH
Sbjct: 421 VKQHECPYCHRFFTQSTHLEVHVRSHIGYKPFQCQY--CGKRFTQGGNLRTHQRLH 474

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 33/54 (61%), Gaps = 2/54 (3%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           QC+ CGK  T+  +L+TH  +HT  +P++C  E CGK F+ K NL  H   H +
Sbjct: 453 QCQYCGKRFTQGGNLRTHQRLHTGEKPYEC--ELCGKRFSRKGNLAAHVVTHQK 504

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRH-CKLHL 434
           ++C++CGK  +R  +L  H+  H   +PF C  + C KTF    N+  H  + HL
Sbjct: 480 YECELCGKRFSRKGNLAAHVVTHQKLKPFICKLDGCNKTFTQLGNMKAHQNRFHL 534

>SAKL0A10648g Chr1 (934819..935604) [786 bp, 261 aa] {ON} some
           similarities with uniprot|Q6Q5F4 Saccharomyces
           cerevisiae YPR015C Hypothetical ORF
          Length = 261

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 31/56 (55%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRR 436
           + C  C K+  R S+L+TH  +H    P+ C    C K FNVKSNL RH K H  R
Sbjct: 199 YSCPECEKVFGRPSALRTHSIIHIGKSPYICQLPGCAKRFNVKSNLLRHVKSHYGR 254

>NDAI0G05800 Chr7 complement(1436085..1438595) [2511 bp, 836 aa]
           {ON} Anc_1.326
          Length = 836

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 2/54 (3%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           QC +C K  T +SSL+ H+  HT  +P KC    CGK FN  SNL++H K H +
Sbjct: 767 QCHLCDKRFTIASSLKIHIRTHTGEKPLKCKI--CGKAFNESSNLSKHIKTHFK 818

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 13/52 (25%), Positives = 25/52 (48%), Gaps = 3/52 (5%)

Query: 385 ICGKLMTRSSSLQTHM---YVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           +C ++      L TH+   ++      ++C+W  C K F  +  + RH K+H
Sbjct: 681 LCDQVFNSKEDLNTHLENDHLLKGQSQYQCHWHGCSKKFTQRQKMVRHLKVH 732

 Score = 31.6 bits (70), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 9/71 (12%)

Query: 387 GKLMTRSSSLQTHMYVHTNYRP-FKCNWENCGKTFNVKSNLNRH-CKLH-------LRRQ 437
            KLM  ++++  +     N  P  KC W +C ++FN    L +H  K H       L++ 
Sbjct: 506 NKLMQDNNTVNFNWIFKKNDEPTLKCKWADCTESFNTLLELQKHIIKDHVSLPATTLQQT 565

Query: 438 AKTTDDGTGGN 448
           AK T++G   N
Sbjct: 566 AKATENGQQDN 576

>Kwal_47.17888 s47 (593447..595807) [2361 bp, 786 aa] {ON} YOR113W
           (AZF1) - similar to Zn-finger transcription factors
           [contig 204] FULL
          Length = 786

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 378 VARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
             +H+C  C K  T+S+ L+ H+  H  Y+PF+C +  CGK F    NL  H +LH
Sbjct: 500 AKQHECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLH 553

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 2/52 (3%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           QC+ CGK  T+  +L+TH+ +HT  +P++C  E CG+ F+ K NL  H   H
Sbjct: 532 QCEYCGKRFTQGGNLRTHVRLHTGEKPYEC--EKCGRRFSRKGNLAAHRLTH 581

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRH-CKLHLR 435
           ++C+ CG+  +R  +L  H   H N +PF C  + C K+F    N+  H  + HL+
Sbjct: 559 YECEKCGRRFSRKGNLAAHRLTHENLKPFHCKLDGCNKSFTQLGNMKAHQNRFHLQ 614

>TDEL0D01950 Chr4 complement(377508..379775) [2268 bp, 755 aa] {ON}
           Anc_1.326 YJL056C
          Length = 755

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/55 (43%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRR 436
           +C+ICGK    SSSL+ H+  HT  +P +C    CG+ F+  SNLN+H K H ++
Sbjct: 676 ECRICGKRFAVSSSLKIHIRTHTGEKPLQCKI--CGRRFSESSNLNKHMKSHQKK 728

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           ++C+ CGK  +   +L  H   H+  +PF+C    CGK F V S+L  H + H
Sbjct: 647 YKCQDCGKCFSSEDTLTQHKRTHSGEKPFECRI--CGKRFAVSSSLKIHIRTH 697

 Score = 39.3 bits (90), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 386 CGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           C K   +   L  H+ VH+ Y+P+KC  ++CGK F+ +  L +H + H
Sbjct: 624 CDKRFAQRQKLVRHLKVHSGYKPYKC--QDCGKCFSSEDTLTQHKRTH 669

>ZYRO0A02288g Chr1 (181918..183777) [1860 bp, 619 aa] {ON} similar
           to uniprot|Q288C3 Torulaspora delbrueckii CRZ1
           Calcineurin-responsive zinc finger transcription factor
           and some similarites with YNL027W uniprot|P53968
           Saccharomyces cerevisiae YNL027W CRZ1 Transcription
           factor that activates transcription of genes involved in
           stress response nuclear localization is positively
           regulated by calcineurin-mediated dephosphorylation
          Length = 619

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 35/55 (63%), Gaps = 2/55 (3%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQ 437
           C++CGK  TR  +L++H+  HTN RPF+C+   CGK F  + +  RH  LH  ++
Sbjct: 510 CELCGKRFTRPYNLKSHLRTHTNERPFECSI--CGKAFARQHDRKRHEDLHTGKK 562

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 26/64 (40%), Gaps = 9/64 (14%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCN--------WENCGKTFNVKSNLNRHCKLH 433
           +C ICGK   R    + H  +HT  + + C         W  CGK F     L RH K  
Sbjct: 537 ECSICGKAFARQHDRKRHEDLHTGKKRYVCGGTLKNGSSW-GCGKKFARSDALGRHFKTE 595

Query: 434 LRRQ 437
             R+
Sbjct: 596 SGRR 599

>KLTH0E09724g Chr5 (876916..879222) [2307 bp, 768 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 768

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           +H+C  C K  T+S+ L+ H+  H  Y+PF+C +  CGK F    NL  H +LH
Sbjct: 485 QHECPYCHKCFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHVRLH 536

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 2/52 (3%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           QC+ CGK  T+  +L+TH+ +HT  +P++C  E CG+ F+ K NL  H   H
Sbjct: 515 QCEYCGKRFTQGGNLRTHVRLHTGEKPYEC--EKCGRRFSRKGNLAAHRLTH 564

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRH-CKLHLR 435
           ++C+ CG+  +R  +L  H   H N +PF C  + C K+F    N+  H  + HL+
Sbjct: 542 YECEKCGRRFSRKGNLAAHRLTHENLKPFHCKLDGCNKSFTQLGNMKAHQNRFHLQ 597

>TPHA0G03750 Chr7 complement(794102..795142) [1041 bp, 346 aa] {ON} 
          Length = 346

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 24/35 (68%)

Query: 386 CGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTF 420
           CGK+  R S LQ H Y HTN RP+ C +ENCGK F
Sbjct: 21  CGKIYDRPSLLQQHRYSHTNERPYACQYENCGKKF 55

>NDAI0B04290 Chr2 (1077647..1080841) [3195 bp, 1064 aa] {ON}
           Anc_2.162
          Length = 1064

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 34/54 (62%), Gaps = 2/54 (3%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           +H+C  C +L ++S+ L+ H+  H  Y+PF+CN+  CGK F    NL  H +LH
Sbjct: 599 QHECPYCHRLFSQSTHLEVHIRSHLGYKPFQCNF--CGKRFTQGGNLRTHQRLH 650

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRH-CKLHLR 435
           ++C+IC K  +R  +L  H   H + +PF C  +NC KTF    N+  H  K HL+
Sbjct: 656 YRCEICDKRFSRKGNLAAHKLTHRDVKPFVCKLDNCNKTFTQLGNMKAHQNKFHLQ 711

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           QC  CGK  T+  +L+TH  +HT  +P++C  E C K F+ K NL  H   H
Sbjct: 629 QCNFCGKRFTQGGNLRTHQRLHTGEKPYRC--EICDKRFSRKGNLAAHKLTH 678

>TBLA0B01280 Chr2 complement(271520..273991) [2472 bp, 823 aa] {ON}
           Anc_2.162 YOR113W
          Length = 823

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           HQC  C +  ++S+ L+ H+  H  Y+P++CN+  CGK F    NL  H +LH
Sbjct: 517 HQCPYCHRFFSQSTHLEVHIRSHIGYKPYQCNF--CGKKFTQGGNLKTHQRLH 567

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           +QC  CGK  T+  +L+TH  +HT  +P+ C    C K F+ K NL  H   H +
Sbjct: 545 YQCNFCGKKFTQGGNLKTHQRLHTGEKPYSCKI--CNKRFSRKGNLTAHVLTHKK 597

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRH 429
           + CKIC K  +R  +L  H+  H   +P+ C  +NC KTF    N+  H
Sbjct: 573 YSCKICNKRFSRKGNLTAHVLTHKKLKPYFCKLDNCNKTFTQLGNMKAH 621

>CAGL0K12078g Chr11 complement(1169818..1171209) [1392 bp, 463 aa]
           {ON} weakly similar to uniprot|Q03125 Saccharomyces
           cerevisiae YDR043c NRG1
          Length = 463

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 32/57 (56%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRR 436
           ++ CK+CGK  T S  L  H  +HT  +   C +E CG+ FN   N  +H K HL+R
Sbjct: 401 KYLCKVCGKGFTTSGHLARHNRIHTGEKRHVCPYEGCGQRFNRHDNCLQHYKTHLKR 457

>Kpol_1072.58 s1072 complement(131384..133768) [2385 bp, 794 aa]
           {ON} complement(131384..133768) [2385 nt, 795 aa]
          Length = 794

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 378 VARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           + +H+C  C +  T+S+ L+ H+  H  Y+PF+C +  CGK F    NL  H +LH
Sbjct: 505 IKQHECPYCHRFFTQSTHLEVHVRSHIGYKPFQCEY--CGKRFTQGGNLRTHQRLH 558

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           QC+ CGK  T+  +L+TH  +HT  RP+ C  E CGK F+ K NL  H   H +
Sbjct: 537 QCEYCGKRFTQGGNLRTHQRLHTGERPYSC--ELCGKKFSRKGNLAAHFLTHQK 588

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 1/55 (1%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRH-CKLHL 434
           + C++CGK  +R  +L  H   H   +P+ C  + C K+F    N+  H  + HL
Sbjct: 564 YSCELCGKKFSRKGNLAAHFLTHQKLKPYVCKLDECNKSFTQLGNMKAHQNRFHL 618

>TPHA0B02910 Chr2 complement(662998..665151) [2154 bp, 717 aa] {ON}
           Anc_2.162 YOR113W
          Length = 717

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           QC+ CGK  T+  +L+TH  +HT  +P+ C  E CGK F+ K NL  H   H +
Sbjct: 438 QCEFCGKRFTQGGNLRTHQRLHTGEKPYNC--EMCGKRFSRKGNLAAHALTHQK 489

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 33/56 (58%), Gaps = 2/56 (3%)

Query: 378 VARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           + +H+C  C +  T+S+ L+ H+  H  Y+PF+C +  CGK F    NL  H +LH
Sbjct: 406 MKQHECPYCHRFFTQSTHLEVHVRSHIGYKPFQCEF--CGKRFTQGGNLRTHQRLH 459

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRH-CKLHLR 435
           + C++CGK  +R  +L  H   H   +P+ C  ENC K+F    N+  H  + HL+
Sbjct: 465 YNCEMCGKRFSRKGNLAAHALTHQKLKPYICKLENCNKSFTQLGNMKAHQNRFHLK 520

>Kpol_1050.19 s1050 complement(48007..48672) [666 bp, 221 aa] {ON}
           complement(48007..48672) [666 nt, 222 aa]
          Length = 221

 Score = 49.3 bits (116), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 31/54 (57%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRR 436
           C++C +   R    + H+ +HT  +P+KC + NC K F+    LNRH K+H  R
Sbjct: 21  CEVCNRGFYRLEHKKRHLKIHTGEKPYKCLYLNCSKKFSRSDELNRHSKVHHSR 74

>KAFR0C04550 Chr3 (911728..913131) [1404 bp, 467 aa] {ON} 
          Length = 467

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 2/52 (3%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           QC+ CGK  T+  +L+TH  +HT  +P++C  E+CG+ F+ K NL  H   H
Sbjct: 331 QCQFCGKKFTQGGNLRTHQRLHTGEKPYQC--ESCGRRFSRKGNLAAHILTH 380

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 33/54 (61%), Gaps = 2/54 (3%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           +H+C  C +L ++S+ L+ H+  H  Y+PF+C +  CGK F    NL  H +LH
Sbjct: 301 KHECPYCHRLFSQSTHLEVHIRSHIGYKPFQCQF--CGKKFTQGGNLRTHQRLH 352

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRH-CKLHL 434
           +QC+ CG+  +R  +L  H+  H N +PF C  +NC K+F    N+  H  + HL
Sbjct: 358 YQCESCGRRFSRKGNLAAHILTHKNLKPFVCKLDNCDKSFTQLGNMKAHQNRFHL 412

>SAKL0E07216g Chr5 complement(592229..593875) [1647 bp, 548 aa] {ON}
           some similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 548

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 35/59 (59%), Gaps = 2/59 (3%)

Query: 379 ARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQ 437
           A + C++C K  TR  +L++H+  HT+ RPF CN   CGK F  + +  RH  LH  ++
Sbjct: 422 AIYACELCDKKFTRPYNLKSHLRTHTDERPFACNV--CGKAFARQHDRKRHEDLHTGKK 478

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 25/63 (39%), Gaps = 9/63 (14%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCN--------WENCGKTFNVKSNLNRHCKLHL 434
           C +CGK   R    + H  +HT  + + C         W  CGK F     L RH K   
Sbjct: 454 CNVCGKAFARQHDRKRHEDLHTGKKRYICGGNLKDGTSW-GCGKKFARSDALGRHFKTDS 512

Query: 435 RRQ 437
            R+
Sbjct: 513 GRR 515

>Suva_6.132 Chr6 (219016..221652) [2637 bp, 878 aa] {ON} YJL056C
           (REAL)
          Length = 878

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 27/62 (43%), Positives = 38/62 (61%), Gaps = 3/62 (4%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAKT 440
           ++C IC K    SSSL+ H+  HT  +P +C    CGK FN  SNL++H K H +++ K 
Sbjct: 794 YKCHICDKKFAISSSLKIHIRTHTGEKPLQCKI--CGKRFNESSNLSKHIKTH-KKKYKC 850

Query: 441 TD 442
           TD
Sbjct: 851 TD 852

 Score = 30.8 bits (68), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 27/57 (47%), Gaps = 3/57 (5%)

Query: 382 QCKICGKLMTRSSSLQTHM---YVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           Q   C K  T +  L  H+   ++      ++C W +C +TF  +  L RH K+H +
Sbjct: 706 QWDGCNKQFTNAQELNNHLESVHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLKVHSK 762

>TPHA0A05820 Chr1 complement(1319614..1320444) [831 bp, 276 aa] {ON}
           Anc_3.518 YGL209W
          Length = 276

 Score = 49.7 bits (117), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 31/52 (59%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHL 434
           C+ CG+   R    + H+ +HT  +P+KC +E C K+F+    L RH K+H+
Sbjct: 39  CESCGRGFYRLEHKKRHLKIHTGEKPYKCKFEQCIKSFSRSDELRRHSKIHI 90

>Smik_10.184 Chr10 complement(322050..324707) [2658 bp, 885 aa] {ON}
           YJL056C (REAL)
          Length = 885

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRR 436
           ++C IC K  + SSSL+ H+  HT  +P +C    CGK FN  SNL++H K H ++
Sbjct: 799 YKCDICNKKFSISSSLKIHIRTHTGEKPLQCKI--CGKRFNESSNLSKHIKTHKKK 852

>Ecym_3341 Chr3 (647938..649620) [1683 bp, 560 aa] {ON} similar to
           Ashbya gossypii ADL198W
          Length = 560

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 379 ARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           A + C +C K  TR  +L++H+  HT+ RPF CN   CGK F  + +  RH  LH
Sbjct: 436 AIYSCDLCNKKFTRPYNLKSHLRTHTDERPFACNM--CGKAFARQHDRKRHEDLH 488

>CAGL0L03916g Chr12 complement(450952..452880) [1929 bp, 642 aa]
           {ON} weakly similar to uniprot|P41696 Saccharomyces
           cerevisiae YOR113w AZF1 asparagine-rich zinc finger
           protein
          Length = 642

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           +QC  C K+ ++S+ L  H+  H  Y+PF+C +  CGK F    NL  H +LH
Sbjct: 480 YQCAYCSKMFSQSTHLDVHIKAHMGYKPFECEF--CGKRFTQAGNLRTHRRLH 530

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 32/52 (61%), Gaps = 2/52 (3%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           +C+ CGK  T++ +L+TH  +HT  RPFKC  + C KTF  + NL  H   H
Sbjct: 509 ECEFCGKRFTQAGNLRTHRRLHTGERPFKC--DKCDKTFARRGNLTAHEFTH 558

>YOR113W Chr15 (534075..536819) [2745 bp, 914 aa] {ON}
           AZF1Zinc-finger transcription factor, involved in
           induction of CLN3 transcription in response to glucose;
           genetic and physical interactions indicate a possible
           role in mitochondrial transcription or genome
           maintenance
          Length = 914

 Score = 50.8 bits (120), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 378 VARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           V +H+C  C +L ++++ L+ H+  H  Y+PF C++  CGK F    NL  H +LH
Sbjct: 590 VKKHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDY--CGKRFTQGGNLRTHERLH 643

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 31/58 (53%), Gaps = 4/58 (6%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTF----NVKSNLNRHCKLHL 434
           + C IC K  +R  +L  H+  H   +PF C  ENC KTF    N+K++ NR  K  L
Sbjct: 649 YSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQNRFHKETL 706

>KAFR0B04580 Chr2 (951625..953814) [2190 bp, 729 aa] {ON} Anc_2.162
           YOR113W
          Length = 729

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRH-CKLHLR 435
           +QC++CGK  +R  +L  H+  H   +PF C  +NC K+F    N+  H  K HL 
Sbjct: 549 YQCELCGKRFSRKGNLAAHVLTHKKIKPFICKLDNCNKSFTQLGNMKGHQNKFHLE 604

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 34/55 (61%), Gaps = 2/55 (3%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           +QC+ CGK  T+  +L+TH  +HT  +P++C  E CGK F+ K NL  H   H +
Sbjct: 521 YQCQYCGKKFTQGGNLRTHERLHTGEKPYQC--ELCGKRFSRKGNLAAHVLTHKK 573

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 378 VARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           V +H+C+ C +  T+ + L+ H+  H   +P++C +  CGK F    NL  H +LH
Sbjct: 490 VKQHECRYCHRFFTQLTHLEVHIRSHIGIKPYQCQY--CGKKFTQGGNLRTHERLH 543

>Suva_14.318 Chr14 (561697..562047,562519..564213) [2046 bp, 681 aa]
           {ON} YNL027W (REAL)
          Length = 681

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 34/59 (57%), Gaps = 2/59 (3%)

Query: 379 ARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQ 437
           A   C +CGK  TR  +L++H+  HTN RPF C+   CGK F  + +  RH  LH  ++
Sbjct: 570 ANFACDVCGKKFTRPYNLKSHLRTHTNERPFICSI--CGKAFARQHDRKRHEDLHTGKK 626

 Score = 30.8 bits (68), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 24/62 (38%), Gaps = 7/62 (11%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWE-------NCGKTFNVKSNLNRHCKLHLR 435
           C ICGK   R    + H  +HT  + + C  +        C K F     L RH K    
Sbjct: 602 CSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPWGCSKKFARSDALGRHFKTESG 661

Query: 436 RQ 437
           R+
Sbjct: 662 RR 663

>Skud_15.276 Chr15 (490511..493264) [2754 bp, 917 aa] {ON} YOR113W
           (REAL)
          Length = 917

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 378 VARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           V +H+C  C +L ++++ L+ H+  H  Y+PF C++  CGK F    NL  H +LH
Sbjct: 591 VKKHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDY--CGKRFTQGGNLRTHERLH 644

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 31/58 (53%), Gaps = 4/58 (6%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTF----NVKSNLNRHCKLHL 434
           + C IC K  +R  +L  H+  H   +PF C  ENC KTF    N+K++ NR  K  L
Sbjct: 650 YSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQNRFHKETL 707

>ZYRO0B16148g Chr2 (1308101..1310893) [2793 bp, 930 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 930

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 378 VARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           V +H+C  C +  T+S+ L+ H+  H  Y+PF C  E CGK F    NL  H +LH
Sbjct: 559 VKQHECPYCHRFFTQSTHLEVHVRSHIGYKPFLC--ECCGKRFTQGGNLRTHQRLH 612

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           C+ CGK  T+  +L+TH  +HT  +P++C  E CGK F+ K NL  H   H +
Sbjct: 592 CECCGKRFTQGGNLRTHQRLHTGEKPYEC--ELCGKRFSRKGNLAAHIVTHQK 642

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRH-CKLHL 434
           ++C++CGK  +R  +L  H+  H   +PF C  + C KTF    N+  H  + HL
Sbjct: 618 YECELCGKRFSRKGNLAAHIVTHQKLKPFVCKLDGCNKTFTQLGNMKAHQNRFHL 672

>Suva_8.166 Chr8 (291812..294658) [2847 bp, 948 aa] {ON} YOR113W
           (REAL)
          Length = 948

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 378 VARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           + +H+C  C +L ++++ L+ H+  H  Y+PF C++  CGK F    NL  H +LH
Sbjct: 621 IKKHECPYCHRLFSQATHLEVHVRSHIGYKPFACDY--CGKRFTQGGNLRTHERLH 674

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 31/58 (53%), Gaps = 4/58 (6%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTF----NVKSNLNRHCKLHL 434
           + C IC K  +R  +L  H+  H   +PF C  ENC KTF    N+K++ NR  K  L
Sbjct: 680 YSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCDKTFTQLGNMKAHQNRFHKETL 737

>KLLA0F23782g Chr6 (2219920..2222268) [2349 bp, 782 aa] {ON} weakly
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113W AZF1 Zinc-finger transcription factor involved
           in induction of CLN3 transcription in response to
           glucose genetic and physical interactions indicate a
           possible role in mitochondrial transcription or genome
           maintenance
          Length = 782

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 31/56 (55%), Gaps = 2/56 (3%)

Query: 378 VARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           V + QC  C K  T+S+ L+ H+  H  Y+PF C +  CGK F    NL  H +LH
Sbjct: 520 VKQFQCPYCHKYFTQSTHLEVHVRSHIGYKPFSCEF--CGKRFTQGGNLRTHIRLH 573

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           C+ CGK  T+  +L+TH+ +HT  +P++C  E CG+ F+ K NL  H   H
Sbjct: 553 CEFCGKRFTQGGNLRTHIRLHTGEKPYEC--ERCGRKFSRKGNLAAHKLTH 601

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRH-CKLHLR 435
           ++C+ CG+  +R  +L  H   H N +PF+C  ++C K F    N+  H  + HL+
Sbjct: 579 YECERCGRKFSRKGNLAAHKLTHDNLKPFECKLDDCNKNFTQLGNMKAHQNRFHLQ 634

>Smik_15.291 Chr15 (495292..498021) [2730 bp, 909 aa] {ON} YOR113W
           (REAL)
          Length = 909

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 378 VARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           V +H+C  C +L ++++ L+ H+  H  Y+PF C++  CGK F    NL  H +LH
Sbjct: 580 VKKHECPYCHRLFSQATHLEVHVRSHIGYKPFVCDY--CGKRFTQGGNLRTHERLH 633

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 31/58 (53%), Gaps = 4/58 (6%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTF----NVKSNLNRHCKLHL 434
           + C IC K  +R  +L  H+  H   +PF C  ENC KTF    N+K++ NR  K  L
Sbjct: 639 YSCDICDKKFSRKGNLAAHLVTHQKLKPFVCKLENCNKTFTQLGNMKAHQNRFHKETL 696

>TBLA0F01300 Chr6 (326311..329268) [2958 bp, 985 aa] {ON} Anc_1.326
           YJL056C
          Length = 985

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 35/53 (66%), Gaps = 2/53 (3%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           ++C+ICGK  + SSSL+ H+  HT  +PF+C    CGK F   SN ++H K+H
Sbjct: 928 YKCEICGKSFSISSSLKIHVRTHTGEKPFECKV--CGKRFVESSNYSKHMKVH 978

 Score = 38.9 bits (89), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 30/52 (57%), Gaps = 2/52 (3%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           +C +C +  +   +L  H   H+  +P+KC  E CGK+F++ S+L  H + H
Sbjct: 901 KCDVCSRCFSSKETLIQHYRTHSGEKPYKC--EICGKSFSISSSLKIHVRTH 950

 Score = 30.8 bits (68), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 4/55 (7%)

Query: 381 HQCKI--CGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           ++CK   C K+  +   +  H+  H+ ++PFKC+   C + F+ K  L +H + H
Sbjct: 870 YECKWHNCHKVFKQRQKILRHLKTHSGFKPFKCDV--CSRCFSSKETLIQHYRTH 922

>Kwal_14.2543 s14 (807668..809803) [2136 bp, 711 aa] {ON} YJL056C
           (ZAP1) - Metalloregulatory protein involved in
           zinc-responsive transcriptional regulation [contig 224]
           FULL
          Length = 711

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRR 436
           ++C  CGK    SSSL+ H+  HT  +P +C    CGK FN  SNL++H + H R+
Sbjct: 634 YKCSHCGKGFATSSSLRIHIRTHTGEKPLECKV--CGKRFNESSNLSKHMRTHERK 687

 Score = 38.5 bits (88), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 30/48 (62%), Gaps = 2/48 (4%)

Query: 386 CGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           CG+++T+   L  H+ VHT Y+P KC   +C KTF+ +  L +H + H
Sbjct: 583 CGRVITQRQKLLRHLRVHTRYKPCKC--VHCLKTFSTQDILQQHMRTH 628

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           +C  C K  +    LQ HM  H+  +P+KC+  +CGK F   S+L  H + H
Sbjct: 607 KCVHCLKTFSTQDILQQHMRTHSGEKPYKCS--HCGKGFATSSSLRIHIRTH 656

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 5/61 (8%)

Query: 380 RHQCK--ICGKLMTRSSSLQTHM---YVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHL 434
           +H C+   C +  +    L TH+   ++      + C WENCG+    +  L RH ++H 
Sbjct: 542 KHICRWDACMQEFSSCEELNTHIEKEHIPRGKSSYVCGWENCGRVITQRQKLLRHLRVHT 601

Query: 435 R 435
           R
Sbjct: 602 R 602

>Smik_14.303 Chr14 (542116..544137) [2022 bp, 673 aa] {ON} YNL027W
           (REAL)
          Length = 673

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 34/59 (57%), Gaps = 2/59 (3%)

Query: 379 ARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQ 437
           A   C +CGK  TR  +L++H+  HTN RPF C+   CGK F  + +  RH  LH  ++
Sbjct: 562 ANFACDVCGKKFTRPYNLKSHLRTHTNERPFICSI--CGKAFARQHDRKRHEDLHTGKK 618

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 25/63 (39%), Gaps = 9/63 (14%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCN--------WENCGKTFNVKSNLNRHCKLHL 434
           C ICGK   R    + H  +HT  + + C         W  CGK F     L RH K   
Sbjct: 594 CSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPW-GCGKKFARSDALGRHFKTES 652

Query: 435 RRQ 437
            R+
Sbjct: 653 GRR 655

>Skud_14.301 Chr14 (550283..552331) [2049 bp, 682 aa] {ON} YNL027W
           (REAL)
          Length = 682

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 34/59 (57%), Gaps = 2/59 (3%)

Query: 379 ARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQ 437
           A   C +CGK  TR  +L++H+  HTN RPF C+   CGK F  + +  RH  LH  ++
Sbjct: 571 ANFACDVCGKKFTRPYNLKSHLRTHTNERPFICSI--CGKAFARQHDRKRHEDLHTGKK 627

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 25/63 (39%), Gaps = 9/63 (14%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCN--------WENCGKTFNVKSNLNRHCKLHL 434
           C ICGK   R    + H  +HT  + + C         W  CGK F     L RH K   
Sbjct: 603 CSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPW-GCGKKFARSDALGRHFKTES 661

Query: 435 RRQ 437
            R+
Sbjct: 662 GRR 664

>YNL027W Chr14 (579580..581616) [2037 bp, 678 aa] {ON}
           CRZ1Transcription factor that activates transcription of
           genes involved in stress response; nuclear localization
           is positively regulated by calcineurin-mediated
           dephosphorylation
          Length = 678

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 34/59 (57%), Gaps = 2/59 (3%)

Query: 379 ARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQ 437
           A   C +CGK  TR  +L++H+  HTN RPF C+   CGK F  + +  RH  LH  ++
Sbjct: 567 ANFACDVCGKKFTRPYNLKSHLRTHTNERPFICSI--CGKAFARQHDRKRHEDLHTGKK 623

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 25/63 (39%), Gaps = 9/63 (14%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCN--------WENCGKTFNVKSNLNRHCKLHL 434
           C ICGK   R    + H  +HT  + + C         W  CGK F     L RH K   
Sbjct: 599 CSICGKAFARQHDRKRHEDLHTGKKRYVCGGKLKDGKPW-GCGKKFARSDALGRHFKTES 657

Query: 435 RRQ 437
            R+
Sbjct: 658 GRR 660

>YJL056C Chr10 complement(330431..333073) [2643 bp, 880 aa] {ON}
           ZAP1Zinc-regulated transcription factor; binds to
           zinc-responsive promoters to induce transcription of
           certain genes in presence of zinc, represses other genes
           in low zinc; regulates its own transcription; contains
           seven zinc-finger domains
          Length = 880

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRR 436
           ++C IC K    SSSL+ H+  HT  +P +C    CGK FN  SNL++H K H ++
Sbjct: 796 YKCHICNKKFAISSSLKIHIRTHTGEKPLQCKI--CGKRFNESSNLSKHIKTHQKK 849

>TPHA0O01440 Chr15 (289051..291387) [2337 bp, 778 aa] {ON} Anc_1.326
           YJL056C
          Length = 778

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 36/59 (61%), Gaps = 3/59 (5%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAK 439
           ++C +CG   + +SSL+ H   HT  +P  CN   CGK FN  SNL++H K H ++Q K
Sbjct: 701 YKCDMCGNSFSSASSLKVHKRTHTGEKPLSCNV--CGKRFNSSSNLSKHVKTH-KKQYK 756

 Score = 37.7 bits (86), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           CK CGK  +    L  H  VH+  +P+KC+   CG +F+  S+L  H + H
Sbjct: 675 CKTCGKNFSNQEILIQHQRVHSGEKPYKCDM--CGNSFSSASSLKVHKRTH 723

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 29/48 (60%), Gaps = 2/48 (4%)

Query: 386 CGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           C +  T+   L  H+ VHT+Y+PF C  + CGK F+ +  L +H ++H
Sbjct: 650 CDRRFTQKQKLVRHLRVHTHYKPFTC--KTCGKNFSNQEILIQHQRVH 695

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 3/51 (5%)

Query: 386 CGKLMTRSSSLQTHM---YVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           CGKL      L  H+   ++ +    + C WENC + F  K  L RH ++H
Sbjct: 617 CGKLFENEEMLNNHVEKTHLLSRQSEYYCKWENCDRRFTQKQKLVRHLRVH 667

>CAGL0J05060g Chr10 (481253..483394) [2142 bp, 713 aa] {ON} similar
           to uniprot|P47043 Saccharomyces cerevisiae YJL056c ZAP1
           metalloregulatory protein
          Length = 713

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRR 436
           ++C IC K    S+SL+ H+  HT  +P KC    CG+ FN  SNL++H K H+++
Sbjct: 625 YECHICHKRFAISNSLKIHIRTHTGEKPLKCKV--CGRCFNESSNLSKHMKTHMKK 678

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 386 CGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           C K  ++   L  H+ VH+ Y+P++C    C K F+ +  LN+H ++H
Sbjct: 574 CNKTFSQRQKLVRHLKVHSKYKPYQC--PQCQKCFSTEDTLNQHKRVH 619

 Score = 34.7 bits (78), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 3/53 (5%)

Query: 386 CGKLMTRSSSLQTH---MYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           C +    +  L  H   M++      + C WE C KTF+ +  L RH K+H +
Sbjct: 541 CNERFKSAGDLNDHLEEMHLTKGKSQYTCEWEGCNKTFSQRQKLVRHLKVHSK 593

>Skud_10.152 Chr10 (285800..288439) [2640 bp, 879 aa] {ON} YJL056C
           (REAL)
          Length = 879

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRR 436
           ++C IC K    SSSL+ H+  HT  +P +C    CGK FN  SNL++H K H ++
Sbjct: 795 YKCHICNKKFAISSSLKIHIRTHTGEKPLQCKI--CGKRFNESSNLSKHIKTHKKK 848

>KNAG0E02610 Chr5 complement(517056..519296) [2241 bp, 746 aa] {ON}
           Anc_1.326 YJL056C
          Length = 746

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           + C ICGK    SSSL+ H+  HT  +P +C    CGK F   SNLN+H K H +
Sbjct: 669 YHCDICGKRFAISSSLKIHVRTHTGEKPLQC--AVCGKRFIESSNLNKHMKTHEK 721

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 386 CGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           CGK  T+   +  H+ VHT Y+P+KC    C K F+    L +H ++H
Sbjct: 618 CGKTFTQRQKIARHLKVHTRYKPYKC--PQCQKCFSSDETLKQHLRIH 663

 Score = 37.4 bits (85), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           ++C  C K  +   +L+ H+ +H+  +P+ C+   CGK F + S+L  H + H
Sbjct: 641 YKCPQCQKCFSSDETLKQHLRIHSGEKPYHCDI--CGKRFAISSSLKIHVRTH 691

 Score = 35.8 bits (81), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 5/59 (8%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRP-----FKCNWENCGKTFNVKSNLNRHCKLHLR 435
           +CK  G  +   S  + + ++  ++ P     + C+W  CGKTF  +  + RH K+H R
Sbjct: 579 ECKWGGCHLKFGSCKELNDHLENDHLPRGQSQYTCSWAGCGKTFTQRQKIARHLKVHTR 637

>SAKL0D06776g Chr4 (561887..564190) [2304 bp, 767 aa] {ON} weakly
           similar to uniprot|P47043 Saccharomyces cerevisiae
           YJL056C ZAP1 Zinc-regulated transcription factor binds
           to zinc-responsive promoter elements to induce
           transcription of certain genes in the presence of zinc
           regulates its own transcription contains seven zinc-
           finger domains
          Length = 767

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRR 436
           +C  C K    SSSL+ H+  HT  +P KC    CGK FN  SNL++H K H R+
Sbjct: 687 KCTYCTKQFATSSSLRIHIRTHTGEKPLKCKI--CGKRFNESSNLSKHMKTHERK 739

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 4/57 (7%)

Query: 379 ARHQC--KICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           + +QC    C K  T+   L  H+ VH+ Y+PFKC   +C K F+ +  L +H + H
Sbjct: 626 SSYQCSWDTCSKSFTQRQKLLRHLKVHSGYKPFKC--PHCTKKFSTEDILQQHIRTH 680

>TDEL0G02330 Chr7 (449585..451105) [1521 bp, 506 aa] {ON} Anc_2.303
           YNL027W
          Length = 506

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 34/55 (61%), Gaps = 2/55 (3%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQ 437
           C++C K  TR  +L++H+  HTN RPF C+  +CGK F  + +  RH  LH  ++
Sbjct: 394 CELCDKRFTRPYNLKSHLRTHTNERPFICS--SCGKAFARQHDRKRHEDLHTGKK 446

 Score = 34.3 bits (77), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 24/63 (38%), Gaps = 9/63 (14%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCN--------WENCGKTFNVKSNLNRHCKLHL 434
           C  CGK   R    + H  +HT  + + C         W  CGK F     L RH K   
Sbjct: 422 CSSCGKAFARQHDRKRHEDLHTGKKRYVCGGHLKDGTAW-GCGKKFARSDALGRHFKTES 480

Query: 435 RRQ 437
            R+
Sbjct: 481 GRK 483

>ZYRO0E08426g Chr5 complement(673465..673980) [516 bp, 171 aa] {ON}
           some similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 171

 Score = 47.0 bits (110), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 3/63 (4%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHL---RRQA 438
           +C+IC +   R    + H+  HT  +P KC++  CGK+F+    L RH + H    +R+ 
Sbjct: 15  RCEICNRGFHRLEHKKRHIRTHTGEKPHKCSFPGCGKSFSRSDELKRHLRTHTGTSQRKT 74

Query: 439 KTT 441
           K T
Sbjct: 75  KKT 77

>Kpol_489.4 s489 (17106..18125) [1020 bp, 339 aa] {ON}
           (17106..18125) [1020 nt, 340 aa]
          Length = 339

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 29/43 (67%), Gaps = 2/43 (4%)

Query: 380 RHQC--KICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTF 420
           R++C  + C K+  R S LQ H Y HTN RP+ C++ENCGK F
Sbjct: 13  RYKCTYEGCTKVYDRPSLLQQHRYSHTNERPYFCDYENCGKRF 55

>KAFR0C00490 Chr3 complement(97556..98230) [675 bp, 224 aa] {ON}
           Anc_3.281 YBR066C
          Length = 224

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 34/66 (51%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAK 439
           +H CK+C    T S  L  H  +HT  + + C +E CG+ F+   N  +H K HLR++  
Sbjct: 157 KHVCKVCTMAFTTSGHLSRHNKIHTGEKKYVCPFEGCGQRFSRHDNCVQHHKTHLRKKEN 216

Query: 440 TTDDGT 445
           +    T
Sbjct: 217 SKSKST 222

>NCAS0G03730 Chr7 (688768..690483) [1716 bp, 571 aa] {ON} Anc_2.303
          Length = 571

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQ 437
           + C++C K  TR  +L++H+  HTN +PF CN   CGK F  + +  RH  LH  ++
Sbjct: 452 YACELCDKTFTRPYNLKSHLRTHTNEKPFVCNI--CGKAFARQHDRKRHEDLHTGKK 506

>AEL174W Chr5 (310950..312935) [1986 bp, 661 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL056C (ZAP1)
          Length = 661

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRR 436
           C  C K  + SSSL+ H+  HT  +P  C    CGK FN  SNL++H K+H R+
Sbjct: 574 CHYCRKQFSTSSSLRVHIRTHTGEKPLSCTV--CGKRFNESSNLSKHMKIHERK 625

>KLTH0H10538g Chr8 (910730..912778) [2049 bp, 682 aa] {ON} weakly
           similar to uniprot|P47043 Saccharomyces cerevisiae
           YJL056C ZAP1 Zinc-regulated transcription factor binds
           to zinc-responsive promoter elements to induce
           transcription of certain genes in the presence of zinc
           regulates its own transcription contains seven zinc-
           finger domains
          Length = 682

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRR 436
           ++C  CGK    SSSL+ H+  HT  +P +C    CGK FN  SNL++H + H R+
Sbjct: 605 YKCVHCGKGFATSSSLRIHIRTHTGEKPLECKV--CGKRFNESSNLSKHMRTHERK 658

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 30/48 (62%), Gaps = 2/48 (4%)

Query: 386 CGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           CGK++T+   L  H+ VHT Y+P KC   +C KTF+ +  L +H + H
Sbjct: 554 CGKVITQRQKLLRHLRVHTRYKPCKC--PHCAKTFSTQDILQQHIRTH 599

 Score = 35.0 bits (79), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           +C  C K  +    LQ H+  H+  +P+KC   +CGK F   S+L  H + H
Sbjct: 578 KCPHCAKTFSTQDILQQHIRTHSGEKPYKC--VHCGKGFATSSSLRIHIRTH 627

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 29/60 (48%), Gaps = 5/60 (8%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRP-----FKCNWENCGKTFNVKSNLNRHCKLHLR 435
           H C+  G +   +S  + + ++   + P     + C WENCGK    +  L RH ++H R
Sbjct: 514 HTCRWEGCMQVFNSCEELNGHIEKVHIPRGKSSYVCGWENCGKVITQRQKLLRHLRVHTR 573

>ZYRO0G09438g Chr7 complement(752797..753786) [990 bp, 329 aa] {ON}
           some similarities with uniprot|P27705 Saccharomyces
           cerevisiae YGL035C
          Length = 329

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 28/53 (52%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           H C IC +   R      HM  HT  +P  C+++NCGK F+    L RH ++H
Sbjct: 17  HVCPICHRAFHRLEHQTRHMRTHTGEKPHVCDFKNCGKRFSRSDELTRHRRIH 69

>Kwal_27.10925 s27 complement(559077..559871) [795 bp, 264 aa] {ON}
           YDR043C (NRG1) - transcriptional repressor which can
           bind to UAS-1 in the STA1 promoter and which can
           interact with Ssn6p [contig 33] FULL
          Length = 264

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 31/63 (49%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAK 439
           R+ CKIC K  T S  L  H  +HT  +   C  E CG+ F+   N  +H K HLRR   
Sbjct: 200 RYVCKICVKGFTTSGHLARHNRIHTGEKNHVCPHEGCGQRFSRHDNCVQHYKTHLRRNTW 259

Query: 440 TTD 442
             D
Sbjct: 260 HED 262

>AGL197W Chr7 (325717..328251) [2535 bp, 844 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR146C (SWI5) and
           YLR131C (ACE2)
          Length = 844

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%)

Query: 386 CGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRR 436
           CGKL  R  ++++H+  H   RPF+C+ E C K F    +L RH K H  +
Sbjct: 681 CGKLFNRRYNIRSHIQTHLEDRPFRCDHEGCTKAFVRNHDLIRHKKTHAEK 731

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 4/50 (8%)

Query: 390 MTRSSSL---QTHMYVHT-NYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           M ++S+L   +   Y+     + F+C +  CGK FN + N+  H + HL 
Sbjct: 651 MKKASNLPQGEIDQYIKKLQDKTFQCLYPECGKLFNRRYNIRSHIQTHLE 700

>Kwal_23.5400 s23 complement(1143487..1144776) [1290 bp, 429 aa]
           {ON} YPR186C (PZF1) - Transcription factor IIIA (TFIIIA)
           with putative Zn-fingers [contig 8] FULL
          Length = 429

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           QC +C +  +R + L+ HM+ H+  +PFKC++  CGK    K  L RH   H R
Sbjct: 82  QCTVCARQFSRKTHLERHMFSHSEDKPFKCSY--CGKGVTTKQQLRRHEITHTR 133

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 3/52 (5%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTN---YRPFKCNWENCGKTFNVKSNLNRHCK 431
           C+ICGK   R   L+ H+  H N    + ++C+  +C + F   S L +H K
Sbjct: 166 CEICGKRFQRPYRLKNHIAKHHNPDVVQKYQCSQGSCIEAFKTWSALQQHMK 217

>KLTH0G10802g Chr7 (908386..909966) [1581 bp, 526 aa] {ON} some
           similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 526

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 35/62 (56%), Gaps = 2/62 (3%)

Query: 379 ARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQA 438
           A + C++C K  TR  +L++H+  HT+ RPF C    CGK F  + +  RH  LH  ++ 
Sbjct: 406 AVYACELCDKKFTRPYNLKSHLRTHTDERPFACAI--CGKAFARQHDRKRHEDLHTGKKR 463

Query: 439 KT 440
            T
Sbjct: 464 YT 465

 Score = 37.0 bits (84), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 23/56 (41%), Gaps = 7/56 (12%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWE-------NCGKTFNVKSNLNRHCK 431
           C ICGK   R    + H  +HT  + + C  +        CGK F     L RH K
Sbjct: 438 CAICGKAFARQHDRKRHEDLHTGKKRYTCKGKLKDGTQWGCGKKFARSDALGRHFK 493

>KNAG0H01930 Chr8 (340772..342628) [1857 bp, 618 aa] {ON} Anc_2.303
           YNL027W
          Length = 618

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 38/71 (53%), Gaps = 6/71 (8%)

Query: 379 ARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQ- 437
           A + C +C K  TR  +L++H+  HTN RPF C+   CGK F  + +  RH  LH  ++ 
Sbjct: 497 AIYACDMCDKKFTRPYNLKSHLRTHTNERPFVCSI--CGKAFARQHDRKRHEDLHSGKKR 554

Query: 438 ---AKTTDDGT 445
                T  DGT
Sbjct: 555 YICGGTLKDGT 565

>NCAS0A01820 Chr1 (351123..352490) [1368 bp, 455 aa] {ON} Anc_4.80
          Length = 455

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 34/76 (44%), Gaps = 8/76 (10%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR----- 435
           H C IC +   R      HM  HT  +P +C++  C K F+    L RH ++H       
Sbjct: 68  HVCPICQRAFHRLEHQTRHMRTHTGEKPHECDFPGCVKKFSRSDELTRHKRIHTNPQPRG 127

Query: 436 ---RQAKTTDDGTGGN 448
              R+ K   D TGGN
Sbjct: 128 KRGRKKKVVTDQTGGN 143

>CAGL0I02816g Chr9 complement(247817..248692) [876 bp, 291 aa] {OFF}
           similar to uniprot|P41696 Saccharomyces cerevisiae
           YOR113w AZF1 asparagine-rich zinc finger protein
          Length = 291

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRH-CKLHL 434
           ++C IC K  +R  +L  H   H   RPF C  +NC K+F+   N+  H  K HL
Sbjct: 11  YECDICKKRFSRKGNLAAHKMTHGKIRPFICKLDNCNKSFSQLGNMKSHQNKFHL 65

>KLTH0G01826g Chr7 (135376..136299) [924 bp, 307 aa] {ON} some
           similarities with uniprot|P53035 Saccharomyces
           cerevisiae YGL209W MIG2 Protein containing zinc fingers
           involved in repression along with Mig1p of SUC2
           (invertase) expression by high levels of glucose binds
           to Mig1p-binding sites in SUC2 promoter
          Length = 307

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 27/53 (50%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHL 434
           +C +CGK   R    + H+  HT  +P  CN+  C K F+    L RH + H+
Sbjct: 14  KCDMCGKGFHRLEHKRRHIRTHTGEKPHACNFPGCVKRFSRSDELKRHVRTHM 66

>CAGL0M06831g Chr13 (695162..697099) [1938 bp, 645 aa] {ON} weakly
           similar to uniprot|P53968 Saccharomyces cerevisiae
           YNL027w CRZ1
          Length = 645

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 36/55 (65%), Gaps = 2/55 (3%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQ 437
           C++CGK+ +R  +L++H+  HT+ +P++C+   CGK F  + +  RH  LH  ++
Sbjct: 523 CEVCGKVFSRPYNLKSHLRTHTDEKPYQCSI--CGKAFARQHDKKRHEDLHTGKK 575

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 25/59 (42%), Gaps = 9/59 (15%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCN--------WENCGKTFNVKSNLNRHCK 431
           +QC ICGK   R    + H  +HT  + + C         W  CGK F     L RH K
Sbjct: 549 YQCSICGKAFARQHDKKRHEDLHTGKKRYVCGGKLKDGTFW-GCGKKFARSDALGRHFK 606

>NCAS0B06960 Chr2 (1324315..1326834) [2520 bp, 839 aa] {ON}
           Anc_2.162
          Length = 839

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 32/54 (59%), Gaps = 2/54 (3%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           +H+C  C +L  +S+ L+ H+  H  Y+P++C +  CGK F    NL  H +LH
Sbjct: 514 QHKCPYCHRLFAQSTHLEVHIRSHLGYKPYQCGY--CGKRFTQGGNLRTHQRLH 565

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           +QC  CGK  T+  +L+TH  +HT  +P++C  E C K F+ K NL  H   H +
Sbjct: 543 YQCGYCGKRFTQGGNLRTHQRLHTGEKPYEC--ELCDKKFSRKGNLAAHLLTHQK 595

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRH-CKLHL 434
           ++C++C K  +R  +L  H+  H   +PF C  +NC ++F    N+  H  + HL
Sbjct: 571 YECELCDKKFSRKGNLAAHLLTHQKVKPFICKLDNCNRSFTQLGNMKAHQNRFHL 625

>ADL198W Chr4 (349068..350711) [1644 bp, 547 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL027W (CRZ1)
          Length = 547

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 379 ARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           A + C +C K  TR  +L++H+  HT+ RPF C+   CGK F  + +  RH  LH
Sbjct: 424 AIYSCNLCDKKFTRPYNLKSHLRTHTDERPFSCSV--CGKAFARQHDRKRHEDLH 476

 Score = 34.7 bits (78), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 25/62 (40%), Gaps = 7/62 (11%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWE-------NCGKTFNVKSNLNRHCKLHLR 435
           C +CGK   R    + H  +H+  + + C  +        CGK F     L RH K    
Sbjct: 456 CSVCGKAFARQHDRKRHEDLHSGKKRYVCGGKLKGGATWGCGKKFARSDALGRHFKTESG 515

Query: 436 RQ 437
           R+
Sbjct: 516 RR 517

>KAFR0H03240 Chr8 (619580..621139) [1560 bp, 519 aa] {ON} Anc_2.303
           YNL027W
          Length = 519

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           C++C K  TR  +L++H+  HTN RPF C    CGK F  + +  RH  LH
Sbjct: 399 CEVCDKKFTRPYNLKSHLRTHTNERPFACTI--CGKAFARQHDRKRHEDLH 447

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 25/63 (39%), Gaps = 9/63 (14%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCN--------WENCGKTFNVKSNLNRHCKLHL 434
           C ICGK   R    + H  +H+  + + C         W  CGK F     L RH K   
Sbjct: 427 CTICGKAFARQHDRKRHEDLHSGKKRYACGGKLKSGIPW-GCGKKFARSDALGRHFKTDC 485

Query: 435 RRQ 437
            R+
Sbjct: 486 GRK 488

>AGR031W Chr7 (769920..770342) [423 bp, 140 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR043C (NRG1) and
           YBR066C (NRG2)
          Length = 140

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 32/59 (54%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQA 438
           +H C+ CGK  T S  L  H  +HT  +   C++  CG+ F+   N  +H + HL+R A
Sbjct: 79  KHLCQTCGKGFTTSGHLARHNRIHTGEKNHACHFPGCGQRFSRHDNCLQHYRTHLKRTA 137

>Kpol_1035.22 s1035 (53205..55598) [2394 bp, 797 aa] {ON}
           (53205..55598) [2394 nt, 798 aa]
          Length = 797

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 33/54 (61%), Gaps = 2/54 (3%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRR 436
           C+ICG   +  S L+ H+ +HT  +P  C  + CGK F+  SNLN+H K H ++
Sbjct: 707 CQICGSKFSSPSYLKVHIRIHTGEKPLSC--KVCGKKFSSSSNLNKHYKTHYKK 758

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 384 KICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           K CG   T+   +  H+ VH+ ++PFKC  E+C KTF  + NL +H + H
Sbjct: 652 KDCGHKFTQRQKILRHIRVHSGFKPFKC--ESCNKTFASEENLIQHKRTH 699

>Kpol_1003.50 s1003 (114648..116492) [1845 bp, 614 aa] {ON}
           (114648..116492) [1845 nt, 615 aa]
          Length = 614

 Score = 47.4 bits (111), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQ 437
           C +C K  TR  +L++H   HTN RPF C+   CGKTF  + +  RH  LH  ++
Sbjct: 495 CPVCDKKFTRPYNLKSHKRTHTNERPFSCSQ--CGKTFAREHDRKRHEDLHTGKK 547

 Score = 31.2 bits (69), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 24/63 (38%), Gaps = 9/63 (14%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCN--------WENCGKTFNVKSNLNRHCKLHL 434
           C  CGK   R    + H  +HT  + + C         W  CGK F     L RH K   
Sbjct: 523 CSQCGKTFAREHDRKRHEDLHTGKKRYVCGGKLKSGESW-GCGKRFARSDALGRHFKTES 581

Query: 435 RRQ 437
            R+
Sbjct: 582 GRK 584

>Kwal_47.19045 s47 complement(1074829..1075629) [801 bp, 266 aa]
           {ON} YGL209W (MIG2) - 1:1 [contig 188] FULL
          Length = 266

 Score = 46.2 bits (108), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 27/53 (50%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHL 434
           +C +CGK   R    + H+  HT  +P  CN+  C K F+    L RH + H+
Sbjct: 15  KCDMCGKGFHRLEHKRRHIRTHTGEKPHSCNFPGCVKRFSRSDELKRHVRTHM 67

>Kwal_27.11460 s27 complement(810736..812331) [1596 bp, 531 aa] {ON}
           YNL027W (CRZ1) - putative transcription factor [contig
           27] FULL
          Length = 531

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           + C++C K  TR  +L++H+  HT+ RPF C    CGK F  + +  RH  LH
Sbjct: 413 YACELCDKKFTRPYNLKSHLRTHTDERPFSCAI--CGKAFARQHDRKRHEDLH 463

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 23/57 (40%), Gaps = 9/57 (15%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKC--------NWENCGKTFNVKSNLNRHCK 431
           C ICGK   R    + H  +HT  + + C         W  CGK F     L RH K
Sbjct: 443 CAICGKAFARQHDRKRHEDLHTGQKRYTCHGKLKDGTEW-GCGKKFARSDALGRHFK 498

>NDAI0G02560 Chr7 (585170..587554) [2385 bp, 794 aa] {ON} Anc_8.326
          Length = 794

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (54%)

Query: 386 CGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAKT 440
           C K+  R  +++TH+  H   RP++C +  C K F    +L RH KLH  +  KT
Sbjct: 668 CDKIFKRRYNVRTHIQTHLEDRPYRCEFRGCEKAFVRNHDLVRHKKLHAEKHMKT 722

>ZYRO0C13508g Chr3 complement(1068164..1068733) [570 bp, 189 aa]
           {ON} weakly similar to uniprot|P38082 Saccharomyces
           cerevisiae YBR066C
          Length = 189

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 37/69 (53%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAK 439
           RH C+IC K  T S  L  H  +HT  +  +C +E C + F+   N  +H + H++R+ +
Sbjct: 109 RHVCRICYKGFTTSGHLARHNRIHTGEKNHECPYEGCDQKFSRHDNCIQHYRAHVKRELR 168

Query: 440 TTDDGTGGN 448
            ++    GN
Sbjct: 169 VSEALRTGN 177

>KLLA0E08713g Chr5 (777005..778795) [1791 bp, 596 aa] {ON} some
           similarities with uniprot|P53968 Saccharomyces
           cerevisiae YNL027W CRZ1 Transcription factor that
           activates transcription of genes involved in stress
           response nuclear localization is positively regulated by
           calcineurin-mediated dephosphorylation
          Length = 596

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 379 ARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           A + C IC K  TR  +L++H+  HT+ RP+ C+   CGK F    + NRH  LH
Sbjct: 467 AVYACDICDKKFTRPYNLKSHLRSHTDERPYVCSV--CGKAFARMHDKNRHEDLH 519

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 25/62 (40%), Gaps = 7/62 (11%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKC-------NWENCGKTFNVKSNLNRHCKLHLR 435
           C +CGK   R      H  +HT  R + C       N   CGK F     L RH K  L 
Sbjct: 499 CSVCGKAFARMHDKNRHEDLHTGKRRYVCGGILKNGNSWGCGKKFARSDALGRHFKTELG 558

Query: 436 RQ 437
           ++
Sbjct: 559 KK 560

>TPHA0G00820 Chr7 (153365..154963) [1599 bp, 532 aa] {ON} Anc_2.303
           YNL027W
          Length = 532

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQ 437
           + C IC K  TR  +L++H+  HTN RPF C    CGK F  + +  RH  LH  ++
Sbjct: 420 YDCVICEKKFTRPYNLRSHLRTHTNERPFVCTV--CGKAFAREHDRKRHEDLHTGKK 474

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 23/56 (41%), Gaps = 7/56 (12%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWE-------NCGKTFNVKSNLNRHCK 431
           C +CGK   R    + H  +HT  + + C  +        CGK F     L RH K
Sbjct: 450 CTVCGKAFAREHDRKRHEDLHTGKKRYICGGKLKSGEAWGCGKKFARSDALGRHFK 505

>Ecym_2654 Chr2 (1266751..1267524) [774 bp, 257 aa] {ON} similar to
           Ashbya gossypii AGR031W
          Length = 257

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 32/57 (56%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRR 436
           +H+C+ C K  T S  L  H  +HT  +  +C++  CG+ F+   N  +H + HL++
Sbjct: 192 KHRCQTCDKGFTTSGHLARHNRIHTGEKNHRCHFPGCGQRFSRHDNCLQHYRTHLKK 248

>TDEL0D03430 Chr4 (635293..635820) [528 bp, 175 aa] {ON} Anc_3.281
           YBR066C
          Length = 175

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 30/58 (51%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQ 437
           RH CK+C K  T S  L  H  +HT  +   C  E C + F+   N  +H + HLR++
Sbjct: 118 RHVCKVCSKGFTTSGHLARHNRIHTGEKNHFCPLEGCNQRFSRHDNCIQHYRTHLRKK 175

>ZYRO0F10428g Chr6 complement(846822..849263) [2442 bp, 813 aa] {ON}
           similar to uniprot|P21192 Saccharomyces cerevisiae
           YLR131C ACE2 Transcription factor that activates
           expression of early G1-specific genes localizes to
           daughter cell nuclei after cytokinesis and delays G1
           progression in daughters localization is regulated by
           phosphorylation potential Cdc28p substrate
          Length = 813

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%)

Query: 386 CGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRR 436
           CGK+  R  ++++H+  H   RP+ C++E C K F    +L RH K H  +
Sbjct: 634 CGKIFKRRYNIRSHIQTHLEDRPYMCDFEGCDKAFVRNHDLVRHKKSHAEK 684

>NDAI0I02900 Chr9 complement(684980..686554) [1575 bp, 524 aa] {ON}
           Anc_3.518
          Length = 524

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAKTT 441
           +C +C +   R    + HM  HT  +P  CN+  CGK+F+    L RH + H     + T
Sbjct: 19  KCDVCSRGFHRLEHKKRHMRTHTGEKPHHCNFPGCGKSFSRSDELKRHLRTHTSTSQRKT 78

>Skud_5.137 Chr5 complement(208578..209762) [1185 bp, 394 aa] {ON}
           YER028C (REAL)
          Length = 394

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           +C+IC +   R    + H+  HT  +P+KC+ +NC K+F+    L RH + H R
Sbjct: 18  RCEICSRGFHRLEHKKRHVRTHTGEKPYKCSSKNCTKSFSRSDELKRHFRTHTR 71

>TPHA0F01810 Chr6 (416859..418136) [1278 bp, 425 aa] {ON} Anc_2.162
           YOR113W
          Length = 425

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 2/55 (3%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           H+C+ C    T+S +L+TH  +HT+ + F+C  E C K F+ K NL  H   H R
Sbjct: 279 HKCRFCNVCFTQSGNLKTHEKLHTSEKDFEC--EICNKKFSRKGNLASHIATHNR 331

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 2/52 (3%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           QC  C K+  ++S  + H+  H  Y+P KC +  C   F    NL  H KLH
Sbjct: 252 QCSFCLKVFNQASHFEVHIRSHIGYKPHKCRF--CNVCFTQSGNLKTHEKLH 301

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLN-RHCKLHLRRQAKT 440
           +C+IC K  +R  +L +H+  H   R   C +++C K+F    N+   H K H    A+ 
Sbjct: 308 ECEICNKKFSRKGNLASHIATHNRLRLHICKFDHCKKSFTQLGNMKAHHNKFHRETMARL 367

Query: 441 TD 442
           ++
Sbjct: 368 SN 369

>CAGL0E01331g Chr5 (124599..126668) [2070 bp, 689 aa] {ON} some
           similarities with uniprot|P08153 Saccharomyces
           cerevisiae YDR146c SWI5 or uniprot|P21192 Saccharomyces
           cerevisiae YLR131c ACE2
          Length = 689

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (56%)

Query: 386 CGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRR 436
           CGK   R  ++++H+  H   RP++C+++ C K F    +L RH K H  +
Sbjct: 563 CGKTFKRRYNIRSHIQTHLEDRPYRCDYDGCDKAFVRNHDLVRHKKTHQEK 613

>KAFR0H02240 Chr8 (426388..428259) [1872 bp, 623 aa] {ON} Anc_8.326
           YLR131C
          Length = 623

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 29/50 (58%)

Query: 384 KICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           K C KL  R  ++++H+  H   RP+ C++ENC K F    +L RH K H
Sbjct: 464 KDCHKLFKRRYNIRSHIQTHLEDRPYICDYENCNKAFVRNHDLVRHKKSH 513

>CAGL0M04323g Chr13 complement(474158..476269) [2112 bp, 703 aa]
           {ON} similar to uniprot|P21192 Saccharomyces cerevisiae
           YLR131c ACE2 or uniprot|P08153 Saccharomyces cerevisiae
           YDR146c SWI5
          Length = 703

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%)

Query: 386 CGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           CGK   R  ++++H+  H   +P+KC++E C K F    +L RH K H
Sbjct: 530 CGKFFRRRYNIKSHIQTHLEDKPYKCDFEGCTKAFVRNHDLARHKKTH 577

>KNAG0H03480 Chr8 (648636..651026) [2391 bp, 796 aa] {ON} Anc_2.162
           YOR113W
          Length = 796

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           +C+ CGK  T+  +L+TH  +HT  +P+ C  ++C K F+ K NL  H   H
Sbjct: 501 ECQFCGKRFTQGGNLRTHQRLHTGEKPYAC--QHCSKRFSRKGNLAAHQLTH 550

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 24/47 (51%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRH 429
           C+ C K  +R  +L  H   H   +PF C  +NCGKTF    N+  H
Sbjct: 530 CQHCSKRFSRKGNLAAHQLTHREVKPFLCKLDNCGKTFAQLGNMKNH 576

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           +H+C  C     +++ L+ H+  H  Y+PF+C +  CGK F    NL  H +LH
Sbjct: 471 KHECPYCHHKFAQTTHLEVHVRSHLGYKPFECQF--CGKRFTQGGNLRTHQRLH 522

>SAKL0D03146g Chr4 complement(256292..256765) [474 bp, 157 aa] {ON}
           similar to uniprot|Q750L1 Ashbya gossypii AGR031W
           AGR031Wp and some similarites with YDR043C
           uniprot|Q03125 Saccharomyces cerevisiae YDR043C NRG1
           Transcriptional repressor that recruits the Cyc8p-Tup1p
           complex to promoters mediates glucose repression and
           negatively regulates a variety of processes including
           filamentous growth and alkaline pH response
          Length = 157

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           R+ CKIC +  T S  L  H  +HT  +   C +E CG+ F+   N  +H + HL+
Sbjct: 99  RYVCKICSRGFTTSGHLARHNRIHTGEKNHVCPFEGCGQRFSRHDNCVQHYRTHLK 154

>AFR471C Chr6 complement(1287518..1288687) [1170 bp, 389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL035C
           (MIG1)
          Length = 389

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           C IC +   R      H+  HT  +P  C++  CGK F+ +  L RH ++H
Sbjct: 24  CPICARAFHRLEHQTRHIRTHTGEKPHACDFAGCGKRFSRQDELTRHRRIH 74

>KNAG0J00870 Chr10 complement(148421..149263) [843 bp, 280 aa] {ON}
           Anc_3.281 YBR066C
          Length = 280

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 34/70 (48%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAK 439
           + QCK C    T S  L  H  +HT  + + C  E+CG+ F+   N  +H + HL+++ +
Sbjct: 211 KFQCKTCSMAFTTSGHLSRHNKIHTGEKNYVCPHESCGQRFSRHDNCIQHYRTHLKKKQR 270

Query: 440 TTDDGTGGNK 449
               G    K
Sbjct: 271 QAKKGKVAKK 280

>Kwal_27.10167 s27 (225940..226797) [858 bp, 285 aa] {ON} YGL254W
           (FZF1) - putative transcription factor, has five zinc
           fingers [contig 41] FULL
          Length = 285

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 386 CGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAKTT 441
           CGK   R   +  H + H+  +P KC  E C K F  K  L+RH   H +R A +T
Sbjct: 72  CGKRFLRVCHMNVHRWTHSKIKPLKC--EECSKGFTTKQQLSRHLATHKKRNAIST 125

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 24/44 (54%)

Query: 386 CGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRH 429
           C K   + SSL+ H+  H N RPF C   NCGK F    ++N H
Sbjct: 42  CNKRYRKPSSLREHVNSHNNNRPFACPEPNCGKRFLRVCHMNVH 85

>SAKL0A09482g Chr1 (831930..833096) [1167 bp, 388 aa] {ON} some
           similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 388

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKL 432
           HQC +C K   R S L+ H+  H++ +PF C W  C      K NL +H KL
Sbjct: 258 HQCHLCDKSFKRKSWLKRHLLSHSSIKPFNCPW--CQSRHKRKDNLLQHMKL 307

>KLTH0A00682g Chr1 (69084..70385) [1302 bp, 433 aa] {ON} similar to
           uniprot|P39933 Saccharomyces cerevisiae YPR186C PZF1
           Transcription factor IIIA (TFIIIA) with putative
           Zn-fingers
          Length = 433

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           C  CG+  TR + L+ HM+ HT  +PF C+  +CGK    +  L RH   H R
Sbjct: 83  CTECGRQFTRKTHLERHMFTHTAEKPFHCS--HCGKGVTTRQQLRRHEITHTR 133

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 27/55 (49%), Gaps = 4/55 (7%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNW--ENC-GKTFNVKSNLNRHCKLH 433
           QC  CGK       LQ HM VH++    K NW  E+C    F  K++L  HC  H
Sbjct: 224 QCPTCGKACVGEQGLQMHMRVHSSMTVIK-NWKCESCPDLYFAKKADLVSHCLEH 277

>YPR186C Chr16 complement(909733..911022) [1290 bp, 429 aa] {ON}
           PZF1Transcription factor IIIA (TFIIIA); essential DNA
           binding protein required for transcription of 5S rRNA by
           RNA polymerase III; not involved in transcription of
           other RNAP III genes; nine conserved zinc fingers; may
           also bind 5S rRNA
          Length = 429

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRH 429
           QC  C K   + S L+ H+Y H++ +PF+C++  CGK    +  L RH
Sbjct: 81  QCDKCAKSFVKKSHLERHLYTHSDTKPFQCSY--CGKGVTTRQQLKRH 126

>TDEL0D05860 Chr4 complement(1064492..1065484) [993 bp, 330 aa] {ON}
           Anc_3.518 YGL209W
          Length = 330

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 29/52 (55%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           +C++C +   R    + H+  HT  +P +C + +CGK+F+    L RH + H
Sbjct: 18  KCELCSRGFHRLEHKKRHIRTHTGEKPHRCTFGSCGKSFSRSDELKRHLRTH 69

>KLTH0C07172g Chr3 complement(620315..621112) [798 bp, 265 aa] {ON}
           some similarities with uniprot|Q03125 Saccharomyces
           cerevisiae YDR043C NRG1 Transcriptional repressor that
           recruits the Cyc8p-Tup1p complex to promoters mediates
           glucose repression and negatively regulates a variety of
           processes including filamentous growth and alkaline pH
           response
          Length = 265

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 29/63 (46%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAK 439
           R+ CK C K  T S  L  H  +HT  +   C    CG+ F+   N  +H K HLRR   
Sbjct: 201 RYVCKTCVKGFTTSGHLARHNRIHTGEKNHVCPHPGCGQRFSRHDNCVQHYKTHLRRNTW 260

Query: 440 TTD 442
             D
Sbjct: 261 QDD 263

>TPHA0C04190 Chr3 (901757..903010) [1254 bp, 417 aa] {ON} Anc_2.533
           YMR070W
          Length = 417

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 30/54 (55%), Gaps = 2/54 (3%)

Query: 378 VARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCK 431
           +  ++CK+C K   R+S L+ H + H+  + F CNW  C   +  K NL +H +
Sbjct: 321 IKFYECKVCHKTFKRNSWLKRHFFSHSKLKNFSCNW--CSGKYKRKDNLVQHIR 372

>TPHA0A03980 Chr1 (885841..886785) [945 bp, 314 aa] {ON} Anc_3.281
           YBR066C
          Length = 314

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 31/60 (51%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAK 439
           ++ CK+C K +T S  L  H  +HT  + + C  E C + F+   N  +H K HL+   K
Sbjct: 255 KYICKVCSKGLTTSGHLARHYRIHTGEKNYSCLHEGCDQKFSRHDNCKQHYKTHLKNYTK 314

>KLTH0D08734g Chr4 complement(730214..732247) [2034 bp, 677 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 677

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 3/55 (5%)

Query: 382 QCKICGKLMTRSSSLQTHM-YVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           +C+ C K   RS  L+ H+  VH+  RPF C++  C K F+   NL++H K H +
Sbjct: 621 KCQECTKAFRRSEHLKRHIRSVHSTERPFHCSY--CDKKFSRSDNLSQHLKTHKK 673

>AEL278W Chr5 (117043..118473) [1431 bp, 476 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR186C (PZF1)
          Length = 476

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 2/49 (4%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRH 429
           +QC+ CG+  T+ S L+ H++ H+  +PF C    CGK    +  L RH
Sbjct: 150 YQCEQCGRGFTKKSHLERHLFSHSETKPFSCTV--CGKGVTTRQQLRRH 196

 Score = 35.0 bits (79), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 18/32 (56%), Gaps = 1/32 (3%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWE 414
           C +CGKL    + LQ HM VH   R  K NW+
Sbjct: 294 CGVCGKLCVGETGLQMHMTVHDESRVIK-NWK 324

 Score = 34.7 bits (78), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 2/47 (4%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRH 429
           C +CGK +T    L+ H   HT  + FKC  E CG+ F     L  H
Sbjct: 180 CTVCGKGVTTRQQLRRHEITHT--KSFKCPHEGCGEAFYKHPQLRSH 224

>TDEL0B06910 Chr2 complement(1222435..1223748) [1314 bp, 437 aa]
           {ON} Anc_2.598 YMR037C
          Length = 437

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 3/55 (5%)

Query: 382 QCKICGKLMTRSSSLQTHM-YVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           +CK C K   RS  L+ H+  VH+  RPF C +  C K F+   NL++H K H +
Sbjct: 381 KCKECAKAFRRSEHLKRHIRSVHSTERPFACMF--CEKKFSRSDNLSQHLKTHKK 433

>Kwal_26.8351 s26 complement(750276..752372) [2097 bp, 698 aa] {ON}
           YKL062W (MSN4) - zinc finger protein [contig 59] FULL
          Length = 698

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 33/55 (60%), Gaps = 3/55 (5%)

Query: 382 QCKICGKLMTRSSSLQTHM-YVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           +C+ C K   RS  L+ H+  VH++ RPF C++  C K F+   NL++H K H +
Sbjct: 642 KCQECTKAFRRSEHLKRHIRSVHSSERPFHCSY--CDKKFSRSDNLSQHLKTHKK 694

>KAFR0A00800 Chr1 complement(144493..146754) [2262 bp, 753 aa] {ON}
           Anc_1.326 YJL056C
          Length = 753

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 32/52 (61%), Gaps = 2/52 (3%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           +C +C K  + S+SL+ H+  HT  +P +C    CG+ FN  SNL++H K H
Sbjct: 669 KCHLCDKSFSVSTSLKIHIRTHTGEKPLECKV--CGRRFNESSNLSKHMKTH 718

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 35/55 (63%), Gaps = 6/55 (10%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           ++C++C K  +   +L+ H  VH+  +PFKC+   C K+F+V ++L    K+H+R
Sbjct: 640 YKCEVCSKCFSSDETLKQHSRVHSGEKPFKCHL--CDKSFSVSTSL----KIHIR 688

 Score = 33.9 bits (76), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 386 CGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           C K  ++   +  H+ VH+ ++P+KC  E C K F+    L +H ++H
Sbjct: 617 CNKEFSQRQKIVRHLKVHSGFKPYKC--EVCSKCFSSDETLKQHSRVH 662

>NCAS0F03740 Chr6 complement(752361..753227) [867 bp, 288 aa] {ON}
           Anc_3.518
          Length = 288

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHL 434
           +C IC +   R    + H+  HT  +P  C + +CGK+F+    L RH ++HL
Sbjct: 18  RCPICSRGFHRLEHKKRHVRTHTGEKPHPCTFAHCGKSFSRGDELKRHIRIHL 70

>TPHA0M01180 Chr13 complement(237368..238420) [1053 bp, 350 aa] {ON}
           Anc_3.281 YBR066C
          Length = 350

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 31/60 (51%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAK 439
           +HQCKIC K  T +  L  H  +HT  +  KC    C   F+   N  +H + HL+R+ K
Sbjct: 267 KHQCKICMKKFTTAGHLTRHHKIHTGEKNHKCPHRGCNLWFSRNDNSLQHYQTHLKRKTK 326

>KNAG0D03710 Chr4 (675160..676539) [1380 bp, 459 aa] {ON} Anc_4.80
           YGL035C
          Length = 459

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           H C +CG+   R      HM  HT  +P  C++  C K F+    L RH ++H
Sbjct: 43  HVCPVCGRAFHRLEHQTRHMRTHTGEKPHACDFPGCTKRFSRSDELTRHKRIH 95

>Suva_4.305 Chr4 complement(536954..537616) [663 bp, 220 aa] {ON}
           YBR066C (REAL)
          Length = 220

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 30/61 (49%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAK 439
           RH CKIC    T S  L  H  +HT  +   C  E CG+ F+   N N+H + H  ++ +
Sbjct: 152 RHFCKICSTGFTTSGHLSRHNRIHTGEKNHICPHEGCGQRFSRHDNCNQHYRTHANKKKR 211

Query: 440 T 440
            
Sbjct: 212 N 212

>Suva_13.206 Chr13 complement(334812..336941) [2130 bp, 709 aa] {ON}
           YMR037C (REAL)
          Length = 709

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 31/54 (57%), Gaps = 3/54 (5%)

Query: 383 CKICGKLMTRSSSLQTHM-YVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           C IC K   RS  L+ H+  VH+N RPF C+   C K F+   NL++H K H +
Sbjct: 654 CHICSKSFKRSEHLKRHVRSVHSNERPFACHI--CDKKFSRSDNLSQHIKTHKK 705

>TBLA0B06050 Chr2 (1425041..1427329) [2289 bp, 762 aa] {ON}
           Anc_2.303 YNL027W
          Length = 762

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 34/59 (57%), Gaps = 2/59 (3%)

Query: 379 ARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQ 437
           A + C++C K  TR  +L++H+  HTN RPF C+   C K F  + +  RH  LH  ++
Sbjct: 649 AIYACELCDKKFTRPYNLKSHLRTHTNERPFICSI--CNKAFARQHDRKRHEDLHTGKK 705

>NCAS0A12910 Chr1 complement(2546267..2548735) [2469 bp, 822 aa]
           {ON} Anc_2.598
          Length = 822

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 3/56 (5%)

Query: 382 QCKICGKLMTRSSSLQTHM-YVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRR 436
           +C+ CGK   RS  L+ H+  VH++ RPF C    C K F+   NL +H K H +R
Sbjct: 766 KCETCGKAFRRSEHLKRHIRSVHSSERPFAC--PTCDKKFSRSDNLAQHIKTHKKR 819

>Klac_YGOB_Anc_3.518 Chr2 complement(46736..47455) [720 bp, 239 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 239

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 26/57 (45%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAK 439
           C+ICG    R      H+  HT  +PF C    C K F+    L RH K H + + +
Sbjct: 14  CEICGNRFHRLEHKTRHIRTHTGEKPFACTVPGCPKRFSRNDELKRHIKTHFKSRKR 70

>KLLA0B03454g Chr2 complement(314015..315433) [1419 bp, 472 aa] {ON}
           similar to uniprot|P39933 Saccharomyces cerevisiae
           YPR186C PZF1 Transcription factor IIIA (TFIIIA) with
           putative Zn-fingers
          Length = 472

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 2/48 (4%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRH 429
           +C  CGK   + S L  HM+ HT+ +PF C+   CGK    +  L RH
Sbjct: 138 KCDTCGKEFAKKSHLNRHMFSHTDDKPFTCSI--CGKGVTTRQQLKRH 183

 Score = 34.7 bits (78), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%), Gaps = 2/38 (5%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTF 420
           C ICGK +T    L+ H   HT  + F C++E C ++F
Sbjct: 167 CSICGKGVTTRQQLKRHEITHT--KSFHCSYEGCNESF 202

>Ecym_1415 Chr1 complement(863049..864563) [1515 bp, 504 aa] {ON}
           similar to Ashbya gossypii AFR471C
          Length = 504

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           C IC +   R      H+  HT  +P  C++  CGK F+ +  L RH ++H
Sbjct: 24  CPICSRAFHRLEHQTRHIRTHTGEKPHGCDFIGCGKKFSRRDELARHRRIH 74

>KNAG0E01600 Chr5 complement(319141..320157) [1017 bp, 338 aa] {ON}
           Anc_3.518 YGL209W
          Length = 338

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 30/52 (57%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           +C +C +   R    + H+  HT  +P+KC++ +C K+F+    L RH K+H
Sbjct: 18  KCPLCQRGFHRLEHKKRHVRTHTGEKPYKCSFPDCPKSFSRTDELKRHSKIH 69

>Kpol_1036.70 s1036 complement(192400..194424) [2025 bp, 674 aa]
           {ON} complement(192400..194424) [2025 nt, 675 aa]
          Length = 674

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%)

Query: 386 CGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRR 436
           C K   R  ++++H+  H   RP+KC++E C K F    +L RH K H  +
Sbjct: 493 CDKTFKRRYNIRSHIQTHLEDRPYKCDFEGCDKAFVRNHDLIRHKKSHAEK 543

>CAGL0C02519g Chr3 (253051..254007) [957 bp, 318 aa] {ON} some
           similarities with uniprot|P39943 Saccharomyces
           cerevisiae YER028c or uniprot|P53035 Saccharomyces
           cerevisiae YGL209w MIG2
          Length = 318

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 28/53 (52%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHL 434
           +C+IC +   R    + H   HT  +P KC + +C K+F+    L RH + H+
Sbjct: 21  RCEICSRGFHRLEHKKRHFRTHTGEKPHKCKFPSCPKSFSRADELKRHSRTHM 73

>NCAS0E00170 Chr5 (20556..21539) [984 bp, 327 aa] {ON} 
          Length = 327

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 25/43 (58%)

Query: 378 VARHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTF 420
           V + Q + C +  TR   LQ H Y HTN RP+ C+ E CGK F
Sbjct: 12  VYKCQFEGCHREFTRPCLLQQHRYSHTNERPYICDVEGCGKRF 54

 Score = 37.4 bits (85), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 25/54 (46%), Gaps = 2/54 (3%)

Query: 386 CGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAK 439
           CGK   R   L+ H + H+  +P KC +  C K F     L RH   H ++  K
Sbjct: 50  CGKRFMRPCHLKVHKWTHSKVKPLKCAF--CEKGFITNQQLKRHLNTHAKKSRK 101

>Kpol_1050.116 s1050 complement(264361..265350) [990 bp, 329 aa]
           {ON} complement(264361..265350) [990 nt, 330 aa]
          Length = 329

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 34/59 (57%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQA 438
           ++ C++CGK +T S  L  H  +HT  +   C +E C + F+ + N ++H + H R ++
Sbjct: 262 KYYCRVCGKGLTTSGHLSRHYRIHTGEKKHCCPFEGCNQRFSRRDNCSQHYQTHRRNKS 320

>Smik_2.199 Chr2 complement(351916..352578) [663 bp, 220 aa] {ON}
           YBR066C (REAL)
          Length = 220

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 30/60 (50%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAK 439
           RH CKIC    T S  L  H  +HT  +   C  E CG+ F+   N N+H + H  ++ +
Sbjct: 152 RHFCKICSTGFTTSGHLSRHNRIHTGEKNHICPHEGCGQRFSRHDNCNQHYRTHANKKKR 211

>YBR066C Chr2 complement(370037..370699) [663 bp, 220 aa] {ON}
           NRG2Transcriptional repressor that mediates glucose
           repression and negatively regulates filamentous growth;
           has similarity to Nrg1p
          Length = 220

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 30/60 (50%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAK 439
           RH CKIC    T S  L  H  +HT  +   C  E CG+ F+   N N+H + H  ++ +
Sbjct: 152 RHFCKICSTGFTTSGHLSRHNRIHTGEKNHICPHEGCGQRFSRHDNCNQHYRTHANKKKR 211

>TDEL0F02690 Chr6 (493944..494996) [1053 bp, 350 aa] {ON} Anc_4.80
           YGL035C
          Length = 350

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 25/53 (47%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           H C IC +   R      H+  HT  +P  C++  C K F+    L RH ++H
Sbjct: 29  HVCPICQRAFRRLEHQTRHLRTHTGEKPHACDFPGCAKRFSRSDELTRHRRIH 81

>ZYRO0F01012g Chr6 (78166..79920) [1755 bp, 584 aa] {ON} similar to
           uniprot|P33749 Saccharomyces cerevisiae YKL062W MSN4
           Transcriptional activator related to Msn2p activated in
           stress conditions which results in translocation from
           the cytoplasm to the nucleus binds DNA at stress
           response elements of responsive genes inducing gene
           expression
          Length = 584

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 3/55 (5%)

Query: 382 QCKICGKLMTRSSSLQTHM-YVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           +CK C K   RS  L+ H+  VH++ RPF C +  C K F+   NL++H K H +
Sbjct: 528 KCKECSKAFRRSEHLKRHIRSVHSSERPFACMF--CEKKFSRSDNLSQHLKTHKK 580

>NDAI0B01340 Chr2 (309326..311635) [2310 bp, 769 aa] {ON} Anc_2.598
          Length = 769

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 30/55 (54%), Gaps = 3/55 (5%)

Query: 382 QCKICGKLMTRSSSLQTHM-YVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           QC  C K   RS  L+ H+  VH+  RPF CN   C K F+   NL++H K H +
Sbjct: 713 QCDQCTKSFRRSEHLKRHVRSVHSKERPFACNL--CEKKFSRSDNLSQHLKTHKK 765

>Smik_5.151 Chr5 complement(215590..216756) [1167 bp, 388 aa] {ON}
           YER028C (REAL)
          Length = 388

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 30/52 (57%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           +C+IC +   R    + H+  HT  +P KC++++C K+F+    L RH + H
Sbjct: 18  RCEICSRGFHRLEHKKRHVRTHTGEKPHKCSFQSCPKSFSRGDELKRHLRTH 69

>NDAI0G00720 Chr7 complement(155060..157186) [2127 bp, 708 aa] {ON}
           Anc_2.303 YNL027W
          Length = 708

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 2/55 (3%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQ 437
           C++C K  TR  +L++H+  HTN +PF C    C K F  + +  RH  LH  ++
Sbjct: 582 CELCNKTFTRPYNLKSHLRTHTNEKPFICKI--CNKAFARQHDRKRHEDLHTGKK 634

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 23/56 (41%), Gaps = 7/56 (12%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWE-------NCGKTFNVKSNLNRHCK 431
           CKIC K   R    + H  +HT  + + C  +        CGK F     L RH K
Sbjct: 610 CKICNKAFARQHDRKRHEDLHTGKKRYICGGKLKNGDTWGCGKKFARSDALGRHFK 665

>AGL071C Chr7 complement(574723..575913) [1191 bp, 396 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR070W
           (MOT3)
          Length = 396

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKL 432
           H+C  C K   R S L+ H+  H+  +P+ C W  C      K NL++H KL
Sbjct: 185 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLKL 234

>CAGL0M13189g Chr13 complement(1295843..1297468) [1626 bp, 541 aa]
           {ON} weakly similar to uniprot|P33749 Saccharomyces
           cerevisiae YKL062w MSN4 transcriptional activator
          Length = 541

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 30/55 (54%), Gaps = 3/55 (5%)

Query: 382 QCKICGKLMTRSSSLQTHM-YVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           QC  C K   RS  L+ H+  VH+  RPF C +  C K F+   NL++H K H R
Sbjct: 485 QCADCDKAFRRSEHLKRHVRSVHSTERPFPCMF--CEKKFSRSDNLSQHLKTHKR 537

>Skud_2.189 Chr2 complement(338427..339089) [663 bp, 220 aa] {ON}
           YBR066C (REAL)
          Length = 220

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 30/60 (50%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAK 439
           RH CKIC    T S  L  H  +HT  +   C  E CG+ F+   N N+H + H  ++ +
Sbjct: 152 RHFCKICSTGFTTSGHLSRHNRIHTGEKNHICPHEGCGQRFSRHDNCNQHYRTHANKKKR 211

>Kwal_56.23925 s56 complement(779625..781862) [2238 bp, 745 aa] {ON}
           YLR131C (ACE2) - zinc finger transcription factor
           [contig 171] FULL
          Length = 745

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%)

Query: 386 CGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRR 436
           CGK   R  ++++H+  H   RP+ C++E C K F    +L RH K H  +
Sbjct: 592 CGKTFRRRYNIRSHIQTHLEDRPYFCDFEGCHKAFVRNHDLIRHKKTHAEK 642

>TPHA0K01770 Chr11 (374701..376257) [1557 bp, 518 aa] {ON} Anc_4.80
           YGL035C
          Length = 518

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           H C  CG+   R      HM  HT  +P  C+++ C K F+    L RH ++H
Sbjct: 69  HVCGTCGRAFHRLEHQTRHMRTHTGEKPHACDFQGCTKRFSRSDELTRHKRIH 121

>CAGL0A01628g Chr1 (161327..162601) [1275 bp, 424 aa] {ON} similar
           to uniprot|P27705 Saccharomyces cerevisiae YGL035c MIG1
           transcriptional repressor
          Length = 424

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 26/53 (49%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           H C ICG+   R      HM  HT  +P  C++  C K F+    L RH ++H
Sbjct: 43  HVCPICGRAFHRLEHQTRHMRTHTGEKPHACDFPGCVKRFSRSDELTRHRRIH 95

>TDEL0F04510 Chr6 complement(846575..848806) [2232 bp, 743 aa] {ON}
           Anc_8.326 YLR131C
          Length = 743

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%)

Query: 386 CGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRR 436
           C K+  R  ++++H+  H   RP+ C++E C K F    +L RH K H  +
Sbjct: 578 CNKVFKRRYNIRSHIQTHLEDRPYVCDFEGCDKAFVRNHDLVRHKKSHAEK 628

>KLLA0A10373g Chr1 complement(907244..907864) [621 bp, 206 aa] {ON}
           some similarities with uniprot|P32805 Saccharomyces
           cerevisiae YGL254W FZF1 Transcription factor involved in
           sulfite metabolism sole identified regulatory target is
           SSU1 overexpression suppresses sulfite-sensitivity of
           many unrelated mutants due to hyperactivation of SSU1
           contains five zinc fingers
          Length = 206

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 29/61 (47%), Gaps = 2/61 (3%)

Query: 386 CGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAKTTDDGT 445
           C K   R S L+ HM  H+  +P+ C+   CGK F  K    RH + H + Q  T+    
Sbjct: 45  CDKAFLRPSHLRVHMLSHSKVKPYNCSV--CGKGFATKQQFQRHQQTHTQNQDDTSTYQC 102

Query: 446 G 446
           G
Sbjct: 103 G 103

>Kpol_505.15 s505 (42259..43791) [1533 bp, 510 aa] {ON}
           (42259..43791) [1533 nt, 511 aa]
          Length = 510

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 32/56 (57%), Gaps = 2/56 (3%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           +H+C  C K  +++ +L TH  +HT  RP++C+   C K F+ K NL  H   H +
Sbjct: 376 QHKCAYCDKRFSQTGNLNTHQRLHTGERPYECHI--CNKRFSRKGNLTAHVITHKK 429

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 24/49 (48%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRH 429
           ++C IC K  +R  +L  H+  H   +P+ C  + C K F    N+  H
Sbjct: 405 YECHICNKRFSRKGNLTAHVITHKKLKPYICKVDGCNKKFTQLGNMKVH 453

>SAKL0B11330g Chr2 complement(987814..989313) [1500 bp, 499 aa] {ON}
           similar to uniprot|P33749 Saccharomyces cerevisiae
           YKL062W MSN4 Transcriptional activator related to Msn2p
           activated in stress conditions which results in
           translocation from the cytoplasm to the nucleus binds
           DNA at stress response elements of responsive genes
           inducing gene expression
          Length = 499

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 33/55 (60%), Gaps = 3/55 (5%)

Query: 382 QCKICGKLMTRSSSLQTHM-YVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           +C+ C K   RS  L+ H+  VH++ RPF C++  C K F+   NL++H K H +
Sbjct: 443 KCQECTKAFRRSEHLKRHIRSVHSSERPFHCSY--CDKKFSRSDNLSQHLKTHKK 495

>YMR037C Chr13 complement(344403..346517) [2115 bp, 704 aa] {ON}
           MSN2Transcriptional activator related to Msn4p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 704

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 31/54 (57%), Gaps = 3/54 (5%)

Query: 383 CKICGKLMTRSSSLQTHM-YVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           C IC K   RS  L+ H+  VH+N RPF C+   C K F+   NL++H K H +
Sbjct: 649 CHICPKSFKRSEHLKRHVRSVHSNERPFACHI--CDKKFSRSDNLSQHIKTHKK 700

>Skud_16.490 Chr16 complement(852079..853302) [1224 bp, 407 aa] {ON}
           YPR186C (REAL)
          Length = 407

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRH 429
           QC  C K   + S L+ H+Y H++ +PF+C++  CGK    +  L RH
Sbjct: 81  QCDKCPKSFVKKSHLERHLYSHSDTKPFQCSY--CGKGVTTRQQLKRH 126

>Smik_16.450 Chr16 complement(772259..773557) [1299 bp, 432 aa] {ON}
           YPR186C (REAL)
          Length = 432

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRH 429
           QC  C K   + S L+ H+Y H++ +PF+C++  CGK    +  L RH
Sbjct: 84  QCDKCPKSFVKKSHLERHLYSHSDTKPFQCSY--CGKGVTTRQQLKRH 129

>NCAS0C03240 Chr3 (636172..638034) [1863 bp, 620 aa] {ON} Anc_8.326
          Length = 620

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 35/71 (49%), Gaps = 8/71 (11%)

Query: 386 CGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRR--------Q 437
           CGK+  R  ++++H+  H   +P+ C++  C K F    +L RH K H  R        Q
Sbjct: 487 CGKIFKRRYNVRSHIQTHLEDKPYACDFPGCEKAFVRNHDLVRHKKSHANRTSSPQKRVQ 546

Query: 438 AKTTDDGTGGN 448
              +++GT  N
Sbjct: 547 KDHSNEGTQSN 557

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 17/27 (62%)

Query: 409 FKCNWENCGKTFNVKSNLNRHCKLHLR 435
           F+C +E+CGK F  + N+  H + HL 
Sbjct: 480 FECLYEDCGKIFKRRYNVRSHIQTHLE 506

>NCAS0I01560 Chr9 (291561..292361) [801 bp, 266 aa] {ON} Anc_3.281
          Length = 266

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 29/58 (50%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQ 437
           +H CKIC    T S  L  H  +HT  +   C +E C + F+   N  +H + HL++ 
Sbjct: 209 KHVCKICSTGFTTSGHLSRHNRIHTGEKNHSCPFEGCNQKFSRHDNCLQHYRTHLKKN 266

>SAKL0F00242g Chr6 (16275..17150) [876 bp, 291 aa] {ON} similar to
           gnl|GLV|KLLA0A10373g Kluyveromyces lactis KLLA0A10373g
           and weakly similar to YGL254W uniprot|P32805
           Saccharomyces cerevisiae YGL254W FZF1 Transcription
           factor involved in sulfite metabolism sole identified
           regulatory target is SSU1 overexpression suppresses
           sulfite-sensitivity of many unrelated mutants due to
           hyperactivation of SSU1 contains five zinc fingers
          Length = 291

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 24/44 (54%)

Query: 386 CGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRH 429
           CGK+ +R   L+ H   HTN RPF C    CGK F   S+L  H
Sbjct: 15  CGKMYSRPCLLEQHRRSHTNERPFVCEEPGCGKGFLRASHLKVH 58

 Score = 37.4 bits (85), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 29/68 (42%), Gaps = 6/68 (8%)

Query: 386 CGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRR----QAKTT 441
           CGK   R+S L+ H + H+  +P  C    C K F     L+RH K H       Q +  
Sbjct: 45  CGKGFLRASHLKVHKWSHSQVKPLAC--PVCSKGFTTNQQLSRHKKTHKDLPSPPQEQLN 102

Query: 442 DDGTGGNK 449
           D  T G  
Sbjct: 103 DKDTAGGD 110

>Kpol_1018.33 s1018 complement(96025..97794) [1770 bp, 589 aa] {ON}
           complement(96025..97794) [1770 nt, 590 aa]
          Length = 589

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKL 432
           H C ICGK   R S LQ H+  H++ R F C W  C      K NL +H KL
Sbjct: 477 HVCHICGKQFKRKSWLQRHLLSHSSERNFDCPW--CLSKHKRKDNLLQHMKL 526

>Kpol_185.3 s185 complement(4290..6233) [1944 bp, 647 aa] {ON}
           complement(4290..6233) [1944 nt, 648 aa]
          Length = 647

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 3/55 (5%)

Query: 382 QCKICGKLMTRSSSLQTHM-YVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           +C  C K   RS  L+ H+  VH++ RPF CN+  C K F+   NL++H K H +
Sbjct: 591 KCTDCEKAFRRSEHLKRHIRSVHSSERPFACNY--CEKKFSRSDNLSQHLKTHKK 643

>YKL062W Chr11 (323228..325120) [1893 bp, 630 aa] {ON}
           MSN4Transcriptional activator related to Msn2p;
           activated in stress conditions, which results in
           translocation from the cytoplasm to the nucleus; binds
           DNA at stress response elements of responsive genes,
           inducing gene expression
          Length = 630

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 3/55 (5%)

Query: 382 QCKICGKLMTRSSSLQTHM-YVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           +CK C K   RS  L+ H+  VH+  RPF C +  C K F+   NL++H K H +
Sbjct: 574 KCKDCEKAFRRSEHLKRHIRSVHSTERPFACMF--CEKKFSRSDNLSQHLKTHKK 626

>NDAI0B06020 Chr2 complement(1462374..1463654) [1281 bp, 426 aa]
           {ON} Anc_3.518
          Length = 426

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 35/75 (46%), Gaps = 7/75 (9%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHL------- 434
           +C+ C +   R    + H+  HT  +P  CN+ +C K F+ +  L RH + HL       
Sbjct: 22  RCQFCSRGFHRLEHKKRHVRTHTGEKPHVCNFPHCKKGFSRRDELKRHIRTHLGSSYRRI 81

Query: 435 RRQAKTTDDGTGGNK 449
           R+  KTT  G    K
Sbjct: 82  RKPTKTTKAGEDIQK 96

>ABR089C Chr2 complement(548267..549982) [1716 bp, 571 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL062W
           (MSN4) and YMR037C (MSN2)
          Length = 571

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 34/62 (54%), Gaps = 4/62 (6%)

Query: 382 QCKICGKLMTRSSSLQTHM-YVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAKT 440
           +C+ C K   RS  L+ H+  VH++ RPF C +  C K F+   NL++H K H R+    
Sbjct: 505 KCQECTKAFRRSEHLKRHIRSVHSSDRPFPCTY--CDKKFSRSDNLSQHLKTH-RKHGDI 561

Query: 441 TD 442
            D
Sbjct: 562 KD 563

>TPHA0N01460 Chr14 complement(320896..322455) [1560 bp, 519 aa] {ON}
           Anc_2.598 YMR037C
          Length = 519

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 3/55 (5%)

Query: 382 QCKICGKLMTRSSSLQTHM-YVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           +C  C K   RS  L+ H+  VH++ RPF CN+  C K F+   NL++H K H +
Sbjct: 463 KCNNCEKAFRRSEHLKRHIRSVHSSERPFPCNY--CEKKFSRSDNLSQHLKTHKK 515

>SAKL0H20988g Chr8 complement(1832478..1834124) [1647 bp, 548 aa]
           {ON} weakly similar to uniprot|P27705 Saccharomyces
           cerevisiae YGL035C MIG1 Transcription factor involved in
           glucose repression; C2H2 zinc finger protein similar to
           mammalian Egr and Wilms tumor proteins
          Length = 548

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 24/51 (47%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           C IC +   R      H+  HT  +P  C +  CGK F+    L RH ++H
Sbjct: 36  CPICSRAFHRLEHQTRHIRTHTGEKPHACEFPGCGKRFSRSDELTRHTRIH 86

>TBLA0A08910 Chr1 complement(2188408..2189580) [1173 bp, 390 aa]
           {ON} Anc_4.80 YGL035C
          Length = 390

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 25/53 (47%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           H C +C +   R      H+  HT  +P  C++  C K F+    L RH ++H
Sbjct: 72  HVCPVCNRAFHRLEHQTRHIRTHTGEKPHSCDFPGCTKKFSRSDELTRHKRIH 124

>KLLA0F01463g Chr6 (140343..142688) [2346 bp, 781 aa] {ON} some
           similarities with uniprot|P47043 Saccharomyces
           cerevisiae YJL056C ZAP1 Zinc-regulated transcription
           factor binds to zinc-responsive promoter elements to
           induce transcription of certain genes in the presence of
           zinc regulates its own transcription contains seven
           zinc- finger domains
          Length = 781

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 386 CGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           C K+  +   L  H+ VH+ Y+PF+C    CGK FN +  L +H ++H
Sbjct: 669 CNKVFVQKQKLIRHLKVHSKYKPFRC--AECGKCFNTQDILTQHLRVH 714

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAKTT 441
           +C +C K  + SSSL+ H+  HT  +P  C    C K FN  SNL +H + H R   + +
Sbjct: 721 KCHLCPKSYSTSSSLRIHIRTHTGEKPLSCPI--CNKRFNESSNLAKHIRTHKRENCRNS 778

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 25/51 (49%), Gaps = 3/51 (5%)

Query: 386 CGKLMTRSSSLQTHM---YVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           C K    + SL  H+   +V +    +KC WE C K F  K  L RH K+H
Sbjct: 636 CNKEFDSAKSLNEHIENFHVPSGLSSYKCEWEGCNKVFVQKQKLIRHLKVH 686

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           C  CGK       L  H+ VH+  RPFKC+   C K+++  S+L  H + H
Sbjct: 694 CAECGKCFNTQDILTQHLRVHSGERPFKCHL--CPKSYSTSSSLRIHIRTH 742

>Suva_7.240 Chr7 complement(423254..423364,423482..424918) [1548 bp,
           515 aa] {ON} YGL035C (REAL)
          Length = 515

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           H C IC +   R      HM +HT  +P  C++  C K F+    L RH ++H
Sbjct: 38  HACPICQRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIH 90

>Ecym_7255 Chr7 complement(537346..538980) [1635 bp, 544 aa] {ON}
           similar to Ashbya gossypii AGL071C
          Length = 544

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKL 432
           H+C  C K   R S L+ H+  H+  +P+ C W  C      K NL++H KL
Sbjct: 286 HKCHFCEKAFKRKSWLKRHLLSHSTMKPYSCPW--CHSRHKRKDNLSQHLKL 335

>Smik_11.186 Chr11 (309525..311450) [1926 bp, 641 aa] {ON} YKL062W
           (REAL)
          Length = 641

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 3/55 (5%)

Query: 382 QCKICGKLMTRSSSLQTHM-YVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           +CK C K   RS  L+ H+  VH+  RPF C +  C K F+   NL++H K H +
Sbjct: 585 KCKDCEKAFRRSEHLKRHIRSVHSTERPFACMF--CEKKFSRSDNLSQHLKTHKK 637

>KLTH0E06688g Chr5 (614548..615741) [1194 bp, 397 aa] {ON} weakly
           similar to uniprot|P39959 Saccharomyces cerevisiae
           YER130C Hypothetical ORF
          Length = 397

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 3/52 (5%)

Query: 383 CKICGKLMTRSSSLQTHM-YVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           C  C +   R   L+ H+  +H   +PF C    CGK F+   NLN+H K H
Sbjct: 342 CDFCDRRFKRQEHLKRHVRSLHMGEKPFDCQI--CGKKFSRSDNLNQHVKTH 391

>Skud_11.167 Chr11 (302970..304856) [1887 bp, 628 aa] {ON} YKL062W
           (REAL)
          Length = 628

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 31/55 (56%), Gaps = 3/55 (5%)

Query: 382 QCKICGKLMTRSSSLQTHM-YVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           +CK C K   RS  L+ H+  VH+  RPF C +  C K F+   NL++H K H +
Sbjct: 572 KCKDCEKAFRRSEHLKRHIRSVHSTERPFACMF--CEKKFSRSDNLSQHLKTHKK 624

>SAKL0F16170g Chr6 complement(1310627..1311940) [1314 bp, 437 aa]
           {ON} similar to uniprot|P39933 Saccharomyces cerevisiae
           YPR186C PZF1 Transcription factor IIIA (TFIIIA) with
           putative Zn-fingers
          Length = 437

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRH 429
           +C  C +   + S L+ HM+ H++ +PF C++  CGK    K  L RH
Sbjct: 87  KCDHCERTFAKKSHLERHMFTHSDNKPFHCSY--CGKGVTTKQQLKRH 132

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 2/47 (4%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRH 429
           C  CGK +T    L+ H   HT  + FKC +E C + F   S L  H
Sbjct: 116 CSYCGKGVTTKQQLKRHEITHT--KSFKCEYEGCNECFYKHSQLRSH 160

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%), Gaps = 3/52 (5%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNY---RPFKCNWENCGKTFNVKSNLNRHCK 431
           C+ CGK+  R   LQ H+  H N      ++C +  C +TF   + L +H K
Sbjct: 171 CEHCGKMFQRPYRLQNHLAKHHNVDVENKYQCTYTACTETFKTWTALQQHIK 222

>Suva_7.52 Chr7 (92333..93535) [1203 bp, 400 aa] {ON} YGL209W (REAL)
          Length = 400

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 25/52 (48%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           +C  C +   R    + H+  HT  +P  C +  CGK+F+    L RH + H
Sbjct: 18  RCDTCNRGFHRLEHKKRHLRTHTGEKPHHCGFPGCGKSFSRSDELKRHMRTH 69

>TPHA0D03400 Chr4 complement(714580..715596) [1017 bp, 338 aa] {ON}
           Anc_3.518 YGL209W
          Length = 338

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%)

Query: 383 CKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQ 437
           C IC K   R    + H+  HT  +P  C ++ C K F+    L RH K+H+ ++
Sbjct: 15  CDICSKGFRRLEHKKRHIRTHTGEKPHHCTFKGCVKKFSRSDELKRHLKIHVNKK 69

>Skud_13.193 Chr13 complement(330998..333112) [2115 bp, 704 aa] {ON}
           YMR037C (REAL)
          Length = 704

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 31/54 (57%), Gaps = 3/54 (5%)

Query: 383 CKICGKLMTRSSSLQTHM-YVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           C IC K   RS  L+ H+  VH+N RPF C+   C K F+   NL++H K H +
Sbjct: 649 CHICPKSFKRSEHLKRHVRSVHSNERPFACHI--CDKKFSRSDNLSQHIKTHKK 700

>YER028C Chr5 complement(210692..211876) [1185 bp, 394 aa] {ON}
           MIG3Probable transcriptional repressor involved in
           response to toxic agents such as hydroxyurea that
           inhibit ribonucleotide reductase; phosphorylation by
           Snf1p or the Mec1p pathway inactivates Mig3p, allowing
           induction of damage response genes
          Length = 394

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 27/54 (50%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           +C+IC +   R    + H   HT  +P KC  + C K+F+    L RH + H +
Sbjct: 18  RCEICSRGFHRLEHKKRHGRTHTGEKPHKCTVQGCPKSFSRSDELKRHLRTHTK 71

>Ecym_2301 Chr2 (584308..586611) [2304 bp, 767 aa] {ON} similar to
           Ashbya gossypii ABR089C
          Length = 767

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 33/62 (53%), Gaps = 4/62 (6%)

Query: 382 QCKICGKLMTRSSSLQTHM-YVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLRRQAKT 440
           +C+ C K   RS  L+ H+  VH+  RPF C +  C K F+   NL++H K H R+    
Sbjct: 699 KCQECTKAFRRSEHLKRHIRSVHSTDRPFPCTY--CDKKFSRSDNLSQHLKTH-RKHGDI 755

Query: 441 TD 442
            D
Sbjct: 756 KD 757

>KNAG0M02310 Chr13 complement(426937..428919) [1983 bp, 660 aa] {ON}
           Anc_2.598 YMR037C
          Length = 660

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 30/54 (55%), Gaps = 3/54 (5%)

Query: 383 CKICGKLMTRSSSLQTHM-YVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           C+ C K   RS  L+ H+  VH+  RP+ CN   C K F+   NL++H K H R
Sbjct: 605 CEQCLKAFKRSEHLKRHVRSVHSQERPYGCNI--CDKKFSRSDNLSQHLKTHKR 656

>Kpol_1065.15 s1065 (43237..43899) [663 bp, 220 aa] {ON}
           (43237..43899) [663 nt, 221 aa]
          Length = 220

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 27/55 (49%)

Query: 380 RHQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHL 434
           R +CK CG+  T S  L  H  +HT  +   C +E C   F+   N  +H K HL
Sbjct: 160 RFECKTCGRKFTTSGHLTRHNRIHTGEKNHVCPFEGCNLRFSRNDNSLQHYKTHL 214

>YGL035C Chr7 complement(431548..433062) [1515 bp, 504 aa] {ON}
           MIG1Transcription factor involved in glucose repression;
           sequence specific DNA binding protein containing two
           Cys2His2 zinc finger motifs; regulated by the SNF1
           kinase and the GLC7 phosphatase
          Length = 504

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           H C IC +   R      HM +HT  +P  C++  C K F+    L RH ++H
Sbjct: 38  HACPICHRAFHRLEHQTRHMRIHTGEKPHACDFPGCVKRFSRSDELTRHRRIH 90

>CAGL0K09372g Chr11 complement(925647..926837) [1191 bp, 396 aa]
           {ON} similar to uniprot|P53035 Saccharomyces cerevisiae
           YGL209w MIG2 C2H2 zinc-finger protein
          Length = 396

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%)

Query: 382 QCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           +C+ C +   R    + HM  HT  +P  C++  CGK+F+    L RH + H
Sbjct: 18  KCEHCSRGFHRLEHKKRHMRTHTGEKPHGCSFPGCGKSFSRSDELKRHNRTH 69

>Smik_13.207 Chr13 complement(338510..340621) [2112 bp, 703 aa] {ON}
           YMR037C (REAL)
          Length = 703

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 31/54 (57%), Gaps = 3/54 (5%)

Query: 383 CKICGKLMTRSSSLQTHM-YVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLHLR 435
           C IC K   RS  L+ H+  VH+N RPF C+   C K F+   NL++H K H +
Sbjct: 648 CHICPKSFKRSEHLKRHVRSVHSNERPFACHI--CEKKFSRSDNLSQHIKTHKK 699

>KAFR0J00340 Chr10 complement(58635..59291) [657 bp, 218 aa] {ON} 
          Length = 218

 Score = 40.0 bits (92), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKL 432
           ++C +C K+  R + L+ H   HTN R F C W  C      + NL +H KL
Sbjct: 119 YRCNVCNKIFQREAWLRRHHLSHTNDRNFLCPW--CKSKHKRRDNLFKHIKL 168

>KLLA0E18547g Chr5 complement(1648263..1649558) [1296 bp, 431 aa]
           {ON} some similarities with uniprot|P54785 Saccharomyces
           cerevisiae YMR070W MOT3 Nuclear transcription factor
           with two Cys2-His2 zinc fingers involved in repression
           of a subset of hypoxic genes by Rox1p repression of
           several DAN/TIR genes during aerobic growth and
           repression of ergosterol biosynthetic genes
          Length = 431

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 381 HQCKICGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKL 432
           +QC +C K   R S L+ H+  H+N + F C W  C  T   K NL +H KL
Sbjct: 306 YQCHLCEKQFRRKSWLKRHLLSHSNVKKFHCPW--CSSTHKRKDNLLQHLKL 355

>SAKL0B12672g Chr2 complement(1096894..1097751) [858 bp, 285 aa]
           {ON} weakly similar to uniprot|P32805 Saccharomyces
           cerevisiae YGL254W FZF1 Transcription factor involved in
           sulfite metabolism sole identified regulatory target is
           SSU1 overexpression suppresses sulfite-sensitivity of
           many unrelated mutants due to hyperactivation of SSU1
           contains five zinc fingers
          Length = 285

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 24/44 (54%)

Query: 386 CGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRH 429
           CGK+ +R   L+ H   HTN RPF C    CGK F   S+L  H
Sbjct: 15  CGKMYSRPCLLEQHRRSHTNERPFVCKEPGCGKGFLRDSHLKVH 58

 Score = 33.9 bits (76), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 23/48 (47%), Gaps = 2/48 (4%)

Query: 386 CGKLMTRSSSLQTHMYVHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           CGK   R S L+ H + H+  +P  C    C K F     L+RH K H
Sbjct: 45  CGKGFLRDSHLKVHKWSHSKVKPLTCPV--CFKGFITNQQLSRHSKTH 90

>Kwal_47.17241 s47 (312857..314068) [1212 bp, 403 aa] {ON} YER130C -
           Hypothetical ORF [contig 211] FULL
          Length = 403

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 3/52 (5%)

Query: 383 CKICGKLMTRSSSLQTHMY-VHTNYRPFKCNWENCGKTFNVKSNLNRHCKLH 433
           C  C +   R   L+ H+  +H   +PF C+   CGK F+   NLN+H K H
Sbjct: 348 CDFCDRRFKRQEHLKRHVRSLHMGEKPFDCHI--CGKKFSRSDNLNQHIKTH 397

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.133    0.431 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,780,193
Number of extensions: 1181088
Number of successful extensions: 4140
Number of sequences better than 10.0: 517
Number of HSP's gapped: 3903
Number of HSP's successfully gapped: 699
Length of query: 449
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 336
Effective length of database: 40,524,141
Effective search space: 13616111376
Effective search space used: 13616111376
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 67 (30.4 bits)