Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0B060802.307ON82482435540.0
Suva_4.1252.307ON79357014720.0
YDL122W (UBP1)2.307ON80954714720.0
TPHA0G008502.307ON78253414570.0
ZYRO0A02420g2.307ON74555214430.0
Smik_4.1152.307ON79054614460.0
TDEL0G023702.307ON74755014220.0
Skud_4.1332.307ON78755014250.0
SAKL0E07106g2.307ON79157214230.0
Kpol_1003.532.307ON78843613711e-178
NCAS0B061302.307ON77047213391e-173
CAGL0H10582g2.307ON79053413311e-172
KAFR0A069102.307ON67852512781e-165
KLTH0G10934g2.307ON75851112831e-165
NDAI0B034302.307ON85656212861e-164
Kwal_27.114442.307ON75754912711e-163
KLLA0E08801g2.307ON77154612651e-162
AGR389C2.307ON77551412431e-159
KNAG0A054502.307ON76443811751e-149
TBLA0B071602.307ON3843287436e-90
NDAI0G007802.307ON4863672537e-22
NCAS0G036802.307ON482622456e-21
SAKL0H10076g8.540ON7672261432e-08
KLLA0E23387g8.540ON7822721397e-08
TBLA0H036008.540ON4821801281e-06
Kwal_27.120308.540ON7492231262e-06
Smik_13.4318.742ON471681201e-05
Suva_16.2408.540ON5231851191e-05
YMR223W (UBP8)8.742ON471641191e-05
Skud_13.3928.742ON473641172e-05
Suva_13.4078.742ON471641172e-05
YNL186W (UBP10)2.69ON792601164e-05
KAFR0E009308.540ON4981851154e-05
Suva_14.1562.69ON788601155e-05
NDAI0F034102.69ON870601155e-05
TBLA0B097602.69ON898601146e-05
Ecym_11668.540ON6961841147e-05
ZYRO0A05962g8.742ON465581138e-05
NDAI0E008108.742ON493581121e-04
Kpol_1044.242.69ON724601111e-04
NCAS0G018002.69ON875691111e-04
NCAS0C021108.540ON4941611092e-04
KLTH0E12540g8.540ON7521601102e-04
Skud_14.1482.69ON776601092e-04
KAFR0A042108.742ON440581083e-04
SAKL0E13002g2.69ON739621083e-04
KAFR0L017307.390ON701691074e-04
KLLA0D08459g2.69ON750601084e-04
TDEL0B036708.742ON463581064e-04
CAGL0J11352g2.69ON771601074e-04
KLTH0B07150g2.69ON756621065e-04
ZYRO0D03982g8.540ON8212411066e-04
CAGL0M11198g8.742ON461581056e-04
TDEL0A011002.69ON661601057e-04
Kwal_33.144302.69ON511601057e-04
Skud_15.2865.443ON1278631067e-04
NDAI0C059008.188ON826641059e-04
TPHA0O016402.69ON746591040.001
KNAG0F012202.69ON784751040.001
Kwal_26.91518.742ON454621030.001
ZYRO0C09812g2.69ON702601030.001
NDAI0E028208.540ON4951751020.001
CAGL0G02563gsingletonON6311971020.002
Smik_14.1442.69ON763601020.002
Smik_5.3098.188ON805331010.002
KNAG0A019708.540ON4711231000.002
Smik_15.3015.443ON1272631010.002
SAKL0H04994g8.742ON454611000.002
TDEL0D025805.443ON1272651010.002
Skud_16.2098.540ON503189990.003
NCAS0B005808.742ON46665990.003
KNAG0G029308.742ON45961990.003
Kpol_1024.448.540ON496205990.003
Kpol_1064.488.742ON46657980.004
ABL145W2.69ON74960990.004
YOR124C (UBP2)5.443ON127263990.004
NDAI0E041807.390ON82770980.005
Suva_8.1765.443ON127063980.005
TBLA0D010708.742ON48370970.005
Suva_5.2728.188ON78844970.006
YPL072W (UBP16)8.540ON499189970.006
TPHA0P006807.390ON72766970.007
ZYRO0G01606g5.443ON130565970.007
Kpol_1062.235.443ON126665970.008
AEL242W8.540ON613175960.008
KAFR0A075802.69ON80260960.009
TDEL0B030608.540ON734180960.010
Ecym_45145.443ON124663960.010
Skud_5.2818.188ON82333960.010
Smik_16.1638.540ON501186940.012
NDAI0F002005.712ON1105306950.013
Kpol_513.255.18ON119051950.014
NCAS0A039108.188ON79563940.014
KLLA0C06974g8.742ON44658940.014
Kwal_14.20088.188ON42447930.018
TPHA0G005608.742ON46357930.018
Smik_2.497.390ON74565930.019
YER144C (UBP5)8.188ON80533930.019
NCAS0H021005.443ON126949930.020
CAGL0A04477g7.390ON77075930.020
YBL067C (UBP13)7.390ON74765930.022
KLTH0D12760g8.742ON45358920.023
TBLA0A064705.443ON132065930.023
CAGL0I06600g8.202ON81649920.027
KLTH0H07678g8.188ON86133910.033
KNAG0B041905.443ON126248910.034
KNAG0C035807.390ON77674910.034
KAFR0H001505.712ON656277900.038
NDAI0C015505.443ON129570910.041
Skud_2.387.390ON74868900.050
TBLA0D006207.390ON117165900.050
SAKL0G02728g5.443ON123765890.056
AFR551W8.742ON46962890.057
Suva_2.507.390ON75065890.060
Ecym_62488.742ON46662880.061
TPHA0C027708.188ON97031890.061
KNAG0B023707.390ON75371880.069
SAKL0H18986g8.188ON89331880.081
TPHA0L016708.540ON524187870.084
Skud_4.3238.188ON92660880.085
KNAG0D019308.188ON98661880.092
Kwal_55.213935.443ON123365880.094
Kpol_1032.288.188ON88227870.10
Kpol_1045.417.390ON71265870.11
ACL164C5.443ON138963870.11
KLLA0E10275g8.188ON79641860.12
Ecym_46857.390ON77868860.13
KAFR0C025908.188ON97831860.14
AGR370W7.390ON74065860.14
Suva_2.2288.188ON92733860.14
YDR069C (DOA4)8.188ON92633860.15
NDAI0A036808.188ON111631860.15
NCAS0B042808.188ON92231850.16
Smik_4.3078.188ON92933850.16
TBLA0B019308.202ON101949850.18
KAFR0I026005.18ON121359850.19
KLTH0F15862g5.443ON124163840.23
TDEL0C056401.137ON117845840.24
TPHA0E017105.443ON128365830.34
KAFR0C004103.270ON76923820.42
KNAG0G015908.188ON67158820.43
KLLA0E02377g5.443ON122065820.43
TDEL0B020805.712ON1025192810.48
NDAI0I025305.18ON119750820.48
AFR296C5.712ON1169200810.49
TBLA0C070205.18ON124751810.51
Skud_10.221.137ON125527810.53
Ecym_81401.137ON126446810.61
ZYRO0D07062g5.18ON119351810.62
TBLA0F036108.188ON114459800.68
TDEL0B042208.188ON82574800.75
AFR627C1.137ON128735800.75
NCAS0A038408.202ON91748790.86
AGR139C8.202ON78933790.90
KLTH0B09944g5.18ON118951790.94
Suva_6.2761.137ON125644790.94
CAGL0H06721g5.712ON108126781.1
Ecym_55448.202ON83456781.2
CAGL0G05247g8.188ON94760781.2
YJL197W (UBP12)1.137ON125419781.2
Smik_10.371.137ON124719781.3
NCAS0I031401.137ON120121781.3
Kpol_534.231.369ON49618771.3
Smik_13.5215.18ON123150781.4
YMR304W (UBP15)5.18ON123050781.4
ZYRO0G06798g8.188ON87727771.4
NDAI0B004801.137ON125336781.4
Kwal_56.240746.218ON55998771.4
TBLA0J006001.137ON146218781.5
Suva_13.4955.18ON123050771.5
CAGL0H05335g8.540ON48323761.6
Skud_13.4785.18ON123150771.6
TPHA0D043508.202ON85448771.8
ZYRO0C17908g1.137ON120445771.9
Skud_2.1773.270ON78218762.0
NCAS0D023905.18ON121147762.0
TPHA0L022905.18ON119347762.0
YIL156W (UBP7)5.712ON107176762.1
Smik_11.3625.712ON721188762.1
YKR098C (UBP11)5.712ON717187762.1
CAGL0I06765g8.188ON88760762.2
AEL029W1.369ON44618752.2
Smik_9.135.712ON106076762.3
NCAS0G001705.712ON1030306752.8
Kwal_14.19578.202ON44449743.1
AGL357W5.18ON116661743.4
YBR058C (UBP14)3.270ON78119743.4
TDEL0G004105.18ON118651743.8
Suva_4.2953.270ON78218743.8
Smik_2.1893.270ON78218743.9
Kpol_251.73.270ON48018734.0
NDAI0C059508.202ON108057734.3
Klac_YGOB_Anc_5.18b5.18ON116650734.7
TBLA0C012001.369ON50349725.2
Skud_9.125.712ON106477726.0
TPHA0B011501.225ON690102726.6
Ecym_56715.18ON117655726.7
SAKL0C04246g1.137ON129758727.0
CAGL0H10186g3.270ON77860717.7
CAGL0M13783g5.18ON119648719.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0B06080
         (824 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0B06080 Chr2 (1437254..1439728) [2475 bp, 824 aa] {ON} Anc_2...  1373   0.0  
Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W ...   571   0.0  
YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}  UBP1Ubiqui...   571   0.0  
TPHA0G00850 Chr7 (158945..161293) [2349 bp, 782 aa] {ON} Anc_2.3...   565   0.0  
ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} simila...   560   0.0  
Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W ...   561   0.0  
TDEL0G02370 Chr7 (456393..458636) [2244 bp, 747 aa] {ON} Anc_2.3...   552   0.0  
Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W ...   553   0.0  
SAKL0E07106g Chr5 complement(584164..586539) [2376 bp, 791 aa] {...   552   0.0  
Kpol_1003.53 s1003 (121699..124065) [2367 bp, 788 aa] {ON} (1216...   532   e-178
NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa] ...   520   e-173
CAGL0H10582g Chr8 complement(1029876..1032248) [2373 bp, 790 aa]...   517   e-172
KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] ...   496   e-165
KLTH0G10934g Chr7 (919304..921580) [2277 bp, 758 aa] {ON} simila...   498   e-165
NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}    499   e-164
Kwal_27.11444 s27 complement(802766..805039) [2274 bp, 757 aa] {...   494   e-163
KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} simila...   491   e-162
AGR389C Chr7 complement(1444377..1446704) [2328 bp, 775 aa] {ON}...   483   e-159
KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.3...   457   e-149
TBLA0B07160 Chr2 complement(1696047..1697201) [1155 bp, 384 aa] ...   290   6e-90
NDAI0G00780 Chr7 (164452..165912) [1461 bp, 486 aa] {ON}              102   7e-22
NCAS0G03680 Chr7 complement(682617..684065) [1449 bp, 482 aa] {O...    99   6e-21
SAKL0H10076g Chr8 (863358..865661) [2304 bp, 767 aa] {ON} simila...    60   2e-08
KLLA0E23387g Chr5 complement(2079405..2081753) [2349 bp, 782 aa]...    58   7e-08
TBLA0H03600 Chr8 complement(877069..878517) [1449 bp, 482 aa] {O...    54   1e-06
Kwal_27.12030 s27 complement(1056215..1058464) [2250 bp, 749 aa]...    53   2e-06
Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223...    51   1e-05
Suva_16.240 Chr16 (429066..430637) [1572 bp, 523 aa] {ON} YPL072...    50   1e-05
YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}  UBP8Ubiqu...    50   1e-05
Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223...    50   2e-05
Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223...    50   2e-05
YNL186W Chr14 (289498..291876) [2379 bp, 792 aa] {ON}  UBP10Ubiq...    49   4e-05
KAFR0E00930 Chr5 (198914..200410) [1497 bp, 498 aa] {ON} Anc_8.5...    49   4e-05
Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186...    49   5e-05
NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {O...    49   5e-05
TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa] ...    49   6e-05
Ecym_1166 Chr1 (339106..341196) [2091 bp, 696 aa] {ON} similar t...    49   7e-05
ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {...    48   8e-05
NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {O...    48   1e-04
Kpol_1044.24 s1044 (56564..58738) [2175 bp, 724 aa] {ON} (56564....    47   1e-04
NCAS0G01800 Chr7 (319652..322279) [2628 bp, 875 aa] {ON} Anc_2.69      47   1e-04
NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.5...    47   2e-04
KLTH0E12540g Chr5 complement(1111576..1113834) [2259 bp, 752 aa]...    47   2e-04
Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186...    47   2e-04
KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.7...    46   3e-04
SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa]...    46   3e-04
KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7....    46   4e-04
KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {...    46   4e-04
TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {O...    45   4e-04
CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa...    46   4e-04
KLTH0B07150g Chr2 complement(574195..576465) [2271 bp, 756 aa] {...    45   5e-04
ZYRO0D03982g Chr4 (324687..327152) [2466 bp, 821 aa] {ON} weakly...    45   6e-04
CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} sim...    45   6e-04
TDEL0A01100 Chr1 (186399..188384) [1986 bp, 661 aa] {ON} Anc_2.6...    45   7e-04
Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186...    45   7e-04
Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] ...    45   7e-04
NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa] ...    45   9e-04
TPHA0O01640 Chr15 complement(325844..328084) [2241 bp, 746 aa] {...    45   0.001
KNAG0F01220 Chr6 (219798..222152) [2355 bp, 784 aa] {ON} Anc_2.6...    45   0.001
Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] ...    44   0.001
ZYRO0C09812g Chr3 complement(743861..745969) [2109 bp, 702 aa] {...    44   0.001
NDAI0E02820 Chr5 (598119..599606) [1488 bp, 495 aa] {ON} Anc_8.5...    44   0.001
CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {...    44   0.002
Smik_14.144 Chr14 (268784..271075) [2292 bp, 763 aa] {ON} YNL186...    44   0.002
Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON...    44   0.002
KNAG0A01970 Chr1 (157670..159085) [1416 bp, 471 aa] {ON} Anc_8.5...    43   0.002
Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] ...    44   0.002
SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {...    43   0.002
TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5....    44   0.002
Skud_16.209 Chr16 (389855..391366) [1512 bp, 503 aa] {ON} YPL072...    43   0.003
NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742       43   0.003
KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.7...    43   0.003
Kpol_1024.44 s1024 (118060..119550) [1491 bp, 496 aa] {ON} (1180...    43   0.003
Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON} (88495....    42   0.004
ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic ho...    43   0.004
YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}...    43   0.004
NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {O...    42   0.005
Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {O...    42   0.005
TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {O...    42   0.005
Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON...    42   0.006
YPL072W Chr16 (418512..420011) [1500 bp, 499 aa] {ON}  UBP16Deub...    42   0.006
TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7....    42   0.007
ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] ...    42   0.007
Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON} (51365...    42   0.008
AEL242W Chr5 (182610..184451) [1842 bp, 613 aa] {ON} Syntenic ho...    42   0.008
KAFR0A07580 Chr1 complement(1528362..1530770) [2409 bp, 802 aa] ...    42   0.009
TDEL0B03060 Chr2 (545366..547570) [2205 bp, 734 aa] {ON} Anc_8.5...    42   0.010
Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {...    42   0.010
Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON...    42   0.010
Smik_16.163 Chr16 (301703..303208) [1506 bp, 501 aa] {ON} YPL072...    41   0.012
NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712      41   0.013
Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON} (71125.....    41   0.014
NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188     41   0.014
KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {...    41   0.014
Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C...    40   0.018
TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {O...    40   0.018
Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON} Y...    40   0.019
YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}  ...    40   0.019
NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {...    40   0.020
CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} simila...    40   0.020
YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}  UB...    40   0.022
KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} simi...    40   0.023
TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_...    40   0.023
CAGL0I06600g Chr9 (639096..641546) [2451 bp, 816 aa] {ON} simila...    40   0.027
KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} simila...    40   0.033
KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5....    40   0.034
KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {O...    40   0.034
KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712...    39   0.038
NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5....    40   0.041
Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON} Y...    39   0.050
TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {...    39   0.050
SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] ...    39   0.056
AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic ...    39   0.057
Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON} Y...    39   0.060
Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar t...    39   0.061
TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.1...    39   0.061
KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {O...    39   0.069
SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} simi...    39   0.081
TPHA0L01670 Chr12 complement(351116..352690) [1575 bp, 524 aa] {...    38   0.084
Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON...    39   0.085
KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.1...    39   0.092
Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR12...    39   0.094
Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {O...    38   0.10 
Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {O...    38   0.11 
ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON} Sy...    38   0.11 
KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} simila...    38   0.12 
Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {O...    38   0.13 
KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {O...    38   0.14 
AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic ...    38   0.14 
Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON...    38   0.14 
YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}  ...    38   0.15 
NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON}              38   0.15 
NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188     37   0.16 
Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON...    37   0.16 
TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8....    37   0.18 
KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5....    37   0.19 
KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} sim...    37   0.23 
TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]...    37   0.24 
TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5....    37   0.34 
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    36   0.42 
KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {O...    36   0.43 
KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] ...    36   0.43 
TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5....    36   0.48 
NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5....    36   0.48 
AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON} ...    36   0.49 
TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_...    36   0.51 
Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W ...    36   0.53 
Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON...    36   0.61 
ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] ...    36   0.62 
TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8....    35   0.68 
TDEL0B04220 Chr2 (747864..750341) [2478 bp, 825 aa] {ON} Anc_8.1...    35   0.75 
AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON...    35   0.75 
NCAS0A03840 Chr1 (780031..782784) [2754 bp, 917 aa] {ON} Anc_8.2...    35   0.86 
AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}...    35   0.90 
KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] ...    35   0.94 
Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {O...    35   0.94 
CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] ...    35   1.1  
Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar...    35   1.2  
CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {...    35   1.2  
YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}  UBP12Ubiqu...    35   1.2  
Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W ...    35   1.3  
NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {...    35   1.3  
Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {...    34   1.3  
Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR30...    35   1.4  
YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}  UBP15Ubi...    35   1.4  
ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some s...    34   1.4  
NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON...    35   1.4  
Kwal_56.24074 s56 (836209..837888) [1680 bp, 559 aa] {ON} YGL066...    34   1.4  
TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON} Anc_1...    35   1.5  
Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR30...    34   1.5  
CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {...    34   1.6  
Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR30...    34   1.6  
TPHA0D04350 Chr4 complement(934597..937161) [2565 bp, 854 aa] {O...    34   1.8  
ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa...    34   1.9  
Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON...    34   2.0  
NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {...    34   2.0  
TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5...    34   2.0  
YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}  UBP7Ubiquit...    34   2.1  
Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {...    34   2.1  
YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON} ...    34   2.1  
CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} simila...    34   2.2  
AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic ho...    33   2.2  
Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (R...    34   2.3  
NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712      33   2.8  
Kwal_14.1957 s14 (549510..550844) [1335 bp, 444 aa] {ON} YER151C...    33   3.1  
AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic hom...    33   3.4  
YBR058C Chr2 complement(353672..356017) [2346 bp, 781 aa] {ON}  ...    33   3.4  
TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON...    33   3.8  
Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON...    33   3.8  
Smik_2.189 Chr2 complement(335612..337960) [2349 bp, 782 aa] {ON...    33   3.9  
Kpol_251.7 s251 (12280..13719) [1440 bp, 480 aa] {ON} (12280..13...    33   4.0  
NDAI0C05950 Chr3 complement(1361343..1364585) [3243 bp, 1080 aa]...    33   4.3  
Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [35...    33   4.7  
TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512...    32   5.2  
Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W (R...    32   6.0  
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    32   6.6  
Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {...    32   6.7  
SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} simil...    32   7.0  
CAGL0H10186g Chr8 complement(993354..995690) [2337 bp, 778 aa] {...    32   7.7  
CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} si...    32   9.6  

>TBLA0B06080 Chr2 (1437254..1439728) [2475 bp, 824 aa] {ON}
           Anc_2.307 YDL122W
          Length = 824

 Score = 1373 bits (3554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 683/824 (82%), Positives = 683/824 (82%)

Query: 1   MNISCSNDPSGYRKWVTKNNLQIQNTVMKRGGFVGGLVNEGNTCFMNSVLQSLASSHEIV 60
           MNISCSNDPSGYRKWVTKNNLQIQNTVMKRGGFVGGLVNEGNTCFMNSVLQSLASSHEIV
Sbjct: 1   MNISCSNDPSGYRKWVTKNNLQIQNTVMKRGGFVGGLVNEGNTCFMNSVLQSLASSHEIV 60

Query: 61  RFLDXXXXXXXXXXXXXXXXXXXXXSDSAHNHHNHQQDDXXXXXXXXXXXXXXLTKTNDD 120
           RFLD                     SDSAHNHHNHQQDD              LTKTNDD
Sbjct: 61  RFLDEEIIKQFKQKQLQELEELHKKSDSAHNHHNHQQDDKKSKNKSYGKRKKKLTKTNDD 120

Query: 121 DMSTDVSFSISXXXXXXXXXXXYYRERKYYRTNNLLKTMSKAPNKNIILGYEQEDAQEFF 180
           DMSTDVSFSIS           YYRERKYYRTNNLLKTMSKAPNKNIILGYEQEDAQEFF
Sbjct: 121 DMSTDVSFSISLKDLLDKLNDKYYRERKYYRTNNLLKTMSKAPNKNIILGYEQEDAQEFF 180

Query: 181 QTILYELEKNIKFLDSDREKLDKKPIPESDLPSNALIGQNNLSHVGTVYIPTAHLDPNSL 240
           QTILYELEKNIKFLDSDREKLDKKPIPESDLPSNALIGQNNLSHVGTVYIPTAHLDPNSL
Sbjct: 181 QTILYELEKNIKFLDSDREKLDKKPIPESDLPSNALIGQNNLSHVGTVYIPTAHLDPNSL 240

Query: 241 LDKDPSTNYFTPFRLVTPLDGIVAERIGCLNCGETGGIRYSVSSGLSLNLPSENIGDTLK 300
           LDKDPSTNYFTPFRLVTPLDGIVAERIGCLNCGETGGIRYSVSSGLSLNLPSENIGDTLK
Sbjct: 241 LDKDPSTNYFTPFRLVTPLDGIVAERIGCLNCGETGGIRYSVSSGLSLNLPSENIGDTLK 300

Query: 301 LSQLLNEWCKPEIIEGVNCYRCSLNAVLEHLENQLKTMSEKPKGSIPDKLISAIKTRIKA 360
           LSQLLNEWCKPEIIEGVNCYRCSLNAVLEHLENQLKTMSEKPKGSIPDKLISAIKTRIKA
Sbjct: 301 LSQLLNEWCKPEIIEGVNCYRCSLNAVLEHLENQLKTMSEKPKGSIPDKLISAIKTRIKA 360

Query: 361 LNETLSKPVIDDEEYKKMHTDNMVRKSSKSKQIILARPPPLLSIHINRSVFDTRTFMIKK 420
           LNETLSKPVIDDEEYKKMHTDNMVRKSSKSKQIILARPPPLLSIHINRSVFDTRTFMIKK
Sbjct: 361 LNETLSKPVIDDEEYKKMHTDNMVRKSSKSKQIILARPPPLLSIHINRSVFDTRTFMIKK 420

Query: 421 NNSRLAFKARLNLKPWCCDVNDINLDARLPMSKTQKXXXXXXXXXXXXTVGGEYYAKLHD 480
           NNSRLAFKARLNLKPWCCDVNDINLDARLPMSKTQK            TVGGEYYAKLHD
Sbjct: 421 NNSRLAFKARLNLKPWCCDVNDINLDARLPMSKTQKSEEDGSISSEDETVGGEYYAKLHD 480

Query: 481 KFQKEFEDSDEEQEDGMSDYSDYNMRSNRDVDNYDPLNEDTEHDEIRETVSTTDSEDEYI 540
           KFQKEFEDSDEEQEDGMSDYSDYNMRSNRDVDNYDPLNEDTEHDEIRETVSTTDSEDEYI
Sbjct: 481 KFQKEFEDSDEEQEDGMSDYSDYNMRSNRDVDNYDPLNEDTEHDEIRETVSTTDSEDEYI 540

Query: 541 EETDKLGNTIRIPKSKESENHHHIKRTIXXXXXXXXXXXXXXXXXXXSSSTNESHTEKFK 600
           EETDKLGNTIRIPKSKESENHHHIKRTI                   SSSTNESHTEKFK
Sbjct: 541 EETDKLGNTIRIPKSKESENHHHIKRTIVESNDESEELEVEYEMDLNSSSTNESHTEKFK 600

Query: 601 XXXXXXXXXXXXXXLPNSDSSEEEEANGHNENVTYXXXXXXXXXXXXXXXXXXXXXXAPT 660
                         LPNSDSSEEEEANGHNENVTY                      APT
Sbjct: 601 GGSGNVASSNGVNVLPNSDSSEEEEANGHNENVTYSSSSDGDDDEDDDLPPPPPLSLAPT 660

Query: 661 YSTKVPTGPLTYELRSVIVHYGTHNYGHYIAFRKYRGTWWRISDETVHMVDEAEVLSTPS 720
           YSTKVPTGPLTYELRSVIVHYGTHNYGHYIAFRKYRGTWWRISDETVHMVDEAEVLSTPS
Sbjct: 661 YSTKVPTGPLTYELRSVIVHYGTHNYGHYIAFRKYRGTWWRISDETVHMVDEAEVLSTPS 720

Query: 721 VFMLFYEYDFDEKSGMMKDDLXXXXXXXXXFDVGTESDESSDELGMNEHLPAXXXXXXXX 780
           VFMLFYEYDFDEKSGMMKDDL         FDVGTESDESSDELGMNEHLPA        
Sbjct: 721 VFMLFYEYDFDEKSGMMKDDLEKHEYEEEEFDVGTESDESSDELGMNEHLPATNEDDLNE 780

Query: 781 XXXXXXXXXXXRIGQGLENIKDEKTIGEYQDASNNVFNGNKHLI 824
                      RIGQGLENIKDEKTIGEYQDASNNVFNGNKHLI
Sbjct: 781 LEVELTEEANERIGQGLENIKDEKTIGEYQDASNNVFNGNKHLI 824

>Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W
           (REAL)
          Length = 793

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/570 (53%), Positives = 390/570 (68%), Gaps = 40/570 (7%)

Query: 14  KWVTKNNL-QIQNTVMKRGGFVGGLVNEGNTCFMNSVLQSLASSHEIVRFLDXXXXXXXX 72
           +W+ ++    +   V+KRGGF+ GLVN+GNTCFMNSVLQSLASS E++ FLD        
Sbjct: 79  RWLPRSKFTHLDEEVLKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMDFLDNNVIKTYE 138

Query: 73  XXXXXXXXXXXXXSDSAHNHHNHQQDDXXXXXXXXXXXXXXLTKTN---------DDDMS 123
                         ++ H H + +                   K N         +++  
Sbjct: 139 ELEENAENK----EENGHEHEDEEDGHKKKSAKNGKVYGKHKKKLNRKLSSKGEEEENQE 194

Query: 124 TDVSFSISXXXXXXXXXXXYYRERKYYRTNNLLKTMSKAPNKNIILGYEQEDAQEFFQTI 183
            DV+FS++           YYR++ Y++TN LLK MSK+P KN++LGY+QEDAQEFFQ +
Sbjct: 195 PDVTFSVTLRDLLAALNDKYYRDKPYFKTNRLLKAMSKSPRKNMLLGYDQEDAQEFFQNL 254

Query: 184 LYELEKNIKFLDSDREKLDKKPIPESDLPSNALIGQNNLSHVGTVYIPTAHLDPNSLLDK 243
           L ELE NIK L+S  EKLD  PI +++LP++AL+GQNNL  VGTVYIPT  +DPNS+L  
Sbjct: 255 LAELENNIKSLNS--EKLDTTPIAKTELPADALVGQNNLEKVGTVYIPTEQIDPNSIL-H 311

Query: 244 DPSTNYFTPFRLVTPLDGIVAERIGCLNCGETGGIRYSVSSGLSLNLPSENIGDTLKLSQ 303
           D S   FTP++L+TPLDGI AERIGCL CGE GGIRYSV SGLSLNLP+ENIG TLKLSQ
Sbjct: 312 DKSIKNFTPYKLITPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPNENIGCTLKLSQ 371

Query: 304 LLNEWCKPEIIEGVNCYRCSLNAVLEHLENQLKTMSEKPKGSIPDKLISAIKTRIKALNE 363
           LL++W KPEIIEGV C RC+L A   HL  QLK   +KP+GSIP+KLI+A++ R++ + E
Sbjct: 372 LLSDWSKPEIIEGVECNRCALTAAHSHLLGQLKEFRKKPEGSIPEKLINAVEDRVQQIEE 431

Query: 364 TLSKPVIDDEEYKKMHTDNMVRKSSKSKQIILARPPPLLSIHINRSVFDTRTFMIKKNNS 423
            L+KPVIDDE+Y+K+HT NMVRK SKSKQI+++RPPPLLSIHINRSVFD RT+MI+KNNS
Sbjct: 432 VLAKPVIDDEDYEKLHTANMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNS 491

Query: 424 RLAFKARLNLKPWCCDVNDINLDARLPMSKTQKXXXXXXXXXXXXTVGGEYYAKLHDKFQ 483
           ++ FK+RLNL PWCCD+++INLDARLPMSK +K             +GGEYY+KLH++F+
Sbjct: 492 KVLFKSRLNLAPWCCDIDEINLDARLPMSKKEK--AMQQDSSEDENIGGEYYSKLHERFE 549

Query: 484 KEFEDS------DEEQEDGMSDYSDYNMRSNRDVDNYDPLNEDTEHDEIRETVSTTDSED 537
           +EFEDS      D+ +E+  S Y+D     NRD +NYDPLN   E D +     T+D ED
Sbjct: 550 QEFEDSEEEREYDDGEENQASHYND-----NRDTNNYDPLN--GEADGL-----TSDDED 597

Query: 538 EYIEETDKLGNTIR---IPKSKESENHHHI 564
           EYIEETD LGNTIR   I  +  +E H H+
Sbjct: 598 EYIEETDALGNTIRKRNIEHANTNEEHEHV 627

 Score =  154 bits (388), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 69/84 (82%), Positives = 76/84 (90%), Gaps = 1/84 (1%)

Query: 658 APTYSTKVPTGPLTYELRSVIVHYGTHNYGHYIAFRKYRGTWWRISDETVHMVDEAEVLS 717
           A ++ST VP  PLTY LRSVIVHYGTHNYGHYIAFRKYRG WWRISDETV++VDEAEVLS
Sbjct: 672 ARSFST-VPATPLTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVDEAEVLS 730

Query: 718 TPSVFMLFYEYDFDEKSGMMKDDL 741
           TP VFMLFYEYD+DE++G MKDDL
Sbjct: 731 TPGVFMLFYEYDYDEETGEMKDDL 754

>YDL122W Chr4 (242552..244981) [2430 bp, 809 aa] {ON}
           UBP1Ubiquitin-specific protease that removes ubiquitin
           from ubiquitinated proteins; cleaves at the C terminus
           of ubiquitin fusions irrespective of their size; capable
           of cleaving polyubiquitin chains
          Length = 809

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/547 (54%), Positives = 384/547 (70%), Gaps = 23/547 (4%)

Query: 14  KWVTKNNL-QIQNTVMKRGGFVGGLVNEGNTCFMNSVLQSLASSHEIVRFLDXXXXXXXX 72
           +W+ ++    +   ++KRGGF+ GLVN+GNTCFMNSVLQSLASS E++ FLD        
Sbjct: 79  RWLPRSKFTHLDEEILKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMEFLDNNVIRTYE 138

Query: 73  XXXXXXXXXXXXXSDSAHNHHNHQQDDXXXXXXXXXXXXXXLTKTN---DDDMST--DVS 127
                         +SA +   H+++                 K++   D++ S   D++
Sbjct: 139 EIEQNEHNEEGNGQESAQDEATHKKNTRKGGKVYGKHKKKLNRKSSSKEDEEKSQEPDIT 198

Query: 128 FSISXXXXXXXXXXXYYRERKYYRTNNLLKTMSKAPNKNIILGYEQEDAQEFFQTILYEL 187
           FS++           YYR++ Y++TN+LLK MSK+P KNI+LGY+QEDAQEFFQ IL EL
Sbjct: 199 FSVALRDLLSALNAKYYRDKPYFKTNSLLKAMSKSPRKNILLGYDQEDAQEFFQNILAEL 258

Query: 188 EKNIKFLDSDREKLDKKPIPESDLPSNALIGQNNLSHVGTVYIPTAHLDPNSLLDKDPST 247
           E N+K L++  EKLD  P+ +S+LP +AL+GQ NL  VGTVYIPT  +DPNS+L  D S 
Sbjct: 259 ESNVKSLNT--EKLDTTPVAKSELPDDALVGQLNLGEVGTVYIPTEQIDPNSIL-HDKSI 315

Query: 248 NYFTPFRLVTPLDGIVAERIGCLNCGETGGIRYSVSSGLSLNLPSENIGDTLKLSQLLNE 307
             FTPF+L+TPLDGI AERIGCL CGE GGIRYSV SGLSLNLP+ENIG TLKLSQLL++
Sbjct: 316 QNFTPFKLMTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPNENIGSTLKLSQLLSD 375

Query: 308 WCKPEIIEGVNCYRCSLNAVLEHLENQLKTMSEKPKGSIPDKLISAIKTRIKALNETLSK 367
           W KPEIIEGV C RC+L A   HL  QLK   +KP+GSIP+KLI+A+K R+  + E L+K
Sbjct: 376 WSKPEIIEGVECNRCALTAAHSHLFGQLKEFEKKPEGSIPEKLINAVKDRVHQIEEVLAK 435

Query: 368 PVIDDEEYKKMHTDNMVRKSSKSKQIILARPPPLLSIHINRSVFDTRTFMIKKNNSRLAF 427
           PVIDDE+YKK+HT NMVRK SKSKQI+++RPPPLLSIHINRSVFD RT+MI+KNNS++ F
Sbjct: 436 PVIDDEDYKKLHTANMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKVLF 495

Query: 428 KARLNLKPWCCDVNDINLDARLPMSKTQKXXXXXXXXXXXXTVGGEYYAKLHDKFQKEFE 487
           K+RLNL PWCCD+N+INLDARLPMSK +K             +GGEYY KLH++F++EFE
Sbjct: 496 KSRLNLAPWCCDINEINLDARLPMSKKEK--AAQQDSSEDENIGGEYYTKLHERFEQEFE 553

Query: 488 DSDEEQ--EDGMSDY-SDYNMRSNRDVDNYDPLNEDTEHDEIRETVSTTDSEDEYIEETD 544
           DS+EE+  +D   +Y S YN    +D+ NYDPLN + +         T+D EDEYIEETD
Sbjct: 554 DSEEEKEYDDAEGNYASHYN--HTKDISNYDPLNGEVDG-------VTSDDEDEYIEETD 604

Query: 545 KLGNTIR 551
            LGNTI+
Sbjct: 605 ALGNTIK 611

 Score =  156 bits (394), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 70/84 (83%), Positives = 76/84 (90%), Gaps = 1/84 (1%)

Query: 658 APTYSTKVPTGPLTYELRSVIVHYGTHNYGHYIAFRKYRGTWWRISDETVHMVDEAEVLS 717
           A ++ST VP  PLTY LRSVIVHYGTHNYGHYIAFRKYRG WWRISDETV++VDEAEVLS
Sbjct: 668 ARSFST-VPATPLTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVDEAEVLS 726

Query: 718 TPSVFMLFYEYDFDEKSGMMKDDL 741
           TP VFMLFYEYDFDE++G MKDDL
Sbjct: 727 TPGVFMLFYEYDFDEETGKMKDDL 750

>TPHA0G00850 Chr7 (158945..161293) [2349 bp, 782 aa] {ON} Anc_2.307
           YDL122W
          Length = 782

 Score =  565 bits (1457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/534 (56%), Positives = 374/534 (70%), Gaps = 21/534 (3%)

Query: 23  IQNTVMKRGGFVGGLVNEGNTCFMNSVLQSLASSHEIVRFLDXXXXXXXXXXXXXXXXXX 82
           + +T++KRGG + GLVN+GNTCFMNSVLQSLASS  +V FLD                  
Sbjct: 74  MDDTILKRGGHIAGLVNDGNTCFMNSVLQSLASSRTLVEFLDEEIVNSQLKDDETEGENE 133

Query: 83  XXXSD----SAHNHHNHQQDDXXXXXXXXXXXXXXLTKTNDDDMSTDVSFSISXXXXXXX 138
               +         + ++                 L KT ++    DV+FSI+       
Sbjct: 134 KEVGEEVQVKVQKLNKNKNGGKRKKKLQKQKDQEDLEKT-EESTEKDVAFSIALKELLDK 192

Query: 139 XXXXYYRERKYYRTNNLLKTMSKAPNKNIILGYEQEDAQEFFQTILYELEKNIKFLDSDR 198
               YYR++ Y++T++LLKTMSKAPNKNII+GY+QEDAQEFFQ+IL ELEKN+K + S  
Sbjct: 193 LNFKYYRDKPYFKTHSLLKTMSKAPNKNIIMGYDQEDAQEFFQSILSELEKNVKSI-SPI 251

Query: 199 EKLDKKPIPESDLPSNALIGQNNLSHVGTVYIPTAHLDPNSLLDKDPSTNYFTPFRLVTP 258
           EK D KP+PES+LP  ALIGQN+L  VGTV+IPT  +DPNS+L+   S+ Y+TPFR++TP
Sbjct: 252 EK-DVKPVPESELPDGALIGQNDLGSVGTVFIPTEQIDPNSILENKDSSKYYTPFRMITP 310

Query: 259 LDGIVAERIGCLNCGETGGIRYSVSSGLSLNLPSENI-GDTLKLSQLLNEWCKPEIIEGV 317
           LDGI AERIGCL CGE GGIRYS+SS LSLNLP+ENI    LKLS L+ EW KPEIIEGV
Sbjct: 311 LDGITAERIGCLTCGENGGIRYSISSSLSLNLPNENINSQALKLSNLMQEWIKPEIIEGV 370

Query: 318 NCYRCSLNAVLEHLENQLKTMSEKPKGSIPDKLISAIKTRIKALNETLSKPVIDDEEYKK 377
            C RC+LNAVLEHL++QLK + EK  GSIP+KLISA++ RI  L++TLSKPVIDDE+YKK
Sbjct: 371 ECNRCALNAVLEHLQDQLKQLQEKSTGSIPEKLISAVEERISILSKTLSKPVIDDEDYKK 430

Query: 378 MHTDNMVRKSSKSKQIILARPPPLLSIHINRSVFDTRTFMIKKNNSRLAFKARLNLKPWC 437
            HT+NMVRK SKSKQI+++RPPPLLSIHINRSVFD  T+ I+KNNSR+ FK+R NL+PWC
Sbjct: 431 YHTENMVRKCSKSKQILISRPPPLLSIHINRSVFDPNTYTIRKNNSRVLFKSRFNLEPWC 490

Query: 438 CDVNDINLDARLPMSKTQKXXXXXXXXXXXXTVGGEYYAKLHDKFQKEFEDSDEEQEDGM 497
           CD+++INLDARLPMSK                +GGEYYAKLH KF++EFEDSDEE     
Sbjct: 491 CDIDEINLDARLPMSKKNN---LPQESSEDENIGGEYYAKLHHKFEQEFEDSDEE---SY 544

Query: 498 SDYSDYNMRSNRDVDNYDPLNEDTEHDEIRETVSTTDSEDEYIEETDKLGNTIR 551
            + SD  +R  RDV NYDPL+ + E DE      + D   EYIEETD LGNTIR
Sbjct: 545 ENDSDMQLRG-RDVSNYDPLHGEIEEDE------SVDDGAEYIEETDGLGNTIR 591

 Score =  142 bits (357), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 70/80 (87%)

Query: 662 STKVPTGPLTYELRSVIVHYGTHNYGHYIAFRKYRGTWWRISDETVHMVDEAEVLSTPSV 721
           S+ VP  PLTY LRSVIVHYGTHNYGHYIAFR+YRG WWRISDE+V++V+EAEVLSTP V
Sbjct: 664 SSTVPASPLTYSLRSVIVHYGTHNYGHYIAFRRYRGCWWRISDESVYIVEEAEVLSTPGV 723

Query: 722 FMLFYEYDFDEKSGMMKDDL 741
           FMLFYEYD+D ++  M DD+
Sbjct: 724 FMLFYEYDYDVETKKMFDDI 743

>ZYRO0A02420g Chr1 (190417..192654) [2238 bp, 745 aa] {ON} similar
           to uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
           Ubiquitin-specific protease that removes ubiquitin from
           ubiquitinated proteins cleaves at the C terminus of
           ubiquitin fusions irrespective of their size capable of
           cleaving polyubiquitin chains
          Length = 745

 Score =  560 bits (1443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/552 (51%), Positives = 373/552 (67%), Gaps = 38/552 (6%)

Query: 10  SGYRKWVTKNNLQIQNTVMKRGGFVGGLVNEGNTCFMNSVLQSLASSHEIVRFLDXXXXX 69
           SG+R+W+ ++  Q++N V+KRGG +GGLVN+GNTCFMN VLQS+ASS E+++FLD     
Sbjct: 61  SGFRRWMPRSG-QMENEVLKRGGNIGGLVNDGNTCFMNCVLQSMASSKELLKFLDEEIAC 119

Query: 70  XXXXXXXXXXXXXXXXSDSAHNHHNHQQDDXXXXXXXXXXXXXXLTKTNDDDMSTDVSFS 129
                           ++  HN    QQ                    ++ +   DV+FS
Sbjct: 120 KAKLDEDQSNGDDVN-NEKPHNTSKQQQKREEEAK-------------SEGETVPDVTFS 165

Query: 130 ISXXXXXXXXXXXYYRERKYYRTNNLLKTMSKAPNKNIILGYEQEDAQEFFQTILYELEK 189
            +           YYR+R Y++ N LLK+MSKAPNKNI+LGY+QEDAQEFFQT+L ELEK
Sbjct: 166 AALKELLDKLNAKYYRDRPYFKANKLLKSMSKAPNKNILLGYDQEDAQEFFQTMLSELEK 225

Query: 190 NIKFLDSDREKLDKKPIPESDLPSNALIGQNNLSHVGTVYIPTAHLDPNSLLDKDPSTNY 249
           N K LD+    +DK  I E DLP  A+IGQ  L HVG VYIPT  + PN L+       Y
Sbjct: 226 NAKSLDNT--TIDKHAILEKDLPETAVIGQARLDHVGAVYIPTEQVTPN-LIPPGSKEKY 282

Query: 250 FTPFRLVTPLDGIVAERIGCLNCGETGGIRYSVSSGLSLNLPSENIGDTLKLSQLLNEWC 309
           FT F+L+TPLDGI+AERIGCL CGETGGIRYSVSSGLSLNLPS+N+G +LKLS LL ++ 
Sbjct: 283 FTKFKLITPLDGILAERIGCLQCGETGGIRYSVSSGLSLNLPSDNMGSSLKLSDLLKDYI 342

Query: 310 KPEIIEGVNCYRCSLNAVLEHLENQLKTMSEKPKGSIPDKLISAIKTRIKALNETLSKPV 369
           KPEIIEGV C RC+L AV +HL+ QL+   +K   +IP KL  A ++RI+ L + LSKPV
Sbjct: 343 KPEIIEGVECNRCALIAVRDHLKEQLQQYEDKKANAIPAKLCQAFQSRIQELEKVLSKPV 402

Query: 370 IDDEEYKKMHTDNMVRKSSKSKQIILARPPPLLSIHINRSVFDTRTFMIKKNNSRLAFKA 429
           IDDEEYKK+HT+NMVRKSSKSKQ++++RPPPLL+IHINRSVFD RTFMI+KNN+R+ FK+
Sbjct: 403 IDDEEYKKLHTENMVRKSSKSKQVLISRPPPLLAIHINRSVFDPRTFMIRKNNARVLFKS 462

Query: 430 RLNLKPWCCDVNDINLDARLPMSKTQKXXXXXXXXXXXXTVGGEYYAKLHDKFQKEFEDS 489
           RLNL PWCCD+++IN+DAR+PMS+ ++             VGGE+Y KLH K+++EFEDS
Sbjct: 463 RLNLSPWCCDIDEINMDARMPMSQKEE---VIMDSSEDENVGGEFYTKLHQKYEREFEDS 519

Query: 490 DEEQEDGMSDYSDYNMRSNRDVDNYDPLNEDTEHDEIRETVSTTDSEDE-----YIEETD 544
           DE+ +  +    D      + V NYDPL  D        ++S+   E+E     YIE+TD
Sbjct: 520 DEDSDQPIGSSDD------KLVSNYDPLGGDG------NSLSSYSDEEESNESDYIEKTD 567

Query: 545 KLGNTIRIPKSK 556
            LGNTIR P+++
Sbjct: 568 ALGNTIREPRAR 579

 Score =  142 bits (357), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 59/76 (77%), Positives = 66/76 (86%)

Query: 665 VPTGPLTYELRSVIVHYGTHNYGHYIAFRKYRGTWWRISDETVHMVDEAEVLSTPSVFML 724
           VP  PLTY LRSV+VHYGTHNYGHYIAFR+YRG WWRISDETV++VDE EVLSTP VFML
Sbjct: 647 VPATPLTYSLRSVVVHYGTHNYGHYIAFRRYRGYWWRISDETVYIVDETEVLSTPGVFML 706

Query: 725 FYEYDFDEKSGMMKDD 740
           FYEYD+DE +G  K +
Sbjct: 707 FYEYDYDESTGQTKQE 722

>Smik_4.115 Chr4 (219167..221539) [2373 bp, 790 aa] {ON} YDL122W
           (REAL)
          Length = 790

 Score =  561 bits (1446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/546 (53%), Positives = 382/546 (69%), Gaps = 21/546 (3%)

Query: 14  KWVTKNNL-QIQNTVMKRGGFVGGLVNEGNTCFMNSVLQSLASSHEIVRFLDXXXXXXXX 72
           +W+ ++    +   ++KRGGF+ GLVN+GNTCFMNSVLQSLASS E++ FLD        
Sbjct: 79  RWLPRSKFTHLDEEILKRGGFIAGLVNDGNTCFMNSVLQSLASSKELMEFLDNNVIKTYE 138

Query: 73  XXXXXXXXXXXXXSDSAHNHHNHQQDDXXXXXXXXXXXXXXLTKTND-----DDMSTDVS 127
                         +     +N++++                 K +      ++   D++
Sbjct: 139 EMEQNEHNKEESEHEPEQGEYNNKKNSNRSGKVYGKHKKKLNRKLSSKEEERENQEPDIT 198

Query: 128 FSISXXXXXXXXXXXYYRERKYYRTNNLLKTMSKAPNKNIILGYEQEDAQEFFQTILYEL 187
           FS +           YYR++ Y++TN+LLK+MSK+P KNI+LGY+QEDAQEFFQ IL EL
Sbjct: 199 FSTALRDLLAALNDKYYRDKPYFKTNSLLKSMSKSPRKNILLGYDQEDAQEFFQNILAEL 258

Query: 188 EKNIKFLDSDREKLDKKPIPESDLPSNALIGQNNLSHVGTVYIPTAHLDPNSLLDKDPST 247
           E N+K L++  EKLD  PI +S+LP +AL+GQ NL  VGTVYIPT  +DPNS+L  D S 
Sbjct: 259 ESNVKSLNT--EKLDSTPIAKSNLPEDALVGQQNLGEVGTVYIPTEQIDPNSIL-HDKSI 315

Query: 248 NYFTPFRLVTPLDGIVAERIGCLNCGETGGIRYSVSSGLSLNLPSENIGDTLKLSQLLNE 307
              TPFRL+TPLDGI AERIGCL CGE GGIRYSV SGLSLNLP+ENIG TLKLSQLL++
Sbjct: 316 QNLTPFRLMTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPNENIGSTLKLSQLLSD 375

Query: 308 WCKPEIIEGVNCYRCSLNAVLEHLENQLKTMSEKPKGSIPDKLISAIKTRIKALNETLSK 367
           W KPEIIEGV C RC+L A   HL  QL    +KP+GSIP+KL++A+K R++ + E L+K
Sbjct: 376 WSKPEIIEGVECNRCALTAAHSHLMEQLDQFQKKPEGSIPEKLMNAVKDRVQQIQEVLAK 435

Query: 368 PVIDDEEYKKMHTDNMVRKSSKSKQIILARPPPLLSIHINRSVFDTRTFMIKKNNSRLAF 427
           PVIDDE+YKK+HT NMVRK SKSKQI+++RPPPLLSIHINRSVFD RT+MI+KNNS++ F
Sbjct: 436 PVIDDEDYKKLHTANMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYMIRKNNSKVLF 495

Query: 428 KARLNLKPWCCDVNDINLDARLPMSKTQKXXXXXXXXXXXXTVGGEYYAKLHDKFQKEFE 487
           K+RLNL PWCCD+++INLDARLPMSK +K             +GGEYY KLH++F++EFE
Sbjct: 496 KSRLNLAPWCCDIDEINLDARLPMSKKEK--TVQQDSSEDENIGGEYYTKLHERFEQEFE 553

Query: 488 DSDEEQE--DGMSDYSDYNMRSNRDVDNYDPLNEDTEHDEIRETVSTTDSEDEYIEETDK 545
           DS+EE++  DG  +Y+ +   S ++ +NYDPLN   E D++     T+D EDE+IEETD 
Sbjct: 554 DSEEERDYNDGEENYTSHYSHS-KNNNNYDPLN--GEADDL-----TSDDEDEHIEETDA 605

Query: 546 LGNTIR 551
           LGNTIR
Sbjct: 606 LGNTIR 611

 Score =  154 bits (389), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 68/82 (82%), Positives = 75/82 (91%), Gaps = 1/82 (1%)

Query: 660 TYSTKVPTGPLTYELRSVIVHYGTHNYGHYIAFRKYRGTWWRISDETVHMVDEAEVLSTP 719
           ++ST VP  PLTY LRSVIVHYGTHNYGHYIAFRKYRG WWRISDETV++VDEAEVLSTP
Sbjct: 671 SFST-VPATPLTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVDEAEVLSTP 729

Query: 720 SVFMLFYEYDFDEKSGMMKDDL 741
            VFMLFYEYD+DE++G MKDDL
Sbjct: 730 GVFMLFYEYDYDEETGQMKDDL 751

>TDEL0G02370 Chr7 (456393..458636) [2244 bp, 747 aa] {ON} Anc_2.307
           YDL122W
          Length = 747

 Score =  552 bits (1422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/550 (51%), Positives = 365/550 (66%), Gaps = 25/550 (4%)

Query: 7   NDPSGYRKWVTKNNLQIQNTVMKRGGFVGGLVNEGNTCFMNSVLQSLASSHEIVRFLDXX 66
           N  +G+R+W+ +   Q+    + +GG+V GLVN+GNTCFMNSV+QSLASS E+++FLD  
Sbjct: 65  NPTNGFRRWMPRGG-QVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFLDDE 123

Query: 67  XXXXXXXXXXXXXXXXXXXSDSAHNHHNHQQDDXXXXXXXXXXXXXXLTKTNDDDMSTDV 126
                              +    +    +                     +D++ + DV
Sbjct: 124 IAKKEEIDETELLQDEEKPTSVEPDTIERKVKGKSYGKAKKHANRKLANGVSDEEKTPDV 183

Query: 127 SFSISXXXXXXXXXXXYYRERKYYRTNNLLKTMSKAPNKNIILGYEQEDAQEFFQTILYE 186
           +FS++           YY+ER  ++TN LLK+M+K+PNKNIILGY+QEDAQEFFQTIL E
Sbjct: 184 TFSLALREMLNKLNTKYYKERPCFKTNKLLKSMTKSPNKNIILGYDQEDAQEFFQTILSE 243

Query: 187 LEKNIKFLDSDREKLDKKPIPESDLPSNALIGQNNLSHVGTVYIPTAHLDPNSLLDKDPS 246
           LEKN+K L+   +  +  PIP ++LP NA+IGQ +L  VG VY+P+  +DPN +L  +  
Sbjct: 244 LEKNVKSLEG--KPSEATPIPNAELPKNAVIGQAHLDKVGDVYLPSDQIDPNLVLTNE-G 300

Query: 247 TNYFTPFRLVTPLDGIVAERIGCLNCGETGGIRYSVSSGLSLNLPSENIGDTLKLSQLLN 306
              +TPFRLVTPLDGI AERIGCL CGE GGIRYSV+S +SLNLPSE+IG TLKLS LLN
Sbjct: 301 KQLYTPFRLVTPLDGITAERIGCLQCGENGGIRYSVTSSMSLNLPSEDIGSTLKLSDLLN 360

Query: 307 EWCKPEIIEGVNCYRCSLNAVLEHLENQLKTMSEKPKGSIPDKLISAIKTRIKALNETLS 366
           +W KPEIIEGV+C RC+L AV +HL  QLK    K   SIP+KL+ A K R++ LN +LS
Sbjct: 361 QWIKPEIIEGVSCNRCALEAVRDHLLEQLKQYENK-GDSIPEKLLQAFKARVEELNVSLS 419

Query: 367 KPVIDDEEYKKMHTDNMVRKSSKSKQIILARPPPLLSIHINRSVFDTRTFMIKKNNSRLA 426
           KP++ DE+YK++HT+NM RK SKSKQI+  RPPPLLSIHINRSVFD RT+MI+KNNSR+ 
Sbjct: 420 KPMVSDEDYKRLHTENMTRKCSKSKQILFLRPPPLLSIHINRSVFDPRTYMIRKNNSRVL 479

Query: 427 FKARLNLKPWCCDVNDINLDARLPMSKTQKXXXXXXXXXXXXTVGGEYYAKLHDKFQKEF 486
           FK+RLNL PWCCDV++INLDARLPMSK Q+             +GGEYYAKLH  ++KEF
Sbjct: 480 FKSRLNLSPWCCDVDEINLDARLPMSKKQE---QVQESSEDENLGGEYYAKLHQTYEKEF 536

Query: 487 EDSDEEQEDGMSDYSDYNMRSNRDVDNYDPLNEDTEHDEIRETVSTTDSED------EYI 540
           EDSDEE E       D +   NRDV  YDPLN      EI    S +D+ED      E++
Sbjct: 537 EDSDEEVE------QDGDRYVNRDVSEYDPLN-----GEIDSVSSYSDNEDAHHSSEEFL 585

Query: 541 EETDKLGNTI 550
           EE D LGNT+
Sbjct: 586 EEVDALGNTV 595

 Score =  149 bits (377), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 67/84 (79%), Positives = 74/84 (88%), Gaps = 1/84 (1%)

Query: 658 APTYSTKVPTGPLTYELRSVIVHYGTHNYGHYIAFRKYRGTWWRISDETVHMVDEAEVLS 717
           AP  ST VP GPLTY LRSVIVHYGTHNYGHYIAFRKYRG WWRISDETV++V+EAEVLS
Sbjct: 645 APIPST-VPAGPLTYVLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVEEAEVLS 703

Query: 718 TPSVFMLFYEYDFDEKSGMMKDDL 741
           T  VFMLFYEYD+DE +G M++DL
Sbjct: 704 TSGVFMLFYEYDYDEATGKMREDL 727

>Skud_4.133 Chr4 (238225..240588) [2364 bp, 787 aa] {ON} YDL122W
           (REAL)
          Length = 787

 Score =  553 bits (1425), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/550 (53%), Positives = 373/550 (67%), Gaps = 29/550 (5%)

Query: 14  KWVTKNNL-QIQNTVMKRGGFVGGLVNEGNTCFMNSVLQSLASSHEIVRFLDXXXXXXXX 72
           +W+ ++    +   ++KRGGF+ GLVN+GNTCFMNSVLQSLASS E++ FLD        
Sbjct: 79  RWLPRSKFTHLDEEILKRGGFIAGLVNDGNTCFMNSVLQSLASSRELMDFLDNNVIKTYE 138

Query: 73  XXXXXXXXXXXXXSDSAHNHHNHQQDDXXXXXXXXXXXXXXLTKTNDD-----DMSTDVS 127
                        ++   +  NH+                   K +       +   D++
Sbjct: 139 DIERSEQNKENNGNEREQDEDNHKTKSSRSGKVYGKHRKKLNRKLSSKEEEEENQEPDIT 198

Query: 128 FSISXXXXXXXXXXXYYRERKYYRTNNLLKTMSKAPNKNIILGYEQEDAQEFFQTILYEL 187
           FS++           YYR++ Y++TN LLK MSK+P KNI+LGY+QEDAQEFFQ IL EL
Sbjct: 199 FSVTLKDLLAALNDKYYRDKPYFKTNRLLKAMSKSPRKNILLGYDQEDAQEFFQNILAEL 258

Query: 188 EKNIKFLDSDREKLDKKPIPESDLPSNALIGQNNLSHVGTVYIPTAHLDPNSLLDKDPST 247
           E N+K L+S  E LD  P  +SDLP +AL+GQ +L  VGTVYIPT  +DPNS+L  D S 
Sbjct: 259 ESNVKSLNS--ETLDTTPTAKSDLPDDALVGQRDLDRVGTVYIPTEQIDPNSIL-HDKSI 315

Query: 248 NYFTPFRLVTPLDGIVAERIGCLNCGETGGIRYSVSSGLSLNLPSENIGDTLKLSQLLNE 307
             FTP++L+TPLDGI AERIGCL CGE GGIRYSV SGLSLNLP+ENIG TLKLSQLL++
Sbjct: 316 KNFTPYKLMTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPNENIGSTLKLSQLLSD 375

Query: 308 WCKPEIIEGVNCYRCSLNAVLEHLENQLKTMSEKPKGSIPDKLISAIKTRIKALNETLSK 367
           W KPEIIEGV C RC+L A   HL  QLK   +KP GSIP+KLI+A+K R+  + + L+K
Sbjct: 376 WSKPEIIEGVECNRCALTAAHSHLLGQLKQFEKKPDGSIPEKLINAVKERVHQIEQVLAK 435

Query: 368 PVIDDEEYKKMHTDNMVRKSSKSKQIILARPPPLLSIHINRSVFDTRTFMIKKNNSRLAF 427
           PVIDD++YKK+HT NMVRK SKSKQI+++RPPPLLSIHINRSVFD RT+ I+KNNS++ F
Sbjct: 436 PVIDDDDYKKLHTANMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYTIRKNNSKVLF 495

Query: 428 KARLNLKPWCCDVNDINLDARLPMSKTQKXXXXXXXXXXXXTVGGEYYAKLHDKFQKEFE 487
           K+RLNL PWCCD+++INLDARLPMSK +K             +GGEYY KLH++F++EFE
Sbjct: 496 KSRLNLSPWCCDIDEINLDARLPMSKKEK--VVQQESSEDENIGGEYYTKLHERFEQEFE 553

Query: 488 DS------DEEQEDGMSDYSDYNMRSNRDVDNYDPLNEDTEHDEIRETVSTTDSEDEYIE 541
           DS      ++E+E+  S Y+     SN+   NYDPL +  E D++     T+D EDEYIE
Sbjct: 554 DSEEEREYNDEKENYASHYA-----SNKGNSNYDPLKD--EADDL-----TSDDEDEYIE 601

Query: 542 ETDKLGNTIR 551
           ETD LGNTIR
Sbjct: 602 ETDALGNTIR 611

 Score =  152 bits (384), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 68/84 (80%), Positives = 76/84 (90%), Gaps = 1/84 (1%)

Query: 658 APTYSTKVPTGPLTYELRSVIVHYGTHNYGHYIAFRKYRGTWWRISDETVHMVDEAEVLS 717
           A ++ST VP  PLTY LRSVIVHYGTHNYGHYIAFRKYRG WWRISDETV++VDEAEVLS
Sbjct: 670 ARSFST-VPATPLTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVDEAEVLS 728

Query: 718 TPSVFMLFYEYDFDEKSGMMKDDL 741
           TP VFMLFYEYD+D+++G MKDDL
Sbjct: 729 TPGVFMLFYEYDYDKETGEMKDDL 752

>SAKL0E07106g Chr5 complement(584164..586539) [2376 bp, 791 aa] {ON}
           similar to uniprot|P25037 Saccharomyces cerevisiae
           YDL122W UBP1 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions irrespective of their size
           capable of cleaving polyubiquitin chains
          Length = 791

 Score =  552 bits (1423), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/572 (51%), Positives = 374/572 (65%), Gaps = 36/572 (6%)

Query: 15  WVTKNNLQIQNTVMKRGGFVGGLVNEGNTCFMNSVLQSLASSHEIVRFLDXXXXXXXXXX 74
           W  + + Q +  V+K+GG+VGGLVN+GNTCFMNSVLQSLASS +++ FLD          
Sbjct: 81  WGQRRSEQ-EERVLKKGGYVGGLVNDGNTCFMNSVLQSLASSQQLLEFLDEEIVERSQDD 139

Query: 75  XXXXXXXXXXXSDSAHNHHN------HQQDDXXXXXXXXXXXXXXLTKTNDDDMST---- 124
                        SA N           +++                +T D +       
Sbjct: 140 EEPEEFEVEGGRRSADNADGLDGGLEKMEEESKPKVKGKSYGKRKKKQTRDAEARVLSEK 199

Query: 125 -------DVSFSISXXXXXXXXXXXYYRERKYYRTNNLLKTMSKAPNKNIILGYEQEDAQ 177
                  DV FSI+           +Y ER Y++TN LLKTMSKAPNKNIILGY+QEDAQ
Sbjct: 200 AEEEEEADVQFSITLKELFDKLNAKHYSERPYFKTNRLLKTMSKAPNKNIILGYDQEDAQ 259

Query: 178 EFFQTILYELEKNIKFLDSDREKLDKKPIPESDLPSNALIGQNNLSHVGTVYIPTAHLDP 237
           EFFQTIL ELEKN+K + + ++K  K PIPE++LP++ALIGQ +L  +GTVYIPT  +DP
Sbjct: 260 EFFQTILSELEKNVKSIKT-KKKESKTPIPETELPADALIGQQHLDKIGTVYIPTEQIDP 318

Query: 238 NSLLDKDPSTNYFTPFRLVTPLDGIVAERIGCLNCGETGGIRYSVSSGLSLNLPSENIGD 297
           N++L+      Y TPF+ VTPLDGI AERIGCLNCGE GGIRYSV SGLSLNLPSENIG 
Sbjct: 319 NTVLNNSELKTY-TPFQQVTPLDGITAERIGCLNCGENGGIRYSVFSGLSLNLPSENIGS 377

Query: 298 TLKLSQLLNEWCKPEIIEGVNCYRCSLNAVLEHLENQLKTMSEKPKGSIPDKLISAIKTR 357
           TLKLS L+NEW KPEIIEGV C RC+LNAV +HL+  L +  +   G+IP+KL++A++ R
Sbjct: 378 TLKLSGLMNEWAKPEIIEGVECNRCALNAVRDHLQQSLSSYEQA--GNIPEKLVAAVQKR 435

Query: 358 IKALNETLSKPVIDDEEYKKMHTDNMVRKSSKSKQIILARPPPLLSIHINRSVFDTRTFM 417
           +  LNE L+KPVIDDE+YKK+HT NMVRK SKSKQI+++RPPPLLS+HINRSVFD RTF 
Sbjct: 436 LNLLNEILNKPVIDDEDYKKLHTVNMVRKCSKSKQILISRPPPLLSVHINRSVFDPRTFS 495

Query: 418 IKKNNSRLAFKARLNLKPWCCDVNDINLDARLPMSKTQKXXXXXXXXXXXXTVGGEYYAK 477
           I+KNNSR+ FK R NL PWCC++++INLDARLPMSK Q+             +GGEY+AK
Sbjct: 496 IRKNNSRVLFKPRFNLAPWCCNIDEINLDARLPMSKKQE---APQESSEDEAIGGEYFAK 552

Query: 478 LHDKFQKEFEDSDEEQEDGMSDYSDYNMRSNRDVDNYDPLNEDTEHDEIRETVSTTDSED 537
           LH KFQ+EFEDSD E ++G   Y  YN    RDV +YDPL  +       E     +   
Sbjct: 553 LHRKFQEEFEDSDSEDDEGRDTY--YN---KRDVSDYDPLKGEILTSS--EDEEELEDGG 605

Query: 538 EYIEETDKLGNTI----RIPKSKESENHHHIK 565
           E + E D LGN I     + +++E EN + +K
Sbjct: 606 EDVVEVDSLGNIIPKQKPVQETQEDENGYAVK 637

 Score =  150 bits (379), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 72/80 (90%)

Query: 662 STKVPTGPLTYELRSVIVHYGTHNYGHYIAFRKYRGTWWRISDETVHMVDEAEVLSTPSV 721
           S  VP  PLTY LRSVIVHYGTHNYGHYIAFRK+RG WWRISDETV++VDEAEVLSTP V
Sbjct: 698 SYTVPACPLTYSLRSVIVHYGTHNYGHYIAFRKHRGFWWRISDETVYIVDEAEVLSTPGV 757

Query: 722 FMLFYEYDFDEKSGMMKDDL 741
           FMLFYEYD+DE++G +KDDL
Sbjct: 758 FMLFYEYDYDEQTGKLKDDL 777

>Kpol_1003.53 s1003 (121699..124065) [2367 bp, 788 aa] {ON}
           (121699..124065) [2367 nt, 789 aa]
          Length = 788

 Score =  532 bits (1371), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 273/436 (62%), Positives = 333/436 (76%), Gaps = 17/436 (3%)

Query: 116 KTNDDDMSTDVSFSISXXXXXXXXXXXYYRERKYYRTNNLLKTMSKAPNKNIILGYEQED 175
           K ++++   +V+FS++           YYRER Y++TN LL+TMSKAPNKNIILGY+QED
Sbjct: 188 KKDENEQERNVTFSLTFKELLDKLNFKYYRERHYFKTNKLLRTMSKAPNKNIILGYDQED 247

Query: 176 AQEFFQTILYELEKNIKFLDSDREKLDKKPIPESDLPSNALIGQNNLSHVGTVYIPTAHL 235
           AQEFFQ+IL ELEKN+K L  +  K  ++P+PES+LP NALIGQN L  VGTVYIPT  +
Sbjct: 248 AQEFFQSILLELEKNVKSLGDETNK--QEPVPESELPENALIGQNKLGEVGTVYIPTDQI 305

Query: 236 DPNSLLDKDPSTNYFTPFRLVTPLDGIVAERIGCLNCGETGGIRYSVSSGLSLNLPSENI 295
           DPNS+L+ D ST ++TPF++VTPLDGI AERIGCL CGE GGIRYS+SSG+SLNLP+ENI
Sbjct: 306 DPNSILNSDNSTKFYTPFKMVTPLDGITAERIGCLQCGENGGIRYSISSGISLNLPAENI 365

Query: 296 GDTLKLSQLLNEWCKPEIIEGVNCYRCSLNAVLEHLENQLKTMSEKPKGSIPDKLISAIK 355
           G  LKLSQLL EW KPEIIEGV C RC+LNAV EHL +QLK    K  G+IPDKLI AI 
Sbjct: 366 GSNLKLSQLLKEWIKPEIIEGVECNRCALNAVREHLTDQLKQFEAKESGAIPDKLIKAIS 425

Query: 356 TRIKALNETLSKPVIDDEEYKKMHTDNMVRKSSKSKQIILARPPPLLSIHINRSVFDTRT 415
            RI+ L +TLSKPVIDD++YK+MHT+NMVR+ SKSKQI+++RPPPLLSIHINRSVFD RT
Sbjct: 426 ERIEKLEQTLSKPVIDDDDYKEMHTENMVRRCSKSKQILISRPPPLLSIHINRSVFDPRT 485

Query: 416 FMIKKNNSRLAFKARLNLKPWCCDVNDINLDARLPMSKTQKXXXXXXXXXXXXTVGGEYY 475
           +MI+KNNSR+ FK+RLNL PWCC++++INLDARLPMSK Q+             VGGEYY
Sbjct: 486 YMIRKNNSRVLFKSRLNLAPWCCNIDEINLDARLPMSKKQE---FASESSEDENVGGEYY 542

Query: 476 AKLHDKFQKEFEDSDEEQEDGMSDYSDYNMRSNRDVDNYDPLNEDTEHDEIRETVSTTDS 535
           AKLH +F++EFEDSDEE E G  +Y+D      RDV +YDPLN +          +    
Sbjct: 543 AKLHQRFEQEFEDSDEEDEYGEEEYAD------RDVKDYDPLNGEF------SEDNDDGD 590

Query: 536 EDEYIEETDKLGNTIR 551
           E+EYIEE D LGNTIR
Sbjct: 591 EEEYIEEQDALGNTIR 606

 Score =  158 bits (400), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 75/83 (90%), Gaps = 1/83 (1%)

Query: 658 APTYSTKVPTGPLTYELRSVIVHYGTHNYGHYIAFRKYRGTWWRISDETVHMVDEAEVLS 717
           AP+ ST VP GPLTY LRSVIVHYGTHNYGHYIAFRKYRG WWRISDE+V +VDEAEVLS
Sbjct: 674 APSAST-VPVGPLTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDESVTIVDEAEVLS 732

Query: 718 TPSVFMLFYEYDFDEKSGMMKDD 740
           TP VFMLFYEYDFDE++GMM DD
Sbjct: 733 TPGVFMLFYEYDFDEETGMMGDD 755

 Score = 78.6 bits (192), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 34/62 (54%), Positives = 47/62 (75%)

Query: 3   ISCSNDPSGYRKWVTKNNLQIQNTVMKRGGFVGGLVNEGNTCFMNSVLQSLASSHEIVRF 62
           +S   + S +R+++  NN Q++  ++ RGGFV GLVN+GNTCFMNSVLQSLASS  ++ F
Sbjct: 57  LSAFGNNSTFRRFLPGNNSQLEEKILNRGGFVAGLVNDGNTCFMNSVLQSLASSKTLLEF 116

Query: 63  LD 64
           LD
Sbjct: 117 LD 118

>NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa]
           {ON} Anc_2.307 YDL122W
          Length = 770

 Score =  520 bits (1339), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 263/472 (55%), Positives = 327/472 (69%), Gaps = 37/472 (7%)

Query: 12  YRKWVTKNNLQIQNTVMKRGGFVGGLVNEGNTCFMNSVLQSLASSHEIVRFLDXXXXXXX 71
           +R+W+ +    I + ++K+GGFVGGLVN+GNTCFMNSVLQSLASS E+  FLD       
Sbjct: 69  FRRWIPRAG-NIDDKILKKGGFVGGLVNDGNTCFMNSVLQSLASSKELNAFLD------- 120

Query: 72  XXXXXXXXXXXXXXSDSAHNHHNHQQDDXXXXXXXXXXXXXXLTKTNDDDMSTDVSFSIS 131
                          DS       Q++                 K  +++   DV FS++
Sbjct: 121 ---------------DSIIKKFQEQEE-------KIQNEEDPNEKEEEEEKDVDVRFSVA 158

Query: 132 XXXXXXXXXXXYYRERKYYRTNNLLKTMSKAPNKNIILGYEQEDAQEFFQTILYELEKNI 191
                      YYR++ Y+RTN LLKTMS APNKN++LGY+QEDAQEFFQ IL ELEKN+
Sbjct: 159 FKELLDKLNSKYYRDKPYFRTNKLLKTMSNAPNKNMLLGYDQEDAQEFFQNILSELEKNV 218

Query: 192 KFLDSDREKLDKKPIPESDLPSNALIGQNNLSHVGTVYIPTAHLDPNSLLDKDPS-TNYF 250
           K LD   +K D  PIPE++LP +A+IGQ NL  VGTV++PT  ++PNS+L+ D + T ++
Sbjct: 219 KSLDP--KKFDNTPIPENELPDDAIIGQANLGDVGTVFLPTEQIEPNSVLNNDENDTKFY 276

Query: 251 TPFRLVTPLDGIVAERIGCLNCGETGGIRYSVSSGLSLNLPSENIGDTLKLSQLLNEWCK 310
           TPF+L+TPLDGI AERIGCL CGE GGIRYSV SGLSLNLP ENIG TLKL+ LL EW K
Sbjct: 277 TPFKLITPLDGISAERIGCLQCGENGGIRYSVFSGLSLNLPGENIGSTLKLTGLLKEWIK 336

Query: 311 PEIIEGVNCYRCSLNAVLEHLENQLKTMSEKPKGSIPDKLISAIKTRIKALNETLSKPVI 370
           PEIIEGV CYRC L A+  HL  QL+   E   G IP+KL+ A+  RIK L   L+KPVI
Sbjct: 337 PEIIEGVECYRCGLEAIRSHLLEQLEQYRESNSG-IPEKLLVAVSDRIKVLESILAKPVI 395

Query: 371 DDEEYKKMHTDNMVRKSSKSKQIILARPPPLLSIHINRSVFDTRTFMIKKNNSRLAFKAR 430
           +DE+YKK+HT+NMVRK SKSKQII++RPPPLLSIHINRSVFD RT+ I+KNNSR+ FK+R
Sbjct: 396 EDEDYKKLHTENMVRKCSKSKQIIISRPPPLLSIHINRSVFDPRTYQIRKNNSRVLFKSR 455

Query: 431 LNLKPWCCDVNDINLDARLPMSKTQKXXXXXXXXXXXXTVGGEYYAKLHDKF 482
           LNL+PWCC+ ++INLDARLPMSK ++             +GGEYYAKLH KF
Sbjct: 456 LNLEPWCCNSSEINLDARLPMSKKEQ---FAQESSEDENIGGEYYAKLHQKF 504

 Score =  152 bits (384), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 64/77 (83%), Positives = 70/77 (90%)

Query: 665 VPTGPLTYELRSVIVHYGTHNYGHYIAFRKYRGTWWRISDETVHMVDEAEVLSTPSVFML 724
            P GPLTY LRSVIVHYGTHNYGHYIAFRK+RG WWRISDETV++VDEAEVLSTP VFML
Sbjct: 637 APAGPLTYSLRSVIVHYGTHNYGHYIAFRKFRGCWWRISDETVYIVDEAEVLSTPGVFML 696

Query: 725 FYEYDFDEKSGMMKDDL 741
           FYEYD+DE +G +KDDL
Sbjct: 697 FYEYDYDEATGKLKDDL 713

>CAGL0H10582g Chr8 complement(1029876..1032248) [2373 bp, 790 aa]
           {ON} similar to uniprot|P25037 Saccharomyces cerevisiae
           YDL122w UBP1 ubiquitin-specific protease
          Length = 790

 Score =  517 bits (1331), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 273/534 (51%), Positives = 355/534 (66%), Gaps = 17/534 (3%)

Query: 23  IQNTVMKRGGFVGGLVNEGNTCFMNSVLQSLASSHEIVRFLDXXXXXXXXXXXXXXXXXX 82
           I   +++RGG+VGGL+N+GN CFMNSV+QSLASS E+++FLD                  
Sbjct: 84  IDEQILQRGGYVGGLLNDGNFCFMNSVIQSLASSKELLKFLDDEIIGRYESLEKDLVADE 143

Query: 83  XXXSDSAHNHHNHQQDDXXXXXXXXXXXXXXLTKTNDDDMSTDVSFSISXXXXXXXXXXX 142
              S+S   +   Q+                     D+D   D+ F+I+           
Sbjct: 144 DSVSESNEQNGKKQKASNGKVYGKSKKKHNRSVDNGDNDTEPDIQFTIAFKELLDKLNYK 203

Query: 143 YYRERKYYRTNNLLKTMSKAPNKNIILGYEQEDAQEFFQTILYELEKNIKFLDSDREKLD 202
           YY+ER Y++TN+++  MS +P K++++ Y+QEDAQEFFQTIL ELEKNIK L+S ++  D
Sbjct: 204 YYKERPYFKTNSMVNKMSNSPKKSMLMAYDQEDAQEFFQTILSELEKNIKTLESRKD--D 261

Query: 203 KKPIPESDLPSNALIGQNNLSHVGTVYIPTAHLDPNSLLDKDPSTNYFTPFRLVTPLDGI 262
           K P+P  +L  + +IGQ +L  +GTVYIP+  +DPNS  +     + FTPF+LVTPLDGI
Sbjct: 262 KTPVPAKNLSEDDMIGQAHLGRMGTVYIPSEQIDPNSYTEGSTEKS-FTPFKLVTPLDGI 320

Query: 263 VAERIGCLNCGETGGIRYSVSSGLSLNLPSENIGDTLKLSQLLNEWCKPEIIEGVNCYRC 322
            AERIGCL CGE GGIRYSV SGLSLNLPSENIG TLKLS LLNEW KPEIIEGV C RC
Sbjct: 321 TAERIGCLQCGENGGIRYSVFSGLSLNLPSENIGSTLKLSSLLNEWIKPEIIEGVECNRC 380

Query: 323 SLNAVLEHLENQLKTMSEKPKGSIPDKLISAIKTRIKALNETLSKPVIDDEEYKKMHTDN 382
           +L AV EHL +Q+K +      + P KL+ A++TR+  L ETL KPVIDD++YKK+HT+N
Sbjct: 381 ALEAVREHLLSQMKEID--GSANTPAKLVDAMRTRLAELEETLKKPVIDDDDYKKLHTEN 438

Query: 383 MVRKSSKSKQIILARPPPLLSIHINRSVFDTRTFMIKKNNSRLAFKARLNLKPWCCDVND 442
           MVRK SKSKQ++++RPP LLSIHINRSVFD RT+MI+KNNSR+ FK+R+NL+PWCCD+++
Sbjct: 439 MVRKCSKSKQVVISRPPALLSIHINRSVFDPRTYMIRKNNSRVLFKSRMNLEPWCCDIDE 498

Query: 443 INLDARLPMSKTQKXXXXXXXXXXXXTVGGEYYAKLHDKFQKEFEDSDEEQEDGMSDYSD 502
           INLDARLPMSK QK             +GG+YY+KLH KF+K FED DEE+ D   +  +
Sbjct: 499 INLDARLPMSKKQK----VVESSEDENIGGDYYSKLHQKFEKAFEDEDEEEYDDEDEEYN 554

Query: 503 YNMRSNRDVDNYDPLNEDTEHDEIRETVSTTDSEDEYIEETDKLGNTIRIPKSK 556
             +  +R+V  YDPLN +   D   E   ++D       E D LGNT  IPK K
Sbjct: 555 NGIYESRNVSEYDPLNGELSSDYSEEDEISSDE------EVDALGNT--IPKKK 600

 Score =  153 bits (386), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 67/84 (79%), Positives = 76/84 (90%), Gaps = 1/84 (1%)

Query: 658 APTYSTKVPTGPLTYELRSVIVHYGTHNYGHYIAFRKYRGTWWRISDETVHMVDEAEVLS 717
           AP YST  P+ PLTY LRSVIVHYGTHNYGHYIA+RK+RG WWRISDE+V++VDEAEVLS
Sbjct: 676 APRYSTVNPS-PLTYALRSVIVHYGTHNYGHYIAYRKFRGVWWRISDESVYVVDEAEVLS 734

Query: 718 TPSVFMLFYEYDFDEKSGMMKDDL 741
           TP VFMLFYEYD+DEK+G MKDD+
Sbjct: 735 TPGVFMLFYEYDYDEKTGRMKDDI 758

>KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa]
           {ON} Anc_2.307 YDL122W
          Length = 678

 Score =  496 bits (1278), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 269/525 (51%), Positives = 347/525 (66%), Gaps = 69/525 (13%)

Query: 28  MKRGGFVGGLVNEGNTCFMNSVLQSLASSHEIVRFLDXXXXXXXXXXXXXXXXXXXXXSD 87
           +KRGG++ GLVN+GNTCFMNSVLQSLASS E+  FLD                       
Sbjct: 51  IKRGGYIAGLVNDGNTCFMNSVLQSLASSKELAAFLDNVIE------------------- 91

Query: 88  SAHNHHNHQQDDXXXXXXXXXXXXXXLTKTNDDDMSTDVSFSISXXXXXXXXXXXYYRER 147
                                         N  + + D+ F+ +           YY+E+
Sbjct: 92  ------------------------------NGSENNGDIKFTETLRELLLILNKKYYKEK 121

Query: 148 KYYRTNNLLKTMSKAPNKNIILGYEQEDAQEFFQTILYELEKNIKFLDSDREKLDKKPIP 207
            Y++TN LLKTMS  PNKNIILGY+QEDAQEFFQ IL +LEKNIK   S  +K ++  I 
Sbjct: 122 PYFKTNKLLKTMSNGPNKNIILGYDQEDAQEFFQQILSDLEKNIK-KPSTEKKEERNNIK 180

Query: 208 ESDLPSNALIGQNNLSHVGTVYIPTAHLDPNSLLDKDPSTNYFTPFRLVTPLDGIVAERI 267
           ESDLP +AL+GQ++L++VGTVYIPT  ++PNS+L+ +P    ++PF+L+TPLDGI AERI
Sbjct: 181 ESDLPDDALLGQDDLNNVGTVYIPTEQIEPNSVLE-NPDQKLYSPFKLITPLDGITAERI 239

Query: 268 GCLNCGETGGIRYSVSSGLSLNLPSENIGD-TLKLSQLLNEWCKPEIIEGVNCYRCSLNA 326
           GCL CGE GGIRYSV SGLSLNLPSE++   TLKLS+LLNEW KPEIIEGV C RCSLNA
Sbjct: 240 GCLTCGENGGIRYSVFSGLSLNLPSESLNQSTLKLSELLNEWVKPEIIEGVECNRCSLNA 299

Query: 327 VLEHLENQLKTMSEKPKGSIPDKLISAIKTRIKALNETLSKPVIDDEEYKKMHTDNMVRK 386
           V  HL++Q++        +IP+KL  AI  R+  L E LSKPVI++++YKK HT+NMVRK
Sbjct: 300 VRSHLQDQIQN------DTIPEKLKIAINQRLNLLTEILSKPVIEEDDYKKYHTENMVRK 353

Query: 387 SSKSKQIILARPPPLLSIHINRSVFDTRTFMIKKNNSRLAFKARLNLKPWCCDVNDINLD 446
            SKSKQI+++RPPP LSIHINRSVFD RT+MI+KNN+R+ FK RLNL+ W C+V++INLD
Sbjct: 354 CSKSKQILISRPPPFLSIHINRSVFDPRTYMIRKNNARVLFKTRLNLQKWACNVDEINLD 413

Query: 447 ARLPMSKTQKXXXXXXXXXXXXTVGGEYYAKLHDKFQKEFEDSDEEQEDGMSDYSDYNMR 506
           ARLPMSK +              +GG+YYAKLH +F++E+EDS++E+ +  SD       
Sbjct: 414 ARLPMSKNEH-IVQNEESSEDENIGGDYYAKLHHRFEQEYEDSEDEENEIDSD------- 465

Query: 507 SNRDVDNYDPLNEDTEHDEIRETVSTTDSEDEYIEETDKLGNTIR 551
            +RDV NYDPLN +  +     + S  + E+E +   D LGNTIR
Sbjct: 466 DDRDVRNYDPLNGEEMNLSSEFSSSEDEQEEEEV---DALGNTIR 507

 Score =  155 bits (393), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 67/82 (81%), Positives = 72/82 (87%)

Query: 660 TYSTKVPTGPLTYELRSVIVHYGTHNYGHYIAFRKYRGTWWRISDETVHMVDEAEVLSTP 719
           TYS+ VP GPL Y LRSVIVHYGTHNYGHYIAFRKYRG WWRISDETV++VDE EVLSTP
Sbjct: 565 TYSSSVPAGPLIYSLRSVIVHYGTHNYGHYIAFRKYRGYWWRISDETVYIVDETEVLSTP 624

Query: 720 SVFMLFYEYDFDEKSGMMKDDL 741
            VFMLFYEYD+D  +G MKDDL
Sbjct: 625 GVFMLFYEYDYDSVTGRMKDDL 646

>KLTH0G10934g Chr7 (919304..921580) [2277 bp, 758 aa] {ON} similar
           to uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
           Ubiquitin-specific protease that removes ubiquitin from
           ubiquitinated proteins cleaves at the C terminus of
           ubiquitin fusions irrespective of their size capable of
           cleaving polyubiquitin chains
          Length = 758

 Score =  498 bits (1283), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 262/511 (51%), Positives = 338/511 (66%), Gaps = 18/511 (3%)

Query: 10  SGYRKWVTKNNLQIQNTVMKRGGFVGGLVNEGNTCFMNSVLQSLASSHEIVRFLDXXXXX 69
           S + KW +K+  Q +  ++KRGG+VGGLVN+GNTCFMNSVLQSLASS  +++FLD     
Sbjct: 75  SMFNKWGSKDPEQ-EAAMLKRGGYVGGLVNDGNTCFMNSVLQSLASSKTLLQFLDNEVIQ 133

Query: 70  XXXXXXXXX---XXXXXXXSDSAHNHHNHQQDDXXXXXXXXXXXXXXLTKTNDDDMSTDV 126
                              S+   +    +                      DDD   ++
Sbjct: 134 AYKEAEESEDEHVAEKEFESEKKLSESKTKPKKKVYGKRKKRLTRNAEKDALDDDQDANI 193

Query: 127 SFSISXXXXXXXXXXXYYRERKYYRTNNLLKTMSKAPNKNIILGYEQEDAQEFFQTILYE 186
            FS +           +YR+R Y++TN LLKTMSKAPNK+IILGY+QEDAQEFFQTIL E
Sbjct: 194 EFSTTLKELLNKLNAKHYRDRPYFKTNKLLKTMSKAPNKSIILGYDQEDAQEFFQTILSE 253

Query: 187 LEKNIKFLDSDREKLDKKPIPESDLPSNALIGQNNLSHVGTVYIPTAHLDPNSLLDKDPS 246
           LEKN+K L     K ++ P+    LP ++++GQ  L  +GTVYIPT  +DPN +L  + +
Sbjct: 254 LEKNVKSLYGKSSKDEEAPVQFDQLPEDSMVGQERLGEMGTVYIPTEQIDPNCVLAHE-N 312

Query: 247 TNYFTPFRLVTPLDGIVAERIGCLNCGETGGIRYSVSSGLSLNLPSENIGDTLKLSQLLN 306
            + ++PF+L+TPLDG+ AERIGCL CGE GGIRYSV SGLSLNLPSEN+G TLKLS+LL 
Sbjct: 313 KSLYSPFKLITPLDGLTAERIGCLQCGENGGIRYSVFSGLSLNLPSENLGSTLKLSELLR 372

Query: 307 EWCKPEIIEGVNCYRCSLNAVLEHLENQLKTMSEKPKGSIPDKLISAIKTRIKALNETLS 366
           EW KPEIIEGV C RC+LNAVLEHLE  L         S  +KL++A+K R++ L + L+
Sbjct: 373 EWIKPEIIEGVECNRCALNAVLEHLEKTLIQYEGSEHSS--EKLVAAVKARVEQLKDILA 430

Query: 367 KPVIDDEEYKKMHTDNMVRKSSKSKQIILARPPPLLSIHINRSVFDTRTFMIKKNNSRLA 426
           KP IDD++YKK+HT+NMVRK SKSKQII++RPPPLL IHINRSVFD RT+MI+KNNSR+ 
Sbjct: 431 KPAIDDDDYKKLHTENMVRKCSKSKQIIISRPPPLLCIHINRSVFDPRTYMIRKNNSRVL 490

Query: 427 FKARLNLKPWCCDVNDINLDARLPMSKTQKXXXXXXXXXXXXTVGGEYYAKLHDKFQKEF 486
           FK++LNL PWCC  ++INLDARLPMSK ++             VGGEY+AKLH    + F
Sbjct: 491 FKSKLNLAPWCCAPDEINLDARLPMSKKEQ---KSLESSEDENVGGEYFAKLH----RHF 543

Query: 487 EDSDEEQEDGMSDYSDYNMRSNRDVDNYDPL 517
           E+  E+ E+   ++      SNRDV +YDPL
Sbjct: 544 EEEFEDSEEEEGNFE----ASNRDVSDYDPL 570

 Score =  147 bits (370), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 73/84 (86%), Gaps = 1/84 (1%)

Query: 658 APTYSTKVPTGPLTYELRSVIVHYGTHNYGHYIAFRKYRGTWWRISDETVHMVDEAEVLS 717
           AP+ ST VP GPLTY LRSVIVHYGTHNYGHYIAFRK+RG WWRISDETV++VDEAEVLS
Sbjct: 666 APSSST-VPVGPLTYALRSVIVHYGTHNYGHYIAFRKFRGLWWRISDETVYVVDEAEVLS 724

Query: 718 TPSVFMLFYEYDFDEKSGMMKDDL 741
           TP +FMLFYE+D++E    M DDL
Sbjct: 725 TPGIFMLFYEHDYNESLHAMNDDL 748

>NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}
          Length = 856

 Score =  499 bits (1286), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 280/562 (49%), Positives = 355/562 (63%), Gaps = 63/562 (11%)

Query: 13  RKWVTKNNLQIQNTVMKRGGFVGGLVNEGNTCFMNSVLQSLASSHEIVRFLDXXXXXXXX 72
           R+W+ +++ Q+ + V+  GG++ GL+N+GNTCFMNSVLQSLASS E++ FLD        
Sbjct: 107 RRWMPRSS-QMDSNVLNHGGYIAGLLNDGNTCFMNSVLQSLASSKELMDFLDTTIKQEQE 165

Query: 73  XXXXXXXXXXXXXSDSAHNHHNHQQDDXXXXXXXXXXXXXXLTKTNDDDMSTDVSFSISX 132
                         D                                     D+ F++S 
Sbjct: 166 QEQEQEQVGDEKKED------------------------------------VDIGFTLSL 189

Query: 133 XXXXXXXXXXYYRERKYYRTNNLLKTMSKAPNKNIILGYEQEDAQEFFQTILYELEKNIK 192
                     YY+ER Y++TN LLKTM  APNKN++LGY+QEDAQEFFQ IL ELEKN+K
Sbjct: 190 NELLSQLNAKYYKERPYFKTNKLLKTMKNAPNKNMLLGYDQEDAQEFFQNILSELEKNLK 249

Query: 193 FLDSDREKLDKK-------------PIPESDLPSNALIGQNNLSHVGTVYIPTAHLDPN- 238
            + S   K +++              I + DLP +A+IGQ  L  VGTVYIPT  ++PN 
Sbjct: 250 SISSQNNKEEEEEKKEQEKNSNECVKILKKDLPKDAIIGQEQLGKVGTVYIPTEQIEPNT 309

Query: 239 --SLLDKDPSTNYFTPFRLVTPLDGIVAERIGCLNCGETGGIRYSVSSGLSLNLPSENIG 296
             +L   +P    +TPF+L+TPLDGI AERIGCL CGE GGIRYSV SGLSLNLP+ENIG
Sbjct: 310 STALPSSNPQEKLYTPFKLITPLDGISAERIGCLQCGENGGIRYSVFSGLSLNLPNENIG 369

Query: 297 DTLKLSQLLNEWCKPEIIEGVNCYRCSLNAVLEHLENQLKTMSEKPKGSIPDKLISAIKT 356
            TLKLS LLNEW KPEII+GV C RC+L A+  HL +QL+         IP KLI A+K 
Sbjct: 370 MTLKLSNLLNEWIKPEIIDGVECNRCALEAIKSHLLDQLEQYHNN-STEIPQKLIDAVKD 428

Query: 357 RIKALNETLSKPVIDDEEYKKMHTDNMVRKSSKSKQIILARPPPLLSIHINRSVFDTRTF 416
           R++ L + LSKPVID+E+YKK+HT+NMVRK SKSKQI+++RPPPLLSIHINRSVFD RT+
Sbjct: 429 RVECLQKILSKPVIDEEDYKKLHTENMVRKCSKSKQILISRPPPLLSIHINRSVFDVRTY 488

Query: 417 MIKKNNSRLAFKARLNLKPWCCDVNDINLDARLPMSKTQKXXXXXX-XXXXXXTVGGEYY 475
            I+KNNSR+ FK++LNL+PW CD+++INLDARLPMSK +              T  GEYY
Sbjct: 489 QIRKNNSRVLFKSKLNLEPWTCDIDEINLDARLPMSKKESSLGQDEFSEDDEATTNGEYY 548

Query: 476 AKLHDKFQKEFEDSDEEQEDGMSD--YS-DYNMRSNR-DVDNYDPLNEDTEHDEIRETVS 531
            +LH K+Q+EFEDS +E +D   +  YS D N R  R DV NYDPLN + E        S
Sbjct: 549 NRLHQKYQQEFEDSSDEDDDSDDNEIYSMDNNRRRTRKDVRNYDPLNGEIEDSS--SVYS 606

Query: 532 TTDSEDEY--IEETDKLGNTIR 551
           + D +D +  IEETD LGNTIR
Sbjct: 607 SADEKDTHDSIEETDSLGNTIR 628

 Score =  152 bits (385), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 65/76 (85%), Positives = 70/76 (92%)

Query: 666 PTGPLTYELRSVIVHYGTHNYGHYIAFRKYRGTWWRISDETVHMVDEAEVLSTPSVFMLF 725
           P GPLTY LRSVIVHYGTHNYGHYIAFRKYRG WWRISDETV++VDEAEVLSTP VFMLF
Sbjct: 716 PIGPLTYSLRSVIVHYGTHNYGHYIAFRKYRGVWWRISDETVYIVDEAEVLSTPGVFMLF 775

Query: 726 YEYDFDEKSGMMKDDL 741
           YEYD+DE +G +KDDL
Sbjct: 776 YEYDYDEITGKLKDDL 791

>Kwal_27.11444 s27 complement(802766..805039) [2274 bp, 757 aa] {ON}
           YDL122W (UBP1) - Ubiquitin-specific protease [contig 27]
           FULL
          Length = 757

 Score =  494 bits (1271), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 270/549 (49%), Positives = 352/549 (64%), Gaps = 34/549 (6%)

Query: 10  SGYRKWVTKNNLQIQNTVMKRGGFVGGLVNEGNTCFMNSVLQSLASSHEIVRFLDXXXXX 69
           S + KW ++N  Q + T++KRGG+VGGL+N+GNTCFMNSV+QSLASS  +++FLD     
Sbjct: 74  SVFNKWGSRNPAQ-EATMLKRGGYVGGLINDGNTCFMNSVIQSLASSKSLMQFLDEELME 132

Query: 70  XXXXXXXXXXXXXXXXSDSAHNHHNHQQDDXXXXXXXXXXXXXXLTKTNDDDMS-----T 124
                            +  +   N +  +              LT+  + D +      
Sbjct: 133 ASKELENPNETSSAV-EEEGNLGSNSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGV 191

Query: 125 DVSFSISXXXXXXXXXXXYYRERKYYRTNNLLKTMSKAPNKNIILGYEQEDAQEFFQTIL 184
           ++ FS +           Y+R++ Y++TN LLKTMSKAPNKNIILGY+QEDAQEFFQTIL
Sbjct: 192 NMEFSAALKELLEKLNDKYHRDKPYFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTIL 251

Query: 185 YELEKNIKFLDSDREKLDKKPIPESDLPSNALIGQNNLSHVGTVYIPTAHLDPNSLLDKD 244
            ELEKNIK L    +K D +P   +D+P NA+IGQ  L  +GTVY+P   +DPN +L  +
Sbjct: 252 SELEKNIKSLRGKSDK-DNEPTELADIPKNAMIGQERLGEMGTVYLPAEQIDPNCVLGHE 310

Query: 245 PSTNYFTPFRLVTPLDGIVAERIGCLNCGETGGIRYSVSSGLSLNLPSENIGDTLKLSQL 304
               +F PF LVTPLDGI AERIGCL CGE GGIRYSV SGLSLNLPS+ +G  LKLSQL
Sbjct: 311 AKQLFF-PFDLVTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPSDTVGSALKLSQL 369

Query: 305 LNEWCKPEIIEGVNCYRCSLNAVLEHLENQLKTMSEKPKGSIPDKLISAIKTRIKALNET 364
           L EW KPEIIEGV C RC+L AVLEHLE  L       K  + +KL+SA+ +R++ L   
Sbjct: 370 LREWVKPEIIEGVECNRCALKAVLEHLEKTLTQYEINDK--VSEKLVSAVSSRVEELKAI 427

Query: 365 LSKPVIDDEEYKKMHTDNMVRKSSKSKQIILARPPPLLSIHINRSVFDTRTFMIKKNNSR 424
           L+KPV+DD++YKK+HT+NMVRK SKSKQI+++RPPPLLSIHINRSVFD RT+ I+KNNS+
Sbjct: 428 LAKPVVDDDDYKKLHTENMVRKCSKSKQILISRPPPLLSIHINRSVFDPRTYTIRKNNSK 487

Query: 425 LAFKARLNLKPWCCDVNDINLDARLPMSKTQKXXXXXXXXXXXXTVGGEYYAKLHDKFQK 484
           + FK+RLNL PW C  ++INLDARLPMSK  +             +GGEY+AKLH    +
Sbjct: 488 VLFKSRLNLAPWSCGPDEINLDARLPMSKKDQ---RAMESSEDENIGGEYFAKLH----R 540

Query: 485 EFEDSDEEQEDGMSDYSDYNMRSNRDVDNYDPLNEDTEHDEIRETVSTTDSEDEYIE--- 541
            FE+  E+ ++   +YS+ N R N D   YDPL         +  + ++  +DEY E   
Sbjct: 541 RFEEEFEDSDEESDNYSEKN-RLNSD---YDPL---------KGELDSSSEDDEYSEGEY 587

Query: 542 ETDKLGNTI 550
           E D LGN +
Sbjct: 588 EIDSLGNRV 596

 Score =  145 bits (366), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 74/84 (88%), Gaps = 1/84 (1%)

Query: 658 APTYSTKVPTGPLTYELRSVIVHYGTHNYGHYIAFRKYRGTWWRISDETVHMVDEAEVLS 717
           AP+ ST VP+GPLTY LRSVIVHYG+HNYGHYIAFRK+RG WWRISDETV++VDEAEVLS
Sbjct: 665 APSSST-VPSGPLTYALRSVIVHYGSHNYGHYIAFRKFRGLWWRISDETVYVVDEAEVLS 723

Query: 718 TPSVFMLFYEYDFDEKSGMMKDDL 741
           TP VFMLFYE+D+++    M DDL
Sbjct: 724 TPGVFMLFYEHDYNQTLQKMNDDL 747

>KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} similar
           to uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
           Ubiquitin-specific protease that removes ubiquitin from
           ubiquitinated proteins cleaves at the C terminus of
           ubiquitin fusions irrespective of their size capable of
           cleaving polyubiquitin chains
          Length = 771

 Score =  491 bits (1265), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 273/546 (50%), Positives = 362/546 (66%), Gaps = 26/546 (4%)

Query: 14  KWVTKNNLQIQNTVMKRGGFVGGLVNEGNTCFMNSVLQSLASSHEIVRFLDXXXXXXXXX 73
           +W  +N  Q + T+++RGG+VGGLVN+GNTCFMNSVLQ LASS E+ +F+D         
Sbjct: 64  RWAPRNAEQ-EETIVRRGGYVGGLVNDGNTCFMNSVLQCLASSKELHKFMDTIILDSNDD 122

Query: 74  XXXXXXXXXXXXSDSAHNHHNHQQDDXXXXXXXXXXXXXXLTKTNDDDM-----STDVSF 128
                       SD  +     ++                  +  D+++       ++ F
Sbjct: 123 SQNTIDENGEE-SDLPNEQSTVEKKPKATKNKTYGKRKKIAVRQADNELLKNSTEPNMHF 181

Query: 129 SISXXXXXXXXXXXYYRERKYYRTNNLLKTMSKAPNKNIILGYEQEDAQEFFQTILYELE 188
           +++           +YR R +++TN LLKTMSKAPN+NIILGY+QEDAQEFFQTIL ELE
Sbjct: 182 TLALQDLFSKLNAKHYRNRPWFKTNKLLKTMSKAPNRNIILGYDQEDAQEFFQTILSELE 241

Query: 189 KNIKFLDSDREKLDKKPIPESDLPSNALIGQNNLSHVGTVYIPTAHLDPNSLLDKDPSTN 248
           KN++ +    EK D KP+P+ DLP +A++GQ +L  +G VYIPT  +DPNS+L       
Sbjct: 242 KNVESIYGKPEK-DPKPVPQDDLPEDAIVGQEHLGEIGDVYIPTEQIDPNSVLAS--GRK 298

Query: 249 YFTPFRLVTPLDGIVAERIGCLNCGETGGIRYSVSSGLSLNLPSENIGDTLKLSQLLNEW 308
           +++P+++VTPLDGI AERIGCL CGE GGIRYSV SGLSLNLPS+NIG  +KLSQLL+EW
Sbjct: 299 FYSPYKIVTPLDGITAERIGCLQCGENGGIRYSVFSGLSLNLPSDNIGSPIKLSQLLDEW 358

Query: 309 CKPEIIEGVNCYRCSLNAVLEHLENQLKTMSEKPKGSIPDKLISAIKTRIKALNETLSKP 368
            KPEIIEGV+C RC+LNAVLEHL  QL T+  +P   +  KL++ ++ RI  +   LSK 
Sbjct: 359 SKPEIIEGVDCNRCALNAVLEHLVEQLNTIQSQP--DVNQKLVTLMEDRINEVKSVLSKL 416

Query: 369 VIDDEEYKKMHTDNMVRKSSKSKQIILARPPPLLSIHINRSVFDTRTFMIKKNNSRLAFK 428
            IDD++YK+MHT+NMVRKSSKSKQI+++RPPPLLS+HINRSVFD RT+MI+KNNSR+ FK
Sbjct: 417 AIDDDDYKRMHTENMVRKSSKSKQILISRPPPLLSVHINRSVFDPRTYMIRKNNSRVIFK 476

Query: 429 ARLNLKPWCCDVNDINLDARLPMSKTQKXXXXXXXXXXXXTVGGEYYAKLHDKFQKEFED 488
           ++LNL PWCC+ + INLDARLPMSK Q+              G EYY KLH +F+KEFED
Sbjct: 477 SKLNLSPWCCNYDKINLDARLPMSKKQENWHESSEDDNN---GTEYYNKLHRRFEKEFED 533

Query: 489 SDEEQEDGMSDYSDYNMRSNRDVDNYDPLNEDTEHDEIRETVSTTDSEDEYIE----ETD 544
           SDEE++   +    +N  S+R V+ +D LN +        + S + SED+  E    E D
Sbjct: 534 SDEEEDGSDNGQGMFN-GSSRMVEEHDVLNGEL------SSASLSSSEDDIAEVEEVELD 586

Query: 545 KLGNTI 550
            LGNTI
Sbjct: 587 ALGNTI 592

 Score =  146 bits (369), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 65/102 (63%), Positives = 79/102 (77%), Gaps = 4/102 (3%)

Query: 663 TKVPTGPLTYELRSVIVHYGTHNYGHYIAFRKYRGTWWRISDETVHMVDEAEVLSTPSVF 722
           + VP GPLTY LRSVIVHYGTHNYGHYIAFR++RG WWRISDE+V++VDE EVLSTP VF
Sbjct: 672 SSVPAGPLTYVLRSVIVHYGTHNYGHYIAFRRFRGCWWRISDESVYIVDEQEVLSTPGVF 731

Query: 723 MLFYEYDFDEKSGMMKDDLXXXXXXXXXFDVGTESDESSDEL 764
           MLFYEYD+D ++G MKDD          F+V  E + + D++
Sbjct: 732 MLFYEYDYDTETGKMKDD----TEYENEFNVEIEGEPAVDQV 769

>AGR389C Chr7 complement(1444377..1446704) [2328 bp, 775 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL122W
           (UBP1)
          Length = 775

 Score =  483 bits (1243), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 254/514 (49%), Positives = 331/514 (64%), Gaps = 28/514 (5%)

Query: 14  KWVTKNNLQIQNTVMKRGGFVGGLVNEGNTCFMNSVLQSLASSHEIVRFLDXXXXXXXXX 73
           +W  ++  +++    + GG VGGLVN+GNTCF+NSV+QSLASS E++RFLD         
Sbjct: 68  RWAPQS-AELEKQAHQHGGNVGGLVNDGNTCFINSVIQSLASSRELLRFLDEEIIDASQP 126

Query: 74  XXXXXXXXXXXXSDSAHNHHNHQQDDXXXXXXXXXXXXXXLTKTND---------DDMST 124
                        +SA +  N  +D+                +            D   T
Sbjct: 127 GT----------DESADDVQNGDEDEGSSSAKKKAYGKRKKKQARAADAVALAKADGPRT 176

Query: 125 DVSFSISXXXXXXXXXXXYYRERKYYRTNNLLKTMSKAPNKNIILGYEQEDAQEFFQTIL 184
           D  FS +           +YR + Y+RT+ LLKTMSKAPNKNIILGY+QEDAQEFFQTIL
Sbjct: 177 D--FSAALRELIDNLNGKHYRNKPYFRTSGLLKTMSKAPNKNIILGYDQEDAQEFFQTIL 234

Query: 185 YELEKNIKFLDSDREKLDKKPIPESDLPSNALIGQNNLSHVGTVYIPTAHLDPNSLLDKD 244
            ELEK+++ +    EK + KP+P+ +LP +A+IG  ++  +GTVYIPT  + PNS+L+ D
Sbjct: 235 SELEKDVQSIQGKPEK-NAKPVPKEELPGDAIIGSEHIGRIGTVYIPTEQIAPNSVLN-D 292

Query: 245 PSTNYFTPFRLVTPLDGIVAERIGCLNCGETGGIRYSVSSGLSLNLPSENIGDTLKLSQL 304
           P   Y+TPF+L+TP DGI AER+GCL CGE GGIRY + S LSLNLP++N   TLKLS+L
Sbjct: 293 PE-RYYTPFKLLTPFDGITAERVGCLQCGENGGIRYCLFSSLSLNLPNDNTSSTLKLSEL 351

Query: 305 LNEWCKPEIIEGVNCYRCSLNAVLEHLENQLKTM-SEKPKGSIPDKLISAIKTRIKALNE 363
           L EW KPEIIEGV C RC+L AV  HL  ++K + + + + ++  KLIS +K R++ L  
Sbjct: 352 LREWVKPEIIEGVECNRCALQAVHAHLAAKVKELQAAEDEKAMSAKLISLMKARLEQLEG 411

Query: 364 TLSKPVIDDEEYKKMHTDNMVRKSSKSKQIILARPPPLLSIHINRSVFDTRTFMIKKNNS 423
            L+KP IDDE+YKK+HTDNMVRK SKSKQ ++ RPPPLLSIHINRSVFD RTFMI+KNNS
Sbjct: 412 ILAKPAIDDEDYKKLHTDNMVRKCSKSKQTLITRPPPLLSIHINRSVFDPRTFMIRKNNS 471

Query: 424 RLAFKARLNLKPWCCDVNDINLDARLPMSKTQKXXXXXXXXXXXXTVGGEYYAKLHDKFQ 483
           ++ FK+RLNL PWCC V+++NLDARLPMSK  K              G EYY KLH +FQ
Sbjct: 472 KVLFKSRLNLAPWCCGVDEVNLDARLPMSK--KDAAELEESSEDEPQGTEYYNKLHLRFQ 529

Query: 484 KEFEDSDEEQEDGMSDYSDYNMRSNRDVDNYDPL 517
            E+ED D+  +         + R+  DV NYDPL
Sbjct: 530 AEYEDEDDLDKGPNPSGPHSSYRAVADVPNYDPL 563

 Score =  145 bits (367), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 70/81 (86%)

Query: 661 YSTKVPTGPLTYELRSVIVHYGTHNYGHYIAFRKYRGTWWRISDETVHMVDEAEVLSTPS 720
           + + V   PLTY LRSVIVHYGTHNYGHYIAFRK+RG WWRISDET ++VDEAEVLSTP 
Sbjct: 663 HGSSVLASPLTYSLRSVIVHYGTHNYGHYIAFRKFRGVWWRISDETAYIVDEAEVLSTPG 722

Query: 721 VFMLFYEYDFDEKSGMMKDDL 741
           VFMLFYEYD+DE +G ++DDL
Sbjct: 723 VFMLFYEYDYDEATGQLRDDL 743

>KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.307
           YDL122W
          Length = 764

 Score =  457 bits (1175), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 243/438 (55%), Positives = 311/438 (71%), Gaps = 24/438 (5%)

Query: 125 DVSFSISXXXXXXXXXXXYYRERKYYRTNNLLKTMSKAPNKNIILGYEQEDAQEFFQTIL 184
           +++FS++           Y R RKYYR N LLKTM   PNKNI+LGY+QEDAQEFFQ I+
Sbjct: 107 ELNFSVAFKTLLDKLNAKYGRNRKYYRPNALLKTMESGPNKNILLGYDQEDAQEFFQQII 166

Query: 185 YELEKNIKFLDSDRE-----------KLDKKPIPESDLPSNALIGQNNLSHVGTVYIPTA 233
            +LEK++K  D+D +           + DK PI ESDLP++AL+ Q NL  VGTVYIPT 
Sbjct: 167 SQLEKDLKKEDTDGDFKKEESVQPSSEDDKTPILESDLPADALLNQENLEKVGTVYIPTE 226

Query: 234 HLDPNSLLDKDPSTNYFTPFRLVTPLDGIVAERIGCLNCGETGGIRYSVSSGLSLNLPSE 293
            ++PN  L K    +++TP++L+TPLDGI+AERIGCLNCGE GGIRYSVSSGLSLNLP+E
Sbjct: 227 QVEPNFALGKGEHESFYTPYKLLTPLDGIIAERIGCLNCGENGGIRYSVSSGLSLNLPNE 286

Query: 294 NIGDTLKLSQLLNEWCKPEIIEGVNCYRCSLNAVLEHLENQLKTMSEKPKGSIPDKLISA 353
           NIG TLKLS+LL++W +PEIIEGV+C RC+L AV  HL  QL+   EK + + P KLI A
Sbjct: 287 NIGATLKLSELLDKWVEPEIIEGVDCNRCALEAVRSHLLEQLEGF-EKNEKAPPAKLIDA 345

Query: 354 IKTRIKALNETLSKPVIDDEEYKKMHTDNMVRKSSKSKQIILARPPPLLSIHINRSVFDT 413
           +K R+K L ETL KP IDDE+YKK+HTDNMVRK SKSKQ++++RPPPLLSIHINRSVFD 
Sbjct: 346 MKERVKVLEETLLKPAIDDEDYKKLHTDNMVRKCSKSKQVVISRPPPLLSIHINRSVFDP 405

Query: 414 RTFMIKKNNSRLAFKARLNLKPWCCDVNDINLDARLPMSKTQKXXXXXXXXXXXXTVGGE 473
           RT+MI KN SR+ FK++LNL  WCC   +INLDARLPMSK QK                 
Sbjct: 406 RTYMICKNGSRVLFKSKLNLDQWCCSPLEINLDARLPMSKKQKRSRDSSEEEEEELA--- 462

Query: 474 YYAKLHDKFQKEFEDSDEEQEDGMSDYSDYNMRSNRDVDNYDPLNEDTEHDEIRETVSTT 533
           Y++KLH +FQ+EFEDS E++E          +R++++V +YDPL    + D+     S+ 
Sbjct: 463 YFSKLHQRFQREFEDSSEDEEP---------IRTDKNVKDYDPLGGQYDSDDSSSDFSSQ 513

Query: 534 DSEDEYIEETDKLGNTIR 551
             ++EYIEETD LGN++R
Sbjct: 514 KEDEEYIEETDALGNSVR 531

 Score =  144 bits (363), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 62/83 (74%), Positives = 68/83 (81%)

Query: 659 PTYSTKVPTGPLTYELRSVIVHYGTHNYGHYIAFRKYRGTWWRISDETVHMVDEAEVLST 718
           P      P  PLTY LRSVIVHYGTHNYGHYIAFRKYRG WWRISDETV +V EAEVLST
Sbjct: 611 PVPKVSKPATPLTYSLRSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVGIVTEAEVLST 670

Query: 719 PSVFMLFYEYDFDEKSGMMKDDL 741
           P VFMLFYEYD+DE +G ++DD+
Sbjct: 671 PGVFMLFYEYDYDEATGKLRDDV 693

 Score = 71.2 bits (173), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 36/42 (85%)

Query: 23 IQNTVMKRGGFVGGLVNEGNTCFMNSVLQSLASSHEIVRFLD 64
          + + ++KRGGFV GLVN+GNTCFMNSVLQSLASS E+  FLD
Sbjct: 54 MDDVILKRGGFVAGLVNDGNTCFMNSVLQSLASSRELAHFLD 95

>TBLA0B07160 Chr2 complement(1696047..1697201) [1155 bp, 384 aa]
           {ON} Anc_2.307 YDL122W
          Length = 384

 Score =  290 bits (743), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 161/328 (49%), Positives = 227/328 (69%), Gaps = 40/328 (12%)

Query: 164 NKNIILGYEQEDAQEFFQTILYELEKNIKFLD----SDREKLDK----KPIPESDLPSNA 215
           N++++LGY Q+DAQEFFQ IL +LEKN+K ++     ++ K ++    K IP   LPS+A
Sbjct: 6   NQDVVLGYAQQDAQEFFQAILAKLEKNVKQIEHIPLKEKNKSNQNNILKSIPFEKLPSDA 65

Query: 216 LIGQNNLSHVGTVYIPTAHLDPNSLLDKDPSTN------YFTPFRLVTPLDGIVAERIGC 269
           L+G ++L  VGTV+IPT  ++PN L+  + S N       FTPF+L+TPLDGI+AERIGC
Sbjct: 66  LLGHDHLDKVGTVFIPTDQINPN-LIKNNESINSSNTNQLFTPFKLITPLDGIIAERIGC 124

Query: 270 LNCGETGGIRYSVSSGLSLNLPSENIGDTLKLSQLLNEWCKPEIIEGVNCYRCSLNAVLE 329
           LNCGE GGIRYSVSS LSLNLP+    D++ L +LL+ + +PEIIE VNC RC+L ++ +
Sbjct: 125 LNCGENGGIRYSVSSSLSLNLPNYT-NDSISLYELLSNYTQPEIIEQVNCNRCTLASMYD 183

Query: 330 HLENQLKTMS---------------------EKPKGSIPD---KLISAIKTRIKALNETL 365
            + ++LK ++                     EK   +I D   KL S +  R+  ++  L
Sbjct: 184 SINSKLKELTSEDVNINQIDNNTQEDENSTIEKTSMAINDSNNKLKSVLTERLNTISNVL 243

Query: 366 SKPVIDDEEYKKMHTDNMVRKSSKSKQIILARPPPLLSIHINRSVFDTRTFMIKKNNSRL 425
           SKPVIDD+ +K + T NM  ++SKSKQ++++RPPPLLSIHINRSVFD  T+ I+KNNSR+
Sbjct: 244 SKPVIDDDSFKTLSTSNMTCQTSKSKQLLISRPPPLLSIHINRSVFDPTTYQIRKNNSRV 303

Query: 426 AFKARLNLKPWCCDVNDINLDARLPMSK 453
            F++RLNL  +CC++++INLDARLPM+K
Sbjct: 304 LFESRLNLNGFCCNIDEINLDARLPMNK 331

>NDAI0G00780 Chr7 (164452..165912) [1461 bp, 486 aa] {ON} 
          Length = 486

 Score =  102 bits (253), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 92/367 (25%), Positives = 153/367 (41%), Gaps = 85/367 (23%)

Query: 157 KTMSKAPNKNIILGYEQEDAQEFFQTILYELEKNIKFLDSDREKLDKKPIPESDLPSNAL 216
           K +S   ++ II   +Q+DAQEF Q +  +LEK                           
Sbjct: 125 KFISTLSSQTIINATDQQDAQEFLQILFNDLEK--------------------------- 157

Query: 217 IGQNNLSHVGTVYIPTAHLDPNSLLDKDPSTNYFTPFRLVTPLDGIVAERIGCLNCGETG 276
                      ++  T  +  N  L            ++ TP +GI+  R+ CL C E  
Sbjct: 158 ---------SQIFHTTVKITSNDAL------------QIKTPFEGILMARMKCLTCDEIS 196

Query: 277 GIRYSVSSGLSLNLPSENIGDTLKLSQLLNEWCKPEIIEGVNCYRCSLNAVLEHLENQLK 336
              + + S L+L+LP  +  +T     L   W + + +E V+C RC+L   L+H  +   
Sbjct: 197 NPNFKLFSNLTLSLPRYSKQETFN-DILSTFWNQLDYVENVSCNRCTL---LKHANSN-- 250

Query: 337 TMSEKPKGSIPDKLISAIKTRIKALNETLSKPVIDDEEYKK-MHTDNM-VRKSSKSKQII 394
                                       L K VI D++ +  +  DN+ + KS+K KQI 
Sbjct: 251 ----------------------SEYQNLLVKDVIKDDDMENILKRDNLEMVKSNKIKQIK 288

Query: 395 LARPPPLLSIHINRSVFDTRTFMIKKNNSRLAFKARLNLKPWCCDVNDINLDARLPMSKT 454
           + +PP +LS H NRS+FD + F  KKNN ++    +LN+  +C   +D+ +D    ++  
Sbjct: 289 ILKPPKILSFHFNRSIFDRKQFKFKKNNCKVLLTPKLNISKFCIVDSDLAVD----VADG 344

Query: 455 QKXXXXXXXXXXXXTVGGEYYAKLHDKFQKEFEDSDEEQEDGMS-DYSDYNMRSN--RDV 511
                             +YY KLH  ++ E+  SDE+ +   S D + YN R +   ++
Sbjct: 345 YAPDFYYKNKNGNSEKDKKYYEKLHQSYETEYAQSDEDDDFNESRDENQYNSRQDIPENI 404

Query: 512 DNYDPLN 518
           D +D  N
Sbjct: 405 DLFDSQN 411

 Score = 89.0 bits (219), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 33/65 (50%), Positives = 47/65 (72%)

Query: 665 VPTGPLTYELRSVIVHYGTHNYGHYIAFRKYRGTWWRISDETVHMVDEAEVLSTPSVFML 724
           +      Y L+S++VHYG+H+YGHYI++R++   WWRISDE+V  VDE EV S   +F++
Sbjct: 421 IGNNKCVYSLKSIVVHYGSHDYGHYISYRRFEDQWWRISDESVLKVDEDEVFSASGIFIV 480

Query: 725 FYEYD 729
           FYE D
Sbjct: 481 FYEQD 485

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 27/32 (84%), Gaps = 1/32 (3%)

Query: 34 VGGLVNE-GNTCFMNSVLQSLASSHEIVRFLD 64
          +GGL N+ GN+CF+NS+LQS AS + +++FLD
Sbjct: 5  IGGLNNDDGNSCFINSILQSSASCNYLLQFLD 36

>NCAS0G03680 Chr7 complement(682617..684065) [1449 bp, 482 aa] {ON}
           Anc_2.307 YDL122W
          Length = 482

 Score = 99.0 bits (245), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 40/62 (64%), Positives = 51/62 (82%)

Query: 670 LTYELRSVIVHYGTHNYGHYIAFRKYRGTWWRISDETVHMVDEAEVLSTPSVFMLFYEYD 729
           + Y+L++VI+HYGTHNYGHYI++RK+   WWRISDE+V  VDE EVL++P VFMLFYE  
Sbjct: 420 IIYDLKAVIIHYGTHNYGHYISYRKFMNQWWRISDESVIEVDEMEVLTSPGVFMLFYEIH 479

Query: 730 FD 731
            D
Sbjct: 480 TD 481

 Score = 98.2 bits (243), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 78/262 (29%), Positives = 115/262 (43%), Gaps = 55/262 (20%)

Query: 172 EQEDAQEFFQTILYELEKNIKFLDSDREKLDKKPIPESDLPSNALIGQNNLSHVGTVYIP 231
           +Q+DAQEFFQ IL E++K                 P+ D  ++         + G  Y P
Sbjct: 144 DQQDAQEFFQHILLEIDK-------------VSLPPKYDEATSTFTNVLECVNYGVCYFP 190

Query: 232 TAHLDPNSLLDKDPSTNYFTPFRLVTPLDGIVAERIGCLNCGETGGIRYSVSSGLSLNLP 291
               +                  + +P DGI+   I CL C E     YS+ S ++LNLP
Sbjct: 191 DVSKE----------------LTIRSPFDGIMKTTIRCLQCNEISNAHYSILSNITLNLP 234

Query: 292 SENIGDTLKLSQLLNEWCKPEIIEGVNCYRCSLNAVLEHLENQLKTMSEKPKGSIPDKLI 351
                D  KLS L++ W +P I+E V C +C+L          L   S  P   + + L+
Sbjct: 235 HTK-SDCFKLSTLIHRWIEPCILEDVTCNKCTL----------LNRTSRTP--DVEELLL 281

Query: 352 SAIKTRIKALNETLSKPVIDDEEYKKMHTDNMVRKSSKSKQIILARPPPLLSIHINRSVF 411
           S         +E + K  I  EE KK    N +R S       + + P ++S HINRS F
Sbjct: 282 SGKYIE----DEDMIKLKIIPEEKKK---GNKLRNS------YMVQLPHVMSFHINRSRF 328

Query: 412 DTRTFMIKKNNSRLAFKARLNL 433
             +TF I+K+N R+ FK +L +
Sbjct: 329 HKKTFKIRKDNRRVLFKLQLTI 350

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/34 (58%), Positives = 28/34 (82%)

Query: 31 GGFVGGLVNEGNTCFMNSVLQSLASSHEIVRFLD 64
          G  +GGL+N GN+CFMNSVLQ+LAS   +++FL+
Sbjct: 23 GSTLGGLINNGNSCFMNSVLQALASLPSLLKFLE 56

>SAKL0H10076g Chr8 (863358..865661) [2304 bp, 767 aa] {ON} similar
           to gnl|GLV|KLLA0E23463g Kluyveromyces lactis
           KLLA0E23463g and some similarites with YPL072W
           uniprot|Q02863 Saccharomyces cerevisiae YPL072W UBP16
           Putative ubiquitin-specific protease
          Length = 767

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 61/226 (26%), Positives = 101/226 (44%), Gaps = 44/226 (19%)

Query: 243 KDPSTNYFTP-FRLVTPLDGIVAERIGCLNCGETGGIRYSVSSGLSLNLPSENIGDTLKL 301
           KD S N   P F    P+ G +A+ + CLNC ++  +     S   L +P E+   T  L
Sbjct: 305 KDQSLNVIIPDF----PVRGSLADHLVCLNCRDSSKVNVHPFSMYPLPVPQES---TAVL 357

Query: 302 SQLLNEWCKPEIIEGVNCYRCSLNAVL------------EHLENQLKTMSE-KPKGSIPD 348
           + ++++  + E IEG +C  C + A+L            E   N L+T+ +  P   I D
Sbjct: 358 ADMISD-NQTETIEGYSCLSCKIRAILSNEKQRNFAGTSESERNVLQTLEKILPDIFIND 416

Query: 349 KLISAIKTRIKALNETLSKPVIDDEEYKKMHTDNMVRKSSKSKQIILARPPPLLSIHINR 408
            L + + T I              + Y K   +  + KS+  K+ ++   P LL IH++R
Sbjct: 417 DLSAELTTYI--------------DNYNKDGVNTSILKSTIVKKTVVVDSPELLIIHLSR 462

Query: 409 SVFDTRTFMIKKNNSRLAFKARLNL------KPWCCDVNDINLDAR 448
           SVF+   +   +N+  +AF+  L L      K  C  VN++    R
Sbjct: 463 SVFNGMNYT--RNSCNVAFEEDLGLQEQIIEKNKCVGVNNVKYRLR 506

>KLLA0E23387g Chr5 complement(2079405..2081753) [2349 bp, 782 aa]
           {ON} some similarities with uniprot|Q02863 Saccharomyces
           cerevisiae YPL072W UBP16 Putative ubiquitin-specific
           protease
          Length = 782

 Score = 58.2 bits (139), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 66/272 (24%), Positives = 120/272 (44%), Gaps = 45/272 (16%)

Query: 178 EFFQTILYELEKNIKFLDSDREKLDKKP---IPESDLPSNALIGQNNLSHVGTVYIPTAH 234
           E    ILY+L++ +    + +  +   P   + E    +    GQN+   +  V + T  
Sbjct: 234 ESLAQILYQLQQTV----TAQHHISIWPFLRVIEGIFKAKISTGQNDAHELTQVVLQTLE 289

Query: 235 LDPNSL--LDKDPSTNYFTPFRLVTPLDGIVAERIGCLNCGETGGIRYSVSSGLSLNLPS 292
            +  +L    K+ S N   P     P+ G +A+ + CL+CGE+  +     +  SL +P 
Sbjct: 290 NENLALQKFVKNHSLNVIIP---TFPVHGSLADSLFCLSCGESSKVNIHEFTMYSLPVPQ 346

Query: 293 ENIGDTLKLSQLLNEWCKPEIIEGVNCYRCSLNAVLEHLENQ------------LKTMSE 340
               D   L+Q++++  + + I G +C  C LNA++ + +N+            LK + E
Sbjct: 347 LINAD---LAQMISD-NQTDQISGYSCLCCKLNAIIANEKNRNYQNNSDEENQILKELEE 402

Query: 341 K-PKGSIPDKLISAIKTRIKALNETLSKPVIDDEEYKKMHTDNMVRKSSKSKQIILARPP 399
             PK  I D L   + T I +              Y+K        KS+  K+ ++   P
Sbjct: 403 LLPKAFINDDLARNLSTYINS--------------YEKGGIKTSEIKSTIVKKTVVVDSP 448

Query: 400 PLLSIHINRSVFDTRTFMIKKNNSRLAFKARL 431
            +L +H++RSVFD   +  +KN   ++F+  L
Sbjct: 449 DVLILHLSRSVFDGMGY--QKNTCNVSFEEEL 478

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 20/30 (66%), Gaps = 1/30 (3%)

Query: 699 WWRISDETVHMVDEAEVLS-TPSVFMLFYE 727
           WWRISD  V     +++LS T  V+ML+YE
Sbjct: 748 WWRISDTKVKEYKTSDILSETKFVYMLYYE 777

 Score = 33.5 bits (75), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 18/23 (78%)

Query: 671 TYELRSVIVHYGTHNYGHYIAFR 693
           +Y+LRS++ H G+H+ GHY  FR
Sbjct: 497 SYKLRSMLRHQGSHSTGHYECFR 519

>TBLA0H03600 Chr8 complement(877069..878517) [1449 bp, 482 aa] {ON}
           Anc_8.540 YPL072W
          Length = 482

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 88/180 (48%), Gaps = 18/180 (10%)

Query: 258 PLDGIVAERIGCLNCGETGGIRYSVSSGLSLNLPSENIGDTLKLSQLLNEWCKPEIIEGV 317
           P +G     + CL CG    ++      L+LNLP++    ++ L +L++     ++IEG 
Sbjct: 202 PFEGKYCHELTCLKCGRNSEVKMFDFDILTLNLPAQ---PSISLDELIS-GSNSDVIEGF 257

Query: 318 NCYRCSLNAVLEHLENQLKTMSEKPKGSIPDKLISAIKTRIKALNETLSKPV---IDDEE 374
           +C  C ++A+L        T +  P      K +  I   +K +N  L +P+   +D   
Sbjct: 258 SCTVCKVSAILG------GTGTHNPNTRSLIKSLKEIFPELK-INTELDEPLNSFVDSYS 310

Query: 375 YKKMHTDNMVRKSSKSKQIILARPPPLLSIHINRSVFDTRTFMIKKNNSRLAFKARLNLK 434
           +  + T N+  KS+  K+ +    P +L IH+ RS+F+  ++   +N  ++A+  +L L+
Sbjct: 311 HDGVITRNI--KSTIVKKTVFVEVPDILLIHLTRSMFNGMSY--TRNACKIAYDEKLLLE 366

 Score = 36.2 bits (82), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 21/32 (65%)

Query: 33 FVGGLVNEGNTCFMNSVLQSLASSHEIVRFLD 64
          +  GL+N+GN CF+NS LQ LA S     +L+
Sbjct: 67 YTTGLINKGNDCFINSSLQGLAGSQRFNHYLN 98

>Kwal_27.12030 s27 complement(1056215..1058464) [2250 bp, 749 aa]
           {ON} YPL072W (UBP16) - putative deubiquitinating enzyme
           [contig 24] FULL
          Length = 749

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/223 (26%), Positives = 100/223 (44%), Gaps = 26/223 (11%)

Query: 218 GQNNLSHVGTVYIPTAHLDPNSL--LDKDPSTNYFTP-FRLVTPLDGIVAERIGCLNCGE 274
           GQN+   +  V + T   +   L    KD S N   P F    P+ G +A+ + CLNC  
Sbjct: 272 GQNDAHELSQVILETLEKENLRLKKFVKDQSLNVIIPDF----PVKGCLADHLICLNCQG 327

Query: 275 TGGIRYSVSSGLSLNLPSENIGDTLKLSQLLNEWCKPEIIEGVNCYRCSLNAVLEHLENQ 334
           +  +     +   L +P E+   T  L  ++    + E IEG  C  C + A+L   E +
Sbjct: 328 SSKVNLHPFTMYPLPVPQEH---TASLEAMI-AGNQTETIEGYGCLSCKIKAILATEEQR 383

Query: 335 LKTMSEKPKGSIPDKLISAIKTRIKALNETLSKPVIDDE------EYKKMHTDNMVRKSS 388
                 K +G+ PD+  + + T  K ++E      + D+       YKK   D    KS+
Sbjct: 384 ------KYEGN-PDEENNILATLSKIVSEIFINDDLSDDLMNYINNYKKDGCDTSTLKST 436

Query: 389 KSKQIILARPPPLLSIHINRSVFDTRTFMIKKNNSRLAFKARL 431
             K+ ++   P +L +H++RSVF+   +   +N+  + F+  L
Sbjct: 437 IVKKTVVTESPDILILHLSRSVFNGMNYT--RNSCYVTFEEEL 477

 Score = 33.9 bits (76), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 21/30 (70%)

Query: 665 VPTGPLTYELRSVIVHYGTHNYGHYIAFRK 694
           V   P+ Y+L++++ H GTH+ GHY  +++
Sbjct: 490 VGVKPIKYKLKAMVKHEGTHSQGHYECYKR 519

>Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223W
           (REAL)
          Length = 471

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 40/68 (58%), Gaps = 4/68 (5%)

Query: 660 TYSTKVPTGPLTYELRSVIVHYGTHNYGHYIAFRKYR-GTWWRISDETVHMVDEAEVLST 718
           T + KVP   + YEL  ++ H GT N GHYIAF K   G W++ +D  V  + + EVL  
Sbjct: 401 TGNGKVP--DIIYELIGIVSHRGTVNEGHYIAFCKISGGQWFKFNDSVVTSIAQGEVLKE 458

Query: 719 PSVFMLFY 726
            + ++LFY
Sbjct: 459 QA-YLLFY 465

 Score = 36.6 bits (83), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 24/35 (68%)

Query: 27  VMKRGGFVGGLVNEGNTCFMNSVLQSLASSHEIVR 61
           +M+R   + GL+N G+TCFM+S+LQ L  +   +R
Sbjct: 129 IMERRDGLSGLINMGSTCFMSSILQCLIHNPYFIR 163

>Suva_16.240 Chr16 (429066..430637) [1572 bp, 523 aa] {ON} YPL072W
           (REAL)
          Length = 523

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 87/185 (47%), Gaps = 19/185 (10%)

Query: 258 PLDGIVAERIGCLNCGETGGIRYSVSSGLSLNLPSENIGDTLKLSQLLNEWCKPEIIEGV 317
           P  G  ++ + CL C       Y  S    L +P  +    +K+  L N+  + EIIEG 
Sbjct: 224 PFQGQTSKFLSCLQCHRLSKPSYQESFIRELMVPQRSSEKLMKI--LAND--ETEIIEGY 279

Query: 318 NCYRCSLNAVLEHLENQLKTMSEKPKGSIPDKLISAIKTRI--KALNETLSKPVIDDEEY 375
           +C  C + A+L H   + +T     +  +  +++ A+K      ++NE L    I  E+Y
Sbjct: 280 SCLICQVRAILNH--EKYRTFKNCSQDEL--RILDALKNYANDASINEDLP---IKVEQY 332

Query: 376 KKMHTDNMVR----KSSKSKQIILARPPPLLSIHINRSVFDTRTFMIKKNNSRLAFKARL 431
            K +  + +R    KS+  K+ I  + P +L IH++RS F+  T+   +N   + F+  +
Sbjct: 333 IKHYAKDKLRTSNVKSTVIKKDIAVQLPEVLVIHLSRSTFNGMTYT--RNPCNVEFEETI 390

Query: 432 NLKPW 436
            L  +
Sbjct: 391 KLAEY 395

 Score = 35.4 bits (80), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 19 NNLQIQNTVMKRGGFVG-GLVNEGNTCFMNSVLQSLASSHEIVRFL 63
          N L   N+  + G +   GL+N GN CF+ S LQSLA     V +L
Sbjct: 51 NALVFGNSKQRIGKYTTVGLINNGNDCFITSSLQSLAGIPRFVEYL 96

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 6/37 (16%)

Query: 663 TKVPTGP------LTYELRSVIVHYGTHNYGHYIAFR 693
           T +  GP      + Y L+SV+ H G+H+ GHY+ +R
Sbjct: 396 TSIEKGPSAEYRQIEYHLKSVVKHTGSHSRGHYVCYR 432

>YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}
           UBP8Ubiquitin-specific protease that is a component of
           the SAGA (Spt-Ada-Gcn5-Acetyltransferase) acetylation
           complex; required for SAGA-mediated deubiquitination of
           histone H2B
          Length = 471

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 38/64 (59%), Gaps = 4/64 (6%)

Query: 664 KVPTGPLTYELRSVIVHYGTHNYGHYIAFRKYR-GTWWRISDETVHMVDEAEVLSTPSVF 722
           KVP   + YEL  ++ H GT N GHYIAF K   G W++ +D  V  + + EVL   + +
Sbjct: 405 KVP--DIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQA-Y 461

Query: 723 MLFY 726
           +LFY
Sbjct: 462 LLFY 465

 Score = 35.4 bits (80), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 23/34 (67%)

Query: 28  MKRGGFVGGLVNEGNTCFMNSVLQSLASSHEIVR 61
           M+R   + GL+N G+TCFM+S+LQ L  +   +R
Sbjct: 130 MERRDGLSGLINMGSTCFMSSILQCLIHNPYFIR 163

>Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223W
           (REAL)
          Length = 473

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 38/64 (59%), Gaps = 4/64 (6%)

Query: 664 KVPTGPLTYELRSVIVHYGTHNYGHYIAFRKYR-GTWWRISDETVHMVDEAEVLSTPSVF 722
           KVP   + YEL  ++ H GT N GHYIAF K   G W++ +D  V  + + EVL   + +
Sbjct: 407 KVP--DIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQA-Y 463

Query: 723 MLFY 726
           +LFY
Sbjct: 464 LLFY 467

 Score = 35.4 bits (80), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 23/35 (65%)

Query: 27  VMKRGGFVGGLVNEGNTCFMNSVLQSLASSHEIVR 61
            M+R   + GL+N G+TCFM+S+LQ L  +   +R
Sbjct: 129 AMERRDGLSGLINMGSTCFMSSILQCLIHNPYFIR 163

>Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223W
           (REAL)
          Length = 471

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 38/64 (59%), Gaps = 4/64 (6%)

Query: 664 KVPTGPLTYELRSVIVHYGTHNYGHYIAFRKYR-GTWWRISDETVHMVDEAEVLSTPSVF 722
           KVP   + YEL  ++ H GT N GHYIAF K   G W++ +D  V  + + EVL   + +
Sbjct: 405 KVP--DIIYELIGIVSHKGTVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQA-Y 461

Query: 723 MLFY 726
           +LFY
Sbjct: 462 LLFY 465

 Score = 35.8 bits (81), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 21/27 (77%)

Query: 27  VMKRGGFVGGLVNEGNTCFMNSVLQSL 53
           +M+R   + GL+N G+TCFM+S+LQ L
Sbjct: 129 IMERRDGLSGLINMGSTCFMSSILQCL 155

>YNL186W Chr14 (289498..291876) [2379 bp, 792 aa] {ON}
           UBP10Ubiquitin-specific protease that deubiquitinates
           ubiquitin-protein moieties; may regulate silencing by
           acting on Sir4p; involved in posttranscriptionally
           regulating Gap1p and possibly other transporters;
           primarily located in the nucleus
          Length = 792

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 38/60 (63%), Gaps = 2/60 (3%)

Query: 669 PLTYELRSVIVHYG-THNYGHYIAF-RKYRGTWWRISDETVHMVDEAEVLSTPSVFMLFY 726
           P+ Y+L SV+VH G + + GHYIA  ++  G+W    DE ++++ E +VL  P+ + L Y
Sbjct: 671 PVKYQLLSVVVHEGRSLSSGHYIAHCKQPDGSWATYDDEYINIISERDVLKEPNAYYLLY 730

>KAFR0E00930 Chr5 (198914..200410) [1497 bp, 498 aa] {ON} Anc_8.540
           YPL072W
          Length = 498

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 53/185 (28%), Positives = 89/185 (48%), Gaps = 22/185 (11%)

Query: 258 PLDGIVAERIGCLNCGETGGIRYSVSSGLSLNLP---SENIGDTLKLSQLLNEWCKPEII 314
           P +G+ +  + CL C +     +S    L + +P   SE + D +  SQ        EII
Sbjct: 200 PFEGVSSNYLMCLQCNKYSQTIHSPFLMLEVAVPGNYSEKLTDLILHSQ-------DEII 252

Query: 315 EGVNCYRCSLNAVL--EHLENQLKTMSEKPKGSIPDKLISAIKTRIKALNETLSKPV--- 369
           EG +C  C +N +L  E   NQL   S++ + SI + L + I T    +N+ L   V   
Sbjct: 253 EGYSCLYCKVNMILKNEKYLNQLPEYSQEEQ-SILNFLRNQILTL--YINDDLPADVSFY 309

Query: 370 IDDEEYKKMHTDNMVRKSSKSKQIILARPPPLLSIHINRSVFDTRTFMIKKNNSRLAFKA 429
           +D        T N   KS+  K+  + + P  L +H++RS+F+  T  I ++  R+ ++ 
Sbjct: 310 VDHYSKNGCVTANF--KSNIIKKNAVIKEPASLIVHLSRSIFNGAT--ITRSACRVEYEQ 365

Query: 430 RLNLK 434
            LNL+
Sbjct: 366 SLNLQ 370

 Score = 38.1 bits (87), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 667 TGPLTYELRSVIVHYGTHNYGHYIAFRK 694
           T P+ YEL+SV+ H G+H  GHY  +RK
Sbjct: 382 TEPIKYELKSVVKHTGSHVQGHYQCYRK 409

>Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186W
           (REAL)
          Length = 788

 Score = 48.9 bits (115), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 37/60 (61%), Gaps = 2/60 (3%)

Query: 669 PLTYELRSVIVHYG-THNYGHYIAF-RKYRGTWWRISDETVHMVDEAEVLSTPSVFMLFY 726
           P+ Y+L SV+VH G + + GHYIA  ++  GTW    DE ++ + E +VL  P+ + L Y
Sbjct: 666 PVKYQLLSVVVHEGRSLSSGHYIAHCKQPDGTWATYDDEYINKISERDVLKEPNAYYLLY 725

>NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {ON}
           Anc_2.69 YNL186W
          Length = 870

 Score = 48.9 bits (115), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 37/60 (61%), Gaps = 2/60 (3%)

Query: 669 PLTYELRSVIVHYG-THNYGHYIAF-RKYRGTWWRISDETVHMVDEAEVLSTPSVFMLFY 726
           P  Y+L SV+VH G + + GHYIA  R+  GTW    DE ++ + E ++L+ P+ + L Y
Sbjct: 758 PAKYQLLSVVVHEGRSLSSGHYIAHCRQPDGTWATYDDELINKISELKLLTEPNAYYLVY 817

>TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa]
           {ON} Anc_2.69 YNL186W
          Length = 898

 Score = 48.5 bits (114), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 36/60 (60%), Gaps = 2/60 (3%)

Query: 669 PLTYELRSVIVHYG-THNYGHYIAFRKY-RGTWWRISDETVHMVDEAEVLSTPSVFMLFY 726
           P+ Y+L SV+VH G + + GHYIA  K   G+W    DE ++ + E E+L  P+ + L Y
Sbjct: 752 PVKYQLLSVVVHEGRSLSSGHYIAHCKQPDGSWATYDDEYINKISEREMLKEPNAYYLLY 811

>Ecym_1166 Chr1 (339106..341196) [2091 bp, 696 aa] {ON} similar to
           Ashbya gossypii AEL242W
          Length = 696

 Score = 48.5 bits (114), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 88/184 (47%), Gaps = 23/184 (12%)

Query: 258 PLDGIVAERIGCLNCGETGGI---RYSVSSGLSLNLPSENIGDTLKLSQLLNEWCKPEII 314
           P  G +A  + CL C  +  +   R+++ S     + S ++ D +  +Q        E I
Sbjct: 268 PFQGSLATNLICLRCNNSSKVNVHRFTMHSLPVPQMSSASLKDMMFDNQT-------ETI 320

Query: 315 EGVNCYRCSLNAVLEH-LENQLKTMSEKPKGSIPDKLISAIKTRIKALNETLSKPVIDDE 373
           EG +C  C L A+L +  +     +S++ +  + D  ++ +  RI  +N+ L +P+   E
Sbjct: 321 EGYSCISCRLRAILNNERQRDYHNVSQEERAKLDD--LAKLLPRI-CINDDLPEPL---E 374

Query: 374 EY-KKMHTDNMVRKSSKS---KQIILARPPPLLSIHINRSVFDTRTFMIKKNNSRLAFKA 429
            Y K  H D     S KS   K+ ++   P +L +H++RSVFD  T+   KN+  + F  
Sbjct: 375 LYVKSYHKDGCHIPSLKSRILKRTVVVSSPKVLLLHLSRSVFDGVTY--TKNSCNVLFPE 432

Query: 430 RLNL 433
            L L
Sbjct: 433 DLIL 436

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 26/50 (52%)

Query: 15  WVTKNNLQIQNTVMKRGGFVGGLVNEGNTCFMNSVLQSLASSHEIVRFLD 64
           W++  +  +  +  +   +  GL N  N CF NS +Q+LAS   +  +L+
Sbjct: 64  WLSPGSADMFKSSPREDRYTTGLTNSRNDCFANSSIQALASLPALAEYLN 113

>ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223W UBP8 Ubiquitin-specific protease that is a
           component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
           acetylation complex required for SAGA-mediated
           deubiquitination of histone H2B
          Length = 465

 Score = 48.1 bits (113), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 670 LTYELRSVIVHYGTHNYGHYIAFRKY-RGTWWRISDETVHMVDEAEVLSTPSVFMLFY 726
           + +EL  +I H GT N GHYIAF K   G W++ +D  V  + E E+L   + ++LFY
Sbjct: 403 IIFELIGIIAHRGTVNEGHYIAFTKVTTGHWFKFNDSMVSSITEEELLQEQA-YLLFY 459

>NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {ON}
           Anc_8.742
          Length = 493

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 670 LTYELRSVIVHYGTHNYGHYIAFRKYR-GTWWRISDETVHMVDEAEVLSTPSVFMLFY 726
           + YEL S+I H GT N GHYI   K   G W++ +D  V  + E E L   + ++LFY
Sbjct: 431 MIYELTSIISHKGTVNEGHYIVVVKVNDGQWFKFNDSMVSAITEEEALKQQA-YLLFY 487

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 24/34 (70%), Gaps = 2/34 (5%)

Query: 29  KRGGFVGGLVNEGNTCFMNSVLQSLASSHEIVRF 62
           K G F  GLVN G+TCFM+S+LQ+L  +  +V +
Sbjct: 133 KDGLF--GLVNMGSTCFMSSILQTLIHNPYVVNY 164

>Kpol_1044.24 s1044 (56564..58738) [2175 bp, 724 aa] {ON}
           (56564..58738) [2175 nt, 725 aa]
          Length = 724

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 36/60 (60%), Gaps = 2/60 (3%)

Query: 669 PLTYELRSVIVHYG-THNYGHYIAF-RKYRGTWWRISDETVHMVDEAEVLSTPSVFMLFY 726
           P+ Y+L SV+VH G + + GHYIA  R+  G+W    DE ++ + E  VL  P+ + L Y
Sbjct: 604 PVKYQLISVVVHEGRSLSSGHYIAHCRQPDGSWAIYDDEYINKISERNVLKEPNAYYLIY 663

>NCAS0G01800 Chr7 (319652..322279) [2628 bp, 875 aa] {ON} Anc_2.69
          Length = 875

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/69 (37%), Positives = 39/69 (56%), Gaps = 6/69 (8%)

Query: 664 KVPTG----PLTYELRSVIVHYG-THNYGHYIAF-RKYRGTWWRISDETVHMVDEAEVLS 717
           + P+G    P+ YEL SV+VH G + + GHYIA  R+  G+W    DE ++ + E  VL 
Sbjct: 679 ETPSGTKQLPVKYELLSVVVHEGRSLSSGHYIAHCRQPDGSWATYDDEYINKISELNVLK 738

Query: 718 TPSVFMLFY 726
             + + L Y
Sbjct: 739 EANAYYLLY 747

>NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.540
           YPL072W
          Length = 494

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 71/161 (44%), Gaps = 10/161 (6%)

Query: 255 LVTPLDGIVAERIGCLNCGETGGIRYSVSSGLSLNLPSENIGDTLKLSQLLNEWCKPEII 314
           L  P  GIV   + CL CG T  +         L LP +    ++KLS L+N   + E I
Sbjct: 187 LTVPFKGIVGNHLVCLQCGRTSHVNEQPFYIYELTLPQQG---SVKLSDLVNGE-QMETI 242

Query: 315 EGVNCYRCSLNAVLEHLENQLKTMSEKPKGSIPDKLISAIKTRIKAL--NETLSKPVID- 371
           E  +C  C   A+   L N+ +  S   +      ++  +K ++  L  NE L + +   
Sbjct: 243 ENYSCMYCKTVAM---LTNEREEKSNVSRTDAELNILKFLKGKLSTLLINEELPEHITHY 299

Query: 372 DEEYKKMHTDNMVRKSSKSKQIILARPPPLLSIHINRSVFD 412
              Y K + +    KS   ++   A  P +  IH++RSVF+
Sbjct: 300 INSYNKGYCNTSEIKSVIVRKSTFAEFPEIFLIHLSRSVFN 340

 Score = 33.9 bits (76), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 20/32 (62%)

Query: 33  FVGGLVNEGNTCFMNSVLQSLASSHEIVRFLD 64
           F  GLVN GN CF+NS +Q+L    ++  +L 
Sbjct: 74  FTTGLVNPGNDCFINSSIQALVPLDKLTTYLS 105

>KLTH0E12540g Chr5 complement(1111576..1113834) [2259 bp, 752 aa]
           {ON} some similarities with uniprot|Q02863 Saccharomyces
           cerevisiae YPL072W UBP16 Putative ubiquitin- specific
           protease
          Length = 752

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 80/160 (50%), Gaps = 15/160 (9%)

Query: 258 PLDGIVAERIGCLNCGETGGIRYSVSSGLSLNLPSENIGDTLKLSQLLNEWCKPEIIEGV 317
           P+ G +A+ + CLNC  +  +     +  SL +P E    +  LS ++ +  + E I+G 
Sbjct: 309 PVKGSLADHLICLNCQGSSKVNMHPFTMYSLPVPQE---PSASLSAMIAD-NQTETIDGY 364

Query: 318 NCYRCSLNAVLEHLENQLKTMSEKPKG-SIPDKLISAIKTRIKA---LNETLSKPVID-D 372
           +C  C + A+L + E +        KG S  ++ I A  +RI +   +N+ LS  + +  
Sbjct: 365 SCLSCKIKAILANEEQR------GSKGNSDEEQNILATLSRIISEIFINDDLSDELTNYV 418

Query: 373 EEYKKMHTDNMVRKSSKSKQIILARPPPLLSIHINRSVFD 412
             YKK   +    KS   K+ ++   P +L +H++RSVF+
Sbjct: 419 NNYKKDGCETSSIKSRIVKKTVVTESPEILILHLSRSVFN 458

 Score = 38.5 bits (88), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 21/30 (70%)

Query: 665 VPTGPLTYELRSVIVHYGTHNYGHYIAFRK 694
           V   P+ Y+L+S++ H GTH+ GHY  FR+
Sbjct: 488 VGVKPIKYKLKSMVKHQGTHSQGHYECFRR 517

>Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186W
           (REAL)
          Length = 776

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 36/60 (60%), Gaps = 2/60 (3%)

Query: 669 PLTYELRSVIVHYG-THNYGHYIAF-RKYRGTWWRISDETVHMVDEAEVLSTPSVFMLFY 726
           P+ Y+L SV+VH G + + GHYIA  ++  G W    DE ++ + E +VL  P+ + L Y
Sbjct: 654 PVKYQLLSVVVHEGRSLSSGHYIAHCKQPDGNWATYDDEYINKISERDVLKEPNAYYLLY 713

>KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.742
           YMR223W
          Length = 440

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 670 LTYELRSVIVHYGTHNYGHYIAFRKY-RGTWWRISDETVHMVDEAEVLSTPSVFMLFY 726
           + YEL  VI H GT N GHYIA  K     W++ +D  V  + E EVL   + ++LFY
Sbjct: 378 IIYELNGVISHIGTVNEGHYIATLKLDSNNWFKFNDSMVTSISEEEVLKDQA-YLLFY 434

 Score = 34.7 bits (78), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 24/36 (66%), Gaps = 1/36 (2%)

Query: 26  TVMKRGGFVGGLVNEGNTCFMNSVLQSLASSHEIVR 61
           TV  R G + G VN G+TCFM+S+LQ L  +  IV+
Sbjct: 113 TVTNRDG-LHGFVNMGSTCFMSSILQVLIHNPFIVQ 147

>SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa]
           {ON} similar to uniprot|P53874 Saccharomyces cerevisiae
           YNL186W UBP10 Ubiquitin-specific protease that
           deubiquitinates ubiquitin-protein moieties may regulate
           silencing by acting on Sir4p involved in
           posttranscriptionally regulating Gap1p and possibly
           other transporters primarily located in the nucleus
          Length = 739

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 37/62 (59%), Gaps = 2/62 (3%)

Query: 667 TGPLTYELRSVIVHYG-THNYGHYIAF-RKYRGTWWRISDETVHMVDEAEVLSTPSVFML 724
           T P+ Y+L SV+VH G + + GHYIA  ++  G+W    DE ++ + E ++L  P  + L
Sbjct: 622 TLPVKYQLISVVVHEGRSLSSGHYIAHCKQPDGSWATYDDEYINKITEKQMLKEPGAYYL 681

Query: 725 FY 726
            Y
Sbjct: 682 IY 683

>KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7.390
           YBL067C
          Length = 701

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 37/69 (53%), Gaps = 11/69 (15%)

Query: 672 YELRSVIVHYGTH-NYGHYIAFRKYRGTWWRI-SDETVHMVDEAEVLS-----TPSVFML 724
           YEL S ++H G    YGHYI+  K     W +  DETV  VDE  VLS     + + ++L
Sbjct: 559 YELASAVIHLGDGPQYGHYISLCKTETFGWLLFDDETVEAVDEQTVLSFTGENSDTAYVL 618

Query: 725 FY----EYD 729
           FY    EYD
Sbjct: 619 FYNEVSEYD 627

>KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {ON}
           some similarities with uniprot|P53874 Saccharomyces
           cerevisiae YNL186W UBP10 Ubiquitin-specific protease
           that deubiquitinates ubiquitin-protein moieties may
           regulate silencing by acting on Sir4p involved in
           posttranscriptionally regulating Gap1p and possibly
           other transporters primarily located in the nucleus
          Length = 750

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 36/60 (60%), Gaps = 2/60 (3%)

Query: 669 PLTYELRSVIVHYG-THNYGHYIAFRKYR-GTWWRISDETVHMVDEAEVLSTPSVFMLFY 726
           P+ Y+L SV+VH G + + GHYIA  K   G+W    DE ++ + E ++L  P+ + L Y
Sbjct: 636 PVRYQLISVVVHEGRSLSSGHYIAHCKQPDGSWATYDDEYINKISEKQLLKEPNAYFLVY 695

>TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {ON}
           Anc_8.742 YMR223W
          Length = 463

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 34/58 (58%), Gaps = 2/58 (3%)

Query: 670 LTYELRSVIVHYGTHNYGHYIAFRKYRG-TWWRISDETVHMVDEAEVLSTPSVFMLFY 726
           L YEL  V+ H GT N GHY+A  K  G  W++ +D  V  V + E L+  + ++LFY
Sbjct: 401 LIYELIGVVAHKGTVNEGHYVATTKVAGRQWFKFNDSMVSSVTQEEALNEQA-YLLFY 457

>CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa]
           {ON} similar to uniprot|P53874 Saccharomyces cerevisiae
           YNL186w UBP10
          Length = 771

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 36/60 (60%), Gaps = 2/60 (3%)

Query: 669 PLTYELRSVIVHYG-THNYGHYIAF-RKYRGTWWRISDETVHMVDEAEVLSTPSVFMLFY 726
           P+ YEL SV+VH G + + GHYIA  ++  G+W    DE ++ + E EVL   + + + Y
Sbjct: 659 PVKYELLSVVVHEGRSLSSGHYIAHCKQPDGSWATYDDEYINKITEREVLKERNAYYVLY 718

>KLTH0B07150g Chr2 complement(574195..576465) [2271 bp, 756 aa] {ON}
           some similarities with uniprot|P53874 Saccharomyces
           cerevisiae YNL186W UBP10 Ubiquitin-specific protease
           that deubiquitinates ubiquitin-protein moieties may
           regulate silencing by acting on Sir4p involved in
           posttranscriptionally regulating Gap1p and possibly
           other transporters primarily located in the nucleus
          Length = 756

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 36/62 (58%), Gaps = 2/62 (3%)

Query: 667 TGPLTYELRSVIVHYG-THNYGHYIAF-RKYRGTWWRISDETVHMVDEAEVLSTPSVFML 724
           T P+ Y+L SV+VH G +   GHYIA  ++  G+W    DE ++ + E ++L  P  + L
Sbjct: 643 TLPVKYQLISVVVHEGRSLTSGHYIAHCKQPDGSWSTYDDEYINKISERQMLKEPGAYYL 702

Query: 725 FY 726
            Y
Sbjct: 703 VY 704

>ZYRO0D03982g Chr4 (324687..327152) [2466 bp, 821 aa] {ON} weakly
           similar to uniprot|Q02863 Saccharomyces cerevisiae
           YPL072W UBP16 Putative ubiquitin-specific protease
          Length = 821

 Score = 45.4 bits (106), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 53/241 (21%), Positives = 111/241 (46%), Gaps = 22/241 (9%)

Query: 218 GQNNLSHVGTVYIPTAHLDPNSLLDKDPSTNYFTPFRLV-TPLDGIVAERIGCLNCGETG 276
           GQN+   +  V + T   + N +  ++ + N   P  +   P  G VA+ + C  C  + 
Sbjct: 295 GQNDAHELTQVILETLQKENNKI--REFAKNQKLPVDIPEIPFRGKVADHLVCTACRNSS 352

Query: 277 GIRYSVSSGLSLNLPSENIGDTLKLSQLLNEWCKPEIIEGVNCYRCSLNAVLEHLENQLK 336
            +R +  + L L +P      T KL++++++  + E IEG +C  C +  +LE+ + +  
Sbjct: 353 KVRVTQFNMLPLAVPQ---AITAKLAEMVSD-NQVESIEGYSCLTCKVGKILENEKGRDT 408

Query: 337 TMSEKPKGSIPDKLISAIKTRIKALNETLSKPVIDDEEYKKMHTDNMVR---KSSKSKQI 393
           +  E  + +    L  A       +N+ +S+ +++       + D +V    KS+  K+ 
Sbjct: 409 SSYETTEQNTLASLARAFPNL--TINDDVSEELMN--YINGYNRDGLVTSQLKSTIVKKN 464

Query: 394 ILARPPPLLSIHINRSVFDTRTFMIKKNNSRLAFKARLNLKPW------CCDVNDINLDA 447
           ++   P +L IH++RS+F+   +   +N   + F   L L+        C  +N +N + 
Sbjct: 465 VVVDAPQVLLIHLSRSMFNGTNYT--RNPCAVNFDEILQLQEQVIQNDRCVGINSVNYEL 522

Query: 448 R 448
           +
Sbjct: 523 K 523

 Score = 33.1 bits (74), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 10/24 (41%), Positives = 18/24 (75%)

Query: 670 LTYELRSVIVHYGTHNYGHYIAFR 693
           + YEL++++ H G+H+ GHY  +R
Sbjct: 518 VNYELKAIVKHAGSHSQGHYQCYR 541

>CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223w UBP8
          Length = 461

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 670 LTYELRSVIVHYGTHNYGHYIAFRKYR-GTWWRISDETVHMVDEAEVLSTPSVFMLFY 726
           + YEL  +I H G+ N GHY+AF K   G W++ +D  V  + E +VL   + ++LFY
Sbjct: 399 ILYELIGIISHTGSVNEGHYVAFCKIENGEWFKFNDSMVTKILEKDVLKEQA-YLLFY 455

 Score = 33.5 bits (75), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 11/30 (36%), Positives = 22/30 (73%)

Query: 34  VGGLVNEGNTCFMNSVLQSLASSHEIVRFL 63
           + GLVN G+TC+M+S++Q +  +  ++R+ 
Sbjct: 136 MAGLVNMGSTCYMSSIMQCIIHNPYMIRYF 165

>TDEL0A01100 Chr1 (186399..188384) [1986 bp, 661 aa] {ON} Anc_2.69
           YNL186W
          Length = 661

 Score = 45.1 bits (105), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 36/60 (60%), Gaps = 2/60 (3%)

Query: 669 PLTYELRSVIVHYG-THNYGHYIAF-RKYRGTWWRISDETVHMVDEAEVLSTPSVFMLFY 726
           P+ Y+L +V+VH G + + GHYI   ++  GTW    DE ++ + E +VL  P+ + L Y
Sbjct: 546 PVKYQLTTVVVHEGRSLSSGHYIVHCKQPDGTWATYDDEYINKITERDVLKEPNAYYLLY 605

>Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186W
           (UBP10) - predicted to encode a ubiquitin-processing
           protease [contig 103] PARTIAL
          Length = 511

 Score = 45.1 bits (105), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 35/60 (58%), Gaps = 2/60 (3%)

Query: 669 PLTYELRSVIVHYG-THNYGHYIAFRKYR-GTWWRISDETVHMVDEAEVLSTPSVFMLFY 726
           P+ Y+L SV+VH G + + GHYIA  K   G+W    DE ++ + E ++L  P  + L Y
Sbjct: 392 PVKYQLISVVVHEGRSLSSGHYIAHCKQPDGSWSTYDDEYINKISEKQMLKEPGAYYLVY 451

>Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] {ON}
            YOR124C (REAL)
          Length = 1278

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 8/63 (12%)

Query: 672  YELRSVIVHYGTHNYGHYIAF---RKYRGTWWRISDETVHMVDEAEVL-----STPSVFM 723
            Y L SV +H G  +YGHY  +   R Y G W + +DET+  V E EV      +T + + 
Sbjct: 1199 YSLFSVFIHRGEASYGHYWIYIKDRNYGGVWRKYNDETISEVQEEEVFNFNEGNTATPYF 1258

Query: 724  LFY 726
            L Y
Sbjct: 1259 LVY 1261

>NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa]
           {ON} Anc_8.188 YDR069C
          Length = 826

 Score = 45.1 bits (105), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 31/64 (48%), Gaps = 4/64 (6%)

Query: 667 TGPLTYELRSVIVHYGTHNYGHYIAFRK---YRGTWWRISDETVHMVDEAEVLSTPSVFM 723
           T P  Y+L +V  H G    GHY A+     YRG W+R  D +   V       TP  ++
Sbjct: 760 TPPFKYKLNAVSCHSGNLGSGHYTAYVDKGLYRG-WFRFDDASYRPVKFGTEFLTPDAYL 818

Query: 724 LFYE 727
           LFY+
Sbjct: 819 LFYQ 822

 Score = 35.4 bits (80), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 20/30 (66%)

Query: 33  FVGGLVNEGNTCFMNSVLQSLASSHEIVRF 62
           F  GL N  N+C+MN V+Q L S+H++ + 
Sbjct: 456 FTTGLENVKNSCYMNCVIQCLLSTHDLTKL 485

>TPHA0O01640 Chr15 complement(325844..328084) [2241 bp, 746 aa] {ON}
           Anc_2.69 YNL186W
          Length = 746

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 34/59 (57%), Gaps = 2/59 (3%)

Query: 670 LTYELRSVIVHYG-THNYGHYIAFRKY-RGTWWRISDETVHMVDEAEVLSTPSVFMLFY 726
           + Y+L SV+VH G + + GHYIA  K   GTW    DE  +++ E  VL  P+ + L Y
Sbjct: 614 VMYQLISVVVHEGRSLSSGHYIAHCKQPDGTWATYDDEYTNIISERNVLKEPNAYYLVY 672

>KNAG0F01220 Chr6 (219798..222152) [2355 bp, 784 aa] {ON} Anc_2.69
           YNL186W
          Length = 784

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 43/75 (57%), Gaps = 3/75 (4%)

Query: 669 PLTYELRSVIVHYG-THNYGHYIAF-RKYRGTWWRISDETVHMVDEAEVLSTPSVFMLFY 726
           P+ Y+L SV+VH G + + GHYIA  ++  G+W    DE ++ + E +VL   + + L Y
Sbjct: 642 PVKYQLISVVVHEGRSLSSGHYIAHCKQPDGSWSTYDDEYINKITERDVLRESNAYYLVY 701

Query: 727 EYDFDEKSGMMKDDL 741
                 K+  ++DDL
Sbjct: 702 TR-LTSKAIKLRDDL 715

>Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa]
           {ON} YMR223W (UBP8) - putative deubiquitinating enzyme
           [contig 70] FULL
          Length = 454

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 34/62 (54%), Gaps = 2/62 (3%)

Query: 666 PTGPLTYELRSVIVHYGTHNYGHYIAFRKY-RGTWWRISDETVHMVDEAEVLSTPSVFML 724
           P   + YEL +VI H G+ N GHY +  K   G W+R +D  +  + E E L   + ++L
Sbjct: 388 PVPDMMYELVAVISHEGSVNQGHYTSMCKIPGGQWFRFNDSMIVSISEEEALRQQA-YLL 446

Query: 725 FY 726
           FY
Sbjct: 447 FY 448

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 18/21 (85%)

Query: 34  VGGLVNEGNTCFMNSVLQSLA 54
           + GLVN G+TCFM+S++Q+L 
Sbjct: 135 LCGLVNMGSTCFMSSIIQTLV 155

>ZYRO0C09812g Chr3 complement(743861..745969) [2109 bp, 702 aa] {ON}
           some similarities with uniprot|P53874 Saccharomyces
           cerevisiae YNL186W UBP10 Ubiquitin-specific protease
           that deubiquitinates ubiquitin-protein moieties may
           regulate silencing by acting on Sir4p involved in
           posttranscriptionally regulating Gap1p and possibly
           other transporters primarily located in the nucleus
          Length = 702

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 36/60 (60%), Gaps = 2/60 (3%)

Query: 669 PLTYELRSVIVHYG-THNYGHYIAF-RKYRGTWWRISDETVHMVDEAEVLSTPSVFMLFY 726
           PL Y+L +V+VH G + + GHYI   ++  G W    DE ++ ++E +VL  P+ + L Y
Sbjct: 584 PLKYQLITVVVHEGRSLSSGHYIVHCKQPEGHWATYDDEYINNINEKDVLREPNAYYLVY 643

>NDAI0E02820 Chr5 (598119..599606) [1488 bp, 495 aa] {ON} Anc_8.540
           YPL072W
          Length = 495

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 80/175 (45%), Gaps = 31/175 (17%)

Query: 257 TPLDGIVAERIGCLNCGETGGIRYSVSSGLSLNLP---SENIGDTLKLSQLLNEWCKPEI 313
            P+ G+V   + C+ CG    I+  + S   LN+P   S  + D +  +QL       E 
Sbjct: 189 VPMKGVVGNHLICIRCGHISQIKEEMFSIYELNVPQCSSSKLTDIIHNNQL-------EK 241

Query: 314 IEGVNCYRCSLNAVLEHLENQLKTMSEKPKGSIPDKLISAIKTRIKALNETLSKPVIDDE 373
           IEG +C  C +N +   L+N+    S+   G   +      K +++ L E     ++ ++
Sbjct: 242 IEGYSCLYCEINMI---LKNENYRNSDGFTGDDEE------KRKLRYLKEVFLNNLMINQ 292

Query: 374 E-----------YKKMHTD-NMVRKSSKSKQIILARPPPLLSIHINRSVFDTRTF 416
           E           YK+ + D + + KS   ++  L + P +L IH++RS+++   +
Sbjct: 293 ELPDDIMHYIKSYKRGYCDISKMEKSDIFRKRRLLQCPKVLLIHLSRSMYNGMAY 347

 Score = 32.0 bits (71), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 27/47 (57%), Gaps = 2/47 (4%)

Query: 670 LTYELRSVIVHYGTHNYGHYIAFRKYRGTWWRISDETVHMVDEAEVL 716
           + YEL+S++ H G+H  GHY  +R       RI+ E   +++ + V+
Sbjct: 384 IRYELKSLVKHTGSHYQGHYQCYR--HKPKLRINKENGEIINRSSVI 428

>CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {ON}
           weakly similar to uniprot|P36026 Saccharomyces
           cerevisiae YKR098c UBP11 ubiquitin C-terminal hydrolase
          Length = 631

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/197 (25%), Positives = 87/197 (44%), Gaps = 27/197 (13%)

Query: 256 VTPLD----GIVAERIGCLNCGETGGIRYSVSSGLSLNLPSENIG-----DTLKLSQLLN 306
           ++P+D    G V  ++ C +C E+    +S    LSLN+P E         T++L   +N
Sbjct: 360 LSPIDLLFRGDVESKLICKHCNESAST-FSSFYILSLNIPKEKSSLFFKSKTIRLEDCIN 418

Query: 307 EWCKPEIIEGVN---CYRCSLNAVLEHLENQLKTMSEK----PKGSIPDKLISAIKTRIK 359
            + + EI+ G N   C  C   A    ++N  KT  +K     K S   +  S I+    
Sbjct: 419 LFTRKEILTGENSWACPSCETKARYNVIDND-KTYQQKHTNIGKHSKFPRFFSHIEAGKT 477

Query: 360 ALNETLSKPVIDDEEYKKMHTDNMVRKSSKSKQII---LARPPPLLSIHINRSVFDTRTF 416
             N   +K      +Y  +  +   R+  KS+ I+       PP+L IH++R  +D    
Sbjct: 478 ERNSGANK--FSQLKYDNLENEQRHRQQKKSETILSVSFVSLPPILVIHLSRFCYD---- 531

Query: 417 MIKKNNSRLAFKARLNL 433
           + KKN S +++   L +
Sbjct: 532 ISKKNTSNISYPMSLTV 548

>Smik_14.144 Chr14 (268784..271075) [2292 bp, 763 aa] {ON} YNL186W
           (REAL)
          Length = 763

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 36/60 (60%), Gaps = 2/60 (3%)

Query: 669 PLTYELRSVIVHYG-THNYGHYIAF-RKYRGTWWRISDETVHMVDEAEVLSTPSVFMLFY 726
           P+ Y+L SV+VH G + + GHYIA  ++  G+W    DE ++ + E +VL   + + L Y
Sbjct: 641 PVKYQLLSVVVHEGRSLSSGHYIAHCKQPDGSWATYDDEYINKISERDVLKETNAYYLLY 700

>Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON}
           YER144C (REAL)
          Length = 805

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 24/33 (72%), Gaps = 1/33 (3%)

Query: 33  FVGGLVNEGNTCFMNSVLQSLASSHEIVR-FLD 64
           F+ GL N GN C+MN +LQ L  +H++VR FLD
Sbjct: 444 FIVGLENTGNCCYMNCILQCLVGTHDLVRMFLD 476

 Score = 36.6 bits (83), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 4/65 (6%)

Query: 669 PLTYELRSVIVHYGTHNYGHYIAFRKYRGT---WWRISDETVHMVDEAEVLSTPSVFMLF 725
           P  Y L  V  H G+   GHY ++  Y+G    W+   D     +   +   TP+ ++LF
Sbjct: 742 PFRYRLYGVACHSGSLYGGHYTSY-VYKGPKKGWYFFDDSIYRPIRFNDEFITPNAYVLF 800

Query: 726 YEYDF 730
           YE  F
Sbjct: 801 YERIF 805

>KNAG0A01970 Chr1 (157670..159085) [1416 bp, 471 aa] {ON} Anc_8.540
           YPL072W
          Length = 471

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 65/123 (52%), Gaps = 10/123 (8%)

Query: 312 EIIEGVNCYRCSLNAVLEHLENQLKTMSEKPKGSIPDKLISAIKTRIKAL--NETLSKPV 369
           E+IE  +C  C + A+L +  N     + KP      +++ ++++ +  L  N  L   +
Sbjct: 243 ELIEDYSCLYCQITAILTNESN-----TTKPPTGFEAEMVGSLQSLLPDLKINTALPDTL 297

Query: 370 ID-DEEYKKMHTDNMVRKSSKSKQIILARPPPLLSIHINRSVFDTRTFMIKKNNSRLAFK 428
           +D  + Y+K + +  + K++  ++  ++  P +LS+H++RS+F+  +F   +N  R+ + 
Sbjct: 298 LDYVKSYRKGNCNTSILKTAIIRRTAISNAPSILSLHLSRSMFNGASF--TRNPCRVEYP 355

Query: 429 ARL 431
             L
Sbjct: 356 ETL 358

 Score = 36.6 bits (83), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 28/96 (29%), Positives = 38/96 (39%), Gaps = 38/96 (39%)

Query: 670 LTYELRSVIVHYGTHNYGHYIAFR------KYRGT------------------------- 698
           +TY LRS+I H GTH  GHY  ++      K  GT                         
Sbjct: 373 ITYRLRSMIKHTGTHYSGHYQCYKHKPDLVKLMGTGVTVNRSPTVLARPPMIQERVKTPK 432

Query: 699 ------WWRISDETVHMVDEAEVL-STPSVFMLFYE 727
                 +W ISD  V   +  ++L  +  V+MLFYE
Sbjct: 433 SVRRWPYWFISDAVVRESNAGKMLRESKYVYMLFYE 468

>Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] {ON}
            YOR124C (REAL)
          Length = 1272

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 8/63 (12%)

Query: 672  YELRSVIVHYGTHNYGHYIAF---RKYRGTWWRISDETVHMVDEAEVL-----STPSVFM 723
            Y L SV +H G  +YGHY  +   R + G W + +DETV  V E EV      +T + + 
Sbjct: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNHNGVWRKYNDETVSEVQEDEVFNFNEGNTATPYF 1252

Query: 724  LFY 726
            L Y
Sbjct: 1253 LVY 1255

>SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223W UBP8 Ubiquitin-specific protease that is a
           component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
           acetylation complex required for SAGA-mediated
           deubiquitination of histone H2B
          Length = 454

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 34/61 (55%), Gaps = 2/61 (3%)

Query: 667 TGPLTYELRSVIVHYGTHNYGHYIAFRKY-RGTWWRISDETVHMVDEAEVLSTPSVFMLF 725
           T  + YEL  +I H G+ N GHY +  K   G W++ +D  V  V E +VL   + ++LF
Sbjct: 389 TPAIVYELIGLISHQGSVNQGHYTSICKIPGGQWFKFNDSMVTAVAEIDVLKEQA-YLLF 447

Query: 726 Y 726
           Y
Sbjct: 448 Y 448

 Score = 35.8 bits (81), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 27/36 (75%), Gaps = 1/36 (2%)

Query: 26  TVMKRGGFVGGLVNEGNTCFMNSVLQSLASSHEIVR 61
           +V KR G + GLVN G+TCFM+S++Q+L  +  I++
Sbjct: 128 SVEKRNG-LAGLVNMGSTCFMSSIIQTLIHNPYILK 162

>TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5.443
            YOR124C
          Length = 1272

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 35/65 (53%), Gaps = 8/65 (12%)

Query: 670  LTYELRSVIVHYGTHNYGHYIAFRKYR---GTWWRISDETVHMVDEAEVL-----STPSV 721
            + Y L +V +H G  +YGHY  + K R   GTW + +DET+  V E EV      +T + 
Sbjct: 1189 IGYSLFAVFIHRGEASYGHYWVYIKDRSKNGTWRKYNDETITEVPETEVFNFTEGNTATP 1248

Query: 722  FMLFY 726
            + L Y
Sbjct: 1249 YFLVY 1253

>Skud_16.209 Chr16 (389855..391366) [1512 bp, 503 aa] {ON} YPL072W
           (REAL)
          Length = 503

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 82/189 (43%), Gaps = 27/189 (14%)

Query: 258 PLDGIVAERIGCLNCGETGGIRYSVSSGLSLNLP---SENIGDTLKLSQLLNEWCKPEII 314
           P +G  ++ + C+ C     I +  +    L++P   SEN+ D L   +        EII
Sbjct: 212 PFEGETSKFLVCVQCNGLSKISHQKTFIRELSVPQKSSENLLDILSNDE-------TEII 264

Query: 315 EGVNCYRCSLNAVLEHLENQLKTMSEKPKGSIPDKL--ISAIKTRI--KALNETLSKPVI 370
           E  +C  C   A+L H   Q +      K   PD+L  + A+K      ++NE L  P+ 
Sbjct: 265 EDYSCLICRARAILAH--EQYRNF----KDCAPDELLILDALKDYATEASINEDL--PLE 316

Query: 371 DDEEYKKMHTDNMVRKSSKSKQI---ILARPPPLLSIHINRSVFDTRTFMIKKNNSRLAF 427
            D+       D     + K K I   I  + P +L IH++RS F+  T+   +N   + F
Sbjct: 317 IDQYINHYTKDKFCISNVKGKVIKRDIAVKLPKVLVIHLSRSTFNGVTY--SRNPCNVKF 374

Query: 428 KARLNLKPW 436
           +  + L  +
Sbjct: 375 QEEIKLTEY 383

 Score = 35.4 bits (80), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 19/29 (65%)

Query: 36 GLVNEGNTCFMNSVLQSLASSHEIVRFLD 64
          GL+N GN CF+ S LQ+LA     V +L+
Sbjct: 59 GLINRGNDCFITSALQALAGIPRFVEYLN 87

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 28/48 (58%), Gaps = 2/48 (4%)

Query: 670 LTYELRSVIVHYGTHNYGHYIAFRKYRGTWWRISDETVHMVDEAEVLS 717
           + Y L+SV+ H G+H+ GHY+ +R+     +   DE+   VD   +++
Sbjct: 397 IVYNLKSVVKHTGSHSRGHYMCYRRKGDILFDKEDES--FVDSRSIIT 442

>NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742
          Length = 466

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 2/65 (3%)

Query: 663 TKVPTGPLTYELRSVIVHYGTHNYGHYIAFRKYR-GTWWRISDETVHMVDEAEVLSTPSV 721
           T   T  + YEL  ++ H G+ N GHY+   K   G W++ +D  + ++ E E L   + 
Sbjct: 397 TNQETPDIIYELTGILSHIGSINEGHYVVVLKINDGRWFKFNDSMISVIKEDEALKQQA- 455

Query: 722 FMLFY 726
           ++LFY
Sbjct: 456 YLLFY 460

 Score = 35.8 bits (81), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 24/34 (70%), Gaps = 1/34 (2%)

Query: 29  KRGGFVGGLVNEGNTCFMNSVLQSLASSHEIVRF 62
           +R G  G LVN G+TCFM+S+LQ+L  +  IV +
Sbjct: 133 RRDGLFG-LVNMGSTCFMSSILQALIHNPYIVNY 165

>KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.742
           YMR223W
          Length = 459

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 1/61 (1%)

Query: 666 PTGPLTYELRSVIVHYGTHNYGHYIAFRKY-RGTWWRISDETVHMVDEAEVLSTPSVFML 724
           PT  + Y L  V+ H GT N GHY A  +   G W++ +D  + +V   +VL   +  +L
Sbjct: 390 PTTSIVYRLSGVVSHSGTVNEGHYTAVLQLNSGEWFKFNDSMISVVSAEDVLREQAYLLL 449

Query: 725 F 725
           +
Sbjct: 450 Y 450

 Score = 35.0 bits (79), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 22/28 (78%), Gaps = 1/28 (3%)

Query: 26  TVMKRGGFVGGLVNEGNTCFMNSVLQSL 53
           T ++R G  G L+N G+TCFM+S+LQSL
Sbjct: 129 TSLRRDGLYG-LLNLGSTCFMSSILQSL 155

>Kpol_1024.44 s1024 (118060..119550) [1491 bp, 496 aa] {ON}
           (118060..119550) [1491 nt, 497 aa]
          Length = 496

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 48/205 (23%), Positives = 91/205 (44%), Gaps = 33/205 (16%)

Query: 258 PLDGIVAERIGCLNCGETGGIRYSVSSGLSLNLPSENIGDTLKLSQLLNEWCKPEIIEG- 316
           P +G +A  + CLNCG+T     S  + L +  P E   +              EII G 
Sbjct: 208 PFEGKLASYLSCLNCGQTSIPNISTFNILPIQTPQEYSAEL------------EEIIYGN 255

Query: 317 -------VNCYRCSLNAVLEHLENQLKTMSEKPKGSIPDKLISAIKTRIKAL--NETLSK 367
                   +C  C  NA+L++     KT   K   +   +++  ++  +  L  NE L  
Sbjct: 256 QIDQITDYSCLVCQTNAILKN----EKTNGHKGNTTDEHEIVKYLEDVLPVLRINEELDS 311

Query: 368 PVIDDEEYKK---MHTDNMVRKSSKSKQIILARPPPLLSIHINRSVFDTRTFMIKKNNSR 424
             ++  +Y     M + N+  KS+  K+  +   P +L IH++RS+++    +  +N+ R
Sbjct: 312 KTLNYIKYYNKYGMKSGNI--KSTIIKKNSIIETPKILMIHLSRSIYNGMVAV--RNSCR 367

Query: 425 LAFKARLNLKPWCCDVNDINLDARL 449
           + F+ +++++    D  + NL   L
Sbjct: 368 VRFEEKMSIERQTTDEKNENLKIEL 392

 Score = 35.8 bits (81), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 13/23 (56%), Positives = 18/23 (78%)

Query: 672 YELRSVIVHYGTHNYGHYIAFRK 694
           Y+L+S+I H GTHN GHY  +R+
Sbjct: 395 YQLQSIIKHTGTHNSGHYQCYRR 417

>Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON}
           (88495..89895) [1401 nt, 467 aa]
          Length = 466

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 670 LTYELRSVIVHYGTHNYGHYIAFRKY-RGTWWRISDETVHMVDEAEVLSTPSVFMLF 725
           L YEL  +I H GT N GHY A  K   G W + +D  V ++ E  +L   +  +++
Sbjct: 404 LIYELIGIICHTGTVNEGHYTAICKIPEGQWIKFNDSMVTIISEETMLKEQAYLLIY 460

>ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL186W (UBP10)
          Length = 749

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 35/60 (58%), Gaps = 2/60 (3%)

Query: 669 PLTYELRSVIVHYG-THNYGHYIAF-RKYRGTWWRISDETVHMVDEAEVLSTPSVFMLFY 726
           P+ Y+L SV+VH G + + GHYIA  ++  GTW    DE ++ + E  VL   + + L Y
Sbjct: 635 PVKYQLISVVVHEGRSLSSGHYIAHCKQPDGTWATYDDEYINKITERNVLKEVNAYYLVY 694

>YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}
            UBP2Ubiquitin-specific protease that removes ubiquitin
            from ubiquitinated proteins; interacts with Rsp5p and is
            required for MVB sorting of membrane proteins; can cleave
            polyubiquitin and has isopeptidase activity
          Length = 1272

 Score = 42.7 bits (99), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 8/63 (12%)

Query: 672  YELRSVIVHYGTHNYGHYIAFRKYR---GTWWRISDETVHMVDEAEVL-----STPSVFM 723
            Y L SV +H G  +YGHY  + K R   G W + +DET+  V E EV      +T + + 
Sbjct: 1193 YSLFSVFIHRGEASYGHYWIYIKDRNRNGIWRKYNDETISEVQEEEVFNFNEGNTATPYF 1252

Query: 724  LFY 726
            L Y
Sbjct: 1253 LVY 1255

>NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {ON}
           Anc_7.390 YBL067C
          Length = 827

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 37/70 (52%), Gaps = 9/70 (12%)

Query: 672 YELRSVIVHYGTH-NYGHYIAFRKY-RGTWWRISDETVHMVDEAEVL-------STPSVF 722
           Y+L+ ++VH G+    GHY+A  K  +  W    DET   ++E EVL       S  + +
Sbjct: 672 YKLQGIVVHMGSSPQQGHYVAICKTDKYGWLLFDDETASWINEEEVLSFIGDEKSQNTAY 731

Query: 723 MLFYEYDFDE 732
           +LFYE   DE
Sbjct: 732 VLFYEEVKDE 741

>Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {ON}
            YOR124C (REAL)
          Length = 1270

 Score = 42.4 bits (98), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 8/63 (12%)

Query: 672  YELRSVIVHYGTHNYGHYIAFRKYR---GTWWRISDETVHMVDEAEVL-----STPSVFM 723
            Y L SV +H G  +YGHY  + K R   G W + +DET+  V E EV      +T + + 
Sbjct: 1191 YSLFSVFIHRGEASYGHYWIYIKDRNQNGVWRKYNDETISEVPEEEVFNFNEGNTATPYF 1250

Query: 724  LFY 726
            L Y
Sbjct: 1251 LVY 1253

>TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {ON}
           Anc_8.742 YMR223W
          Length = 483

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 35/70 (50%), Gaps = 1/70 (1%)

Query: 663 TKVPTGPLTYELRSVIVHYGTHNYGHYIAFRKYR-GTWWRISDETVHMVDEAEVLSTPSV 721
           T   T  + YEL  ++ H GT N GHYI + K   G W++ +D  V  V   ++L   + 
Sbjct: 414 TNKSTPDMIYELTGIVTHRGTVNEGHYITYTKTADGVWYQFNDSVVMKVPLEQMLKEQAY 473

Query: 722 FMLFYEYDFD 731
            +++    F+
Sbjct: 474 LLIYTIRQFN 483

>Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON}
           YER144C (REAL)
          Length = 788

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 28/44 (63%), Gaps = 2/44 (4%)

Query: 23  IQN-TVMKRGGFVGGLVNEGNTCFMNSVLQSLASSHEIVR-FLD 64
           IQN T M    F+ GL N GN C+MN +LQ L  +H++ R FLD
Sbjct: 416 IQNSTQMFDLDFIVGLENMGNCCYMNCILQCLVGTHDLTRMFLD 459

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 4/65 (6%)

Query: 669 PLTYELRSVIVHYGTHNYGHYIAFRKYRGT---WWRISDETVHMVDEAEVLSTPSVFMLF 725
           P  Y L  V  H G+   GHY ++  Y+G    W+   D    ++       TP+ ++LF
Sbjct: 725 PFRYRLYGVACHSGSLYGGHYTSY-VYKGPQKGWYFFDDTIYRLIRFNNEFITPNAYVLF 783

Query: 726 YEYDF 730
           YE  F
Sbjct: 784 YERIF 788

>YPL072W Chr16 (418512..420011) [1500 bp, 499 aa] {ON}
           UBP16Deubiquitinating enzyme anchored to the outer
           mitochondrial membrane, probably not important for
           general mitochondrial functioning, but may perform a
           more specialized function at mitochondria
          Length = 499

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 45/189 (23%), Positives = 84/189 (44%), Gaps = 27/189 (14%)

Query: 258 PLDGIVAERIGCLNCGETGGIRYSVSSGLSLNLP---SENIGDTLKLSQLLNEWCKPEII 314
           P +G  ++ + CL C       Y  +    L++P   SEN+ + L   +        EII
Sbjct: 204 PFEGETSKFLVCLKCKGLSEPSYKQTFIRELSVPQQTSENLSNILAHDE-------TEII 256

Query: 315 EGVNCYRCSLNAVLEHLENQLKTMSEKPKGSIPDKLISAIKTRIKA----LNETLSKPVI 370
           +  +C  C + A+L H E +        K   PD+++   + +  A    +NE L  P  
Sbjct: 257 DDYSCLICQIRAILNHEEYR------NFKDCTPDEILMLDRLKNYATKAPINENL--PFE 308

Query: 371 DDEEYKKMHTDNMVRKSSKSKQI---ILARPPPLLSIHINRSVFDTRTFMIKKNNSRLAF 427
            ++  K+    N+   + K K I   ++ + P +L +H++RS F+  T+   +N   + F
Sbjct: 309 VEQYVKRYSKGNLQVSNIKGKVIKKDVVVQLPDILIVHLSRSTFNGITY--SRNPCNVKF 366

Query: 428 KARLNLKPW 436
             R+ L  +
Sbjct: 367 GERITLSEY 375

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 7/52 (13%)

Query: 670 LTYELRSVIVHYGTHNYGHYIAFRKYRGTWWRISDETVHMVDEAEVLSTPSV 721
           + Y L+SV+ H G+H+ GHY+ +R  R T  R   E     DE+     P V
Sbjct: 389 VKYNLKSVVKHTGSHSSGHYMCYR--RKTEIRFGKE-----DESSFRRAPVV 433

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 17/28 (60%)

Query: 36 GLVNEGNTCFMNSVLQSLASSHEIVRFL 63
          GL+N GN CF+ S LQ LA     V +L
Sbjct: 54 GLINRGNDCFITSSLQGLAGIPRFVEYL 81

>TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7.390
           YBL067C
          Length = 727

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 37/66 (56%), Gaps = 11/66 (16%)

Query: 672 YELRSVIVHYG-THNYGHYIAFRKYRGTWWRI-SDETVHMVDEAEVLS--------TPSV 721
           YEL S++VH G +   GHY+   K++   W I  DETV  V + E++S        + + 
Sbjct: 587 YELNSIVVHIGESPQLGHYVTLCKHKSYGWLIYDDETVQAVSD-ELVSRILNNEQRSATA 645

Query: 722 FMLFYE 727
           ++LFYE
Sbjct: 646 YLLFYE 651

>ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] {ON}
            similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124C UBP2 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions capable of cleaving
            polyubiquitin and possesses isopeptidase activity
          Length = 1305

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 35/65 (53%), Gaps = 8/65 (12%)

Query: 670  LTYELRSVIVHYGTHNYGHYIAFRKYR---GTWWRISDETVHMVDEAEVL-----STPSV 721
            + Y L +V +H G  +YGHY  + K R   G W + +DET+  V E+EV      +T + 
Sbjct: 1221 IGYSLFAVFIHRGEASYGHYWIYIKDRYKSGIWRKYNDETITEVPESEVFNFSEGNTATP 1280

Query: 722  FMLFY 726
            + L Y
Sbjct: 1281 YFLVY 1285

>Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON}
            (51365..55165) [3801 nt, 1267 aa]
          Length = 1266

 Score = 42.0 bits (97), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 8/65 (12%)

Query: 670  LTYELRSVIVHYGTHNYGHYIAFRK---YRGTWWRISDETVHMVDEAEVL-----STPSV 721
            + Y L +V +H G  +YGHY  + K     G W + +DET+  V EAEV      +T + 
Sbjct: 1186 IGYSLFAVFIHRGEASYGHYWVYIKDFTKNGIWRKYNDETITEVPEAEVFNFTEGNTATP 1245

Query: 722  FMLFY 726
            + L Y
Sbjct: 1246 YFLVY 1250

>AEL242W Chr5 (182610..184451) [1842 bp, 613 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL072W (UBP16)
          Length = 613

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 80/175 (45%), Gaps = 9/175 (5%)

Query: 258 PLDGIVAERIGCLNCGETGGIRYSVSSGLSLNLPSENIGDTLKLSQLLNEWCKPEIIEGV 317
           P+ G +A+ + CL CG +  +     S  +L +P+    D   L  +L +  + E I+  
Sbjct: 252 PIRGSLADNLVCLRCGGSSKVNVHQFSMHTLPVPNATSAD---LRDMLFD-NQTETIDDY 307

Query: 318 NCYRCSLNAVLEHLENQLKTMSEKPKGSIPDKLISAIKTRIKALNETLSKPVID-DEEYK 376
            C  C + A+L   +N+ +   +  + +I ++L     +   ++NE +   +      Y 
Sbjct: 308 TCVSCQIRAILATEKNRGRQGVDSTELAIIEELARLAPS--ISINEDMPPHLAAYVSAYN 365

Query: 377 KMHTDNMVRKSSKSKQIILARPPPLLSIHINRSVFDTRTFMIKKNNSRLAFKARL 431
           K H      KS+  K+ +    P +L +H++RSVF+  ++   KN   + F   L
Sbjct: 366 KDHCITAALKSTIVKRTVSVDSPRVLILHLSRSVFNGVSY--AKNTCNVTFPEEL 418

 Score = 32.3 bits (72), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 12/22 (54%), Positives = 16/22 (72%)

Query: 672 YELRSVIVHYGTHNYGHYIAFR 693
           Y+L ++I H GTH+ GHY  FR
Sbjct: 438 YKLCAMIKHIGTHSQGHYACFR 459

>KAFR0A07580 Chr1 complement(1528362..1530770) [2409 bp, 802 aa]
           {ON} Anc_2.69 YNL186W
          Length = 802

 Score = 41.6 bits (96), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 35/60 (58%), Gaps = 2/60 (3%)

Query: 669 PLTYELRSVIVHYG-THNYGHYIAF-RKYRGTWWRISDETVHMVDEAEVLSTPSVFMLFY 726
           P+ Y+L SV+VH G + + GHY+A  ++  G W    DE ++ + + EVL   + + L Y
Sbjct: 670 PVKYQLISVVVHEGRSLSSGHYVAHCKQPDGLWATYDDEYINKISDKEVLRETNAYYLVY 729

>TDEL0B03060 Chr2 (545366..547570) [2205 bp, 734 aa] {ON} Anc_8.540
           YPL072W
          Length = 734

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 41/180 (22%), Positives = 83/180 (46%), Gaps = 27/180 (15%)

Query: 258 PLDGIVAERIGCLNCGETGGIRYSVSSGLSLNLPSENIGDTLKLSQLLNEWCKPEIIEGV 317
           P  G +A+ + C+ C  +  +         L +P      + KLS ++++  + + IEG 
Sbjct: 297 PFGGQLADHLVCMKCTNSSKVNIHPFIIYPLTVPQ---AMSAKLSDMVSD-NQTDTIEGY 352

Query: 318 NCYRCSLNAVLEHLENQLKTMSEKPKGSIPDKLISAIKTRIKALNETLSKPVIDDEEYKK 377
           +C  C ++ ++ +         EK +G    K     K  +K L + L    I+DE   +
Sbjct: 353 SCLTCKVSTIVNY---------EKGRGYA--KCTQEEKRILKTLEDALPDMAINDELSDE 401

Query: 378 MHT-------DNMV---RKSSKSKQIILARPPPLLSIHINRSVFDTRTFMIKKNNSRLAF 427
           + +       D +V    KS+  K+ ++   P  L +H++RS+FD  ++  ++N+  +AF
Sbjct: 402 LTSYINSYNKDGIVGADLKSTIVKKTVVVESPKTLVMHLSRSMFDGISY--QRNSCGVAF 459

 Score = 35.8 bits (81), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 21/29 (72%)

Query: 665 VPTGPLTYELRSVIVHYGTHNYGHYIAFR 693
           V   P++Y+L++++ H G+H+ GHY  +R
Sbjct: 476 VGINPISYKLKAIVAHSGSHSQGHYECYR 504

>Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {ON}
            similar to Ashbya gossypii ACL164C
          Length = 1246

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 34/63 (53%), Gaps = 8/63 (12%)

Query: 672  YELRSVIVHYGTHNYGHYIAF---RKYRGTWWRISDETVHMVDEAEVL-----STPSVFM 723
            Y L +V +H G  +YGHY  +   RK  G W + +DE+V  V E+EV      +T + + 
Sbjct: 1168 YNLFAVFIHRGEASYGHYWVYIKDRKNSGIWRKYNDESVTEVPESEVFDFTEDNTATPYF 1227

Query: 724  LFY 726
            L Y
Sbjct: 1228 LVY 1230

>Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON}
           YER144C (REAL)
          Length = 823

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 33  FVGGLVNEGNTCFMNSVLQSLASSHEIVR-FLD 64
           F+ GL N GN C+MN +LQ L  +H++ R FLD
Sbjct: 462 FIVGLENMGNCCYMNCILQCLVGTHDLTRMFLD 494

 Score = 36.6 bits (83), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 4/65 (6%)

Query: 669 PLTYELRSVIVHYGTHNYGHYIAFRKYRGT---WWRISDETVHMVDEAEVLSTPSVFMLF 725
           P  Y L  V  H G+   GHY ++  Y+G    W+   D     +   +   TP+ ++LF
Sbjct: 760 PFRYRLYGVACHSGSLYGGHYTSY-VYKGPQKGWYFFDDSVYCPIRFNDEFITPNAYVLF 818

Query: 726 YEYDF 730
           YE  F
Sbjct: 819 YERIF 823

>Smik_16.163 Chr16 (301703..303208) [1506 bp, 501 aa] {ON} YPL072W
           (REAL)
          Length = 501

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 82/186 (44%), Gaps = 27/186 (14%)

Query: 258 PLDGIVAERIGCLNCGETGGIRYSVSSGLSLNLPSENIGDTLKLSQLLNEWCKPEIIEGV 317
           P +G  ++ + CL C       Y  +    L++P +     L +  L N+  + EIIE  
Sbjct: 204 PFEGETSKFLVCLQCKGLSKPSYQQTFIRELSVPQQTSEKLLTI--LAND--ETEIIEDY 259

Query: 318 NCYRCSLNAVLEHLENQLKTMSEKPKGSIPDKLISAIKTRIKALNETLSKPVIDD----- 372
           +C  C + A+L H            K   P++L+      I+AL    +K  I++     
Sbjct: 260 SCSICQIRAILNH------ERYRNFKDCTPEELL-----MIEALKNYATKASINEDLPPE 308

Query: 373 -EEYKKMHTDNMVRKSSKSKQII----LARPPPLLSIHINRSVFDTRTFMIKKNNSRLAF 427
            E+Y K ++ + +  S    +II      + P +L +H++RS F+  T+   +N   + F
Sbjct: 309 LEQYIKRYSKDKLHISKVKGKIIKKDVAVQLPDILVVHLSRSTFNGITYC--RNPCNVEF 366

Query: 428 KARLNL 433
             R+ L
Sbjct: 367 GERVKL 372

 Score = 35.0 bits (79), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 19/25 (76%)

Query: 670 LTYELRSVIVHYGTHNYGHYIAFRK 694
           + Y L+SV+ H G+H+ GHYI +R+
Sbjct: 389 VKYNLKSVVKHTGSHSRGHYICYRR 413

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 17/28 (60%)

Query: 36 GLVNEGNTCFMNSVLQSLASSHEIVRFL 63
          GL+N GN CF+ S LQ LA     V +L
Sbjct: 54 GLINRGNDCFITSSLQGLAGMPRFVEYL 81

>NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712
          Length = 1105

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 68/306 (22%), Positives = 122/306 (39%), Gaps = 56/306 (18%)

Query: 149  YYRTNNLLKTMSKAPNKNIILGYEQEDAQEFFQTILYELEKNIKFLDSDREKLDKKPIPE 208
            + +T N+L+   + P+       +Q+D QEF   IL          D   ++L  +    
Sbjct: 750  FLKTCNILRPDLRIPD-------DQQDTQEFLMIIL----------DRLHDELSNQQEVV 792

Query: 209  SDLPSNALIGQNNLSHVGTVYIPTAHLDPNSLLDKDPSTNYFTPFRLVTPLDGIVAERIG 268
            ++ P+  L  +NNL      Y            DK+   N  +P   +    G +   + 
Sbjct: 793  NEYPNLLLYDENNLKVQNKEY--------KHWFDKNVIGNGLSPIDHI--FSGQMENSLQ 842

Query: 269  CLNCGETGGIRYSVSSGLSLNLPSENI-----GDTLKLSQLLNEWCKPEIIEGVNCYRC- 322
            C  CG +    YS    LSL +P  +         +KL + +N +   E++ G N + C 
Sbjct: 843  CQRCGNSS-YNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGENAWDCP 901

Query: 323  ----SLNAVLEHLENQLKTMSEKPKGSIPDKLISAIKTRIKALNETLSKPVIDDEEYKKM 378
                S ++ +   E  L   S K K           K++   L+    + +     ++K 
Sbjct: 902  KCGSSASSTISDSEKLLNVTSSKKKNMSSHNEHHRYKSKFFTLHTRSHRSI---SPFRKK 958

Query: 379  HTDNMVRKSSK-----SKQIILARP------PPLLSIHINRSVFDTRTFMIKKNNSRLAF 427
             +   V  S+K     SK++I  +       PP+L IH++R  +D    + KKNN+ + +
Sbjct: 959  TSPAAVPSSTKNEPWKSKKLITIKTLNFIVLPPILVIHLSRFYYD----LTKKNNTVITY 1014

Query: 428  KARLNL 433
               LN+
Sbjct: 1015 PLILNI 1020

>Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON}
           (71125..74697) [3573 nt, 1191 aa]
          Length = 1190

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 668 GPLTYELRSVIVHYGTHNYGHYIAFRK--YRGTWWRISDETVHMVDEAEVL 716
           GP  Y+L  V+VH G  + GHY A  K      W+R  DE V  VD+ +V 
Sbjct: 437 GPKNYKLHGVLVHTGDISTGHYYAMIKPTLEDQWYRFDDEKVWKVDKKQVF 487

>NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188
          Length = 795

 Score = 40.8 bits (94), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 30/63 (47%), Gaps = 4/63 (6%)

Query: 667 TGPLTYELRSVIVHYGTHNYGHYIAFRKYRGT---WWRISDETVHMVDEAEVLSTPSVFM 723
            GP  Y+L +V  H GT   GHY A+   +G    W+   D +  +V  A     P  ++
Sbjct: 729 VGPFKYQLNAVACHMGTLGSGHYTAYVN-KGPDVGWYYFDDSSHRIVKIATEYMNPDAYL 787

Query: 724 LFY 726
           LFY
Sbjct: 788 LFY 790

 Score = 33.5 bits (75), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 35/71 (49%), Gaps = 11/71 (15%)

Query: 385 RKSSKSKQIILARPPPLLSIHINRSVFDTRTFMIKKNNSRLAFKARLNLKP-WCCDVNDI 443
           RK   +KQ+ + R P  L IH  R  FD    M+ KNN  + +   L+L P W   VND 
Sbjct: 659 RKQPSTKQLKITRLPKNLIIHFKR--FDN---MMNKNNIFIQYPYELDLTPFW---VNDF 710

Query: 444 NLDARLPMSKT 454
           N    LP+  T
Sbjct: 711 N--GELPLGMT 719

>KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {ON}
           similar to uniprot|P50102 Saccharomyces cerevisiae
           YMR223W UBP8 Ubiquitin-specific protease that is a
           component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
           acetylation complex required for SAGA-mediated
           deubiquitination of histone H2B
          Length = 446

 Score = 40.8 bits (94), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 2/58 (3%)

Query: 670 LTYELRSVIVHYGTHNYGHYIAFRKYR-GTWWRISDETVHMVDEAEVLSTPSVFMLFY 726
           + Y+L +V+ H GT + GHY    K   G W++ +D  V  V E +VL   + ++LFY
Sbjct: 387 IAYDLLNVVSHQGTVDQGHYTTVSKTEDGQWFKFNDSVVTSVTEEQVLEQQA-YLLFY 443

>Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C
          (DOA4) - ubiquitin isopeptidase [contig 424] PARTIAL
          Length = 424

 Score = 40.4 bits (93), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 33/47 (70%), Gaps = 2/47 (4%)

Query: 20 NLQIQNTVMKRGGFVG-GLVNEGNTCFMNSVLQSLASSHEIVR-FLD 64
          N  + ++++KRG  +  GLVN GN+C+MN ++Q L  + E+V+ FLD
Sbjct: 40 NHSMNSSLVKRGLNINVGLVNLGNSCYMNCIIQCLLGTRELVQIFLD 86

 Score = 37.0 bits (84), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 2/66 (3%)

Query: 663 TKVPTGPLTYELRSVIVHYGTHNYGHYIAF--RKYRGTWWRISDETVHMVDEAEVLSTPS 720
           T+  T P  Y L +V  H+GT   GHY A+  ++ +  W    D         +   T S
Sbjct: 352 TRGQTPPFHYNLYAVACHFGTLYGGHYTAYVNKEDKNGWCYFDDTCWRKAKSEDECITTS 411

Query: 721 VFMLFY 726
            ++LFY
Sbjct: 412 AYVLFY 417

>TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {ON}
           Anc_8.742 YMR223W
          Length = 463

 Score = 40.4 bits (93), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 670 LTYELRSVIVHYGTHNYGHYIAFRKYRGTWW-RISDETVHMVDEAEVLSTPSVFMLF 725
           + YEL  VI H GT N GHYI   K     W + +D  + +VD   VL   +  +++
Sbjct: 401 IIYELIGVICHTGTVNEGHYICSCKLANNQWVKFNDSMITIVDNETVLKEQAYLLIY 457

>Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON}
           YBL067C (REAL)
          Length = 745

 Score = 40.4 bits (93), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 35/65 (53%), Gaps = 9/65 (13%)

Query: 672 YELRSVIVHYGTH-NYGHYIAFRKYRGTWWRI-SDETVHMVDEAEVL-------STPSVF 722
           YEL  ++VH G    +GHY++  K++   W +  DETV  V E  VL       +  + +
Sbjct: 602 YELAGIVVHMGGGPQHGHYVSLCKHQKFGWLLFDDETVEAVKEETVLEFTGESANMATAY 661

Query: 723 MLFYE 727
           +LFY+
Sbjct: 662 VLFYK 666

>YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}
           UBP5Putative ubiquitin-specific protease, closest
           paralog of Doa4p but has no functional overlap;
           concentrates at the bud neck
          Length = 805

 Score = 40.4 bits (93), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 33  FVGGLVNEGNTCFMNSVLQSLASSHEIVR-FLD 64
            + GL N GN C+MN +LQ L  +H++VR FLD
Sbjct: 444 LIVGLENIGNCCYMNCILQCLVGTHDLVRMFLD 476

 Score = 38.9 bits (89), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 32/71 (45%), Gaps = 4/71 (5%)

Query: 663 TKVPTGPLTYELRSVIVHYGTHNYGHYIAFRKYRGT---WWRISDETVHMVDEAEVLSTP 719
           T+    P  Y L  V  H G+   GHY ++  Y+G    W+   D     +  +    TP
Sbjct: 736 TRGQVPPFRYRLYGVACHSGSLYGGHYTSY-VYKGPKKGWYFFDDSLYRPITFSTEFITP 794

Query: 720 SVFMLFYEYDF 730
           S ++LFYE  F
Sbjct: 795 SAYVLFYERIF 805

>NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1269

 Score = 40.4 bits (93), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 3/49 (6%)

Query: 670  LTYELRSVIVHYGTHNYGHYIAFRKYR---GTWWRISDETVHMVDEAEV 715
            + Y + +V +H G  +YGHY  + K R   G W + +DETV  V E EV
Sbjct: 1184 IGYSIFAVFIHRGEASYGHYWIYIKDRSQNGIWRKYNDETVSEVPEEEV 1232

>CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} similar
           to uniprot|P38187 Saccharomyces cerevisiae YBL067c UBP13
           or uniprot|P39967 Saccharomyces cerevisiae YER098w UBP9
           ubiquitin carboxyl-terminal hydrolase
          Length = 770

 Score = 40.4 bits (93), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 37/75 (49%), Gaps = 9/75 (12%)

Query: 662 STKVPTGPLTYELRSVIVHYGTH-NYGHYIAFRK-YRGTWWRISDETVHMVDEAEVL--- 716
           ST  P+    YEL  ++VH G    +GHYI+  K  +  W    DETV  + E  VL   
Sbjct: 603 STFNPSISKNYELSGIVVHMGGGPQHGHYISLCKNEKFGWLLFDDETVEAISEQAVLQYT 662

Query: 717 ----STPSVFMLFYE 727
               +  + ++LFY+
Sbjct: 663 GDKDTMTTAYVLFYQ 677

>YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}
           UBP13Putative ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 747

 Score = 40.4 bits (93), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 34/65 (52%), Gaps = 9/65 (13%)

Query: 672 YELRSVIVHYGTH-NYGHYIAFRKY-RGTWWRISDETVHMVDEAEVL-------STPSVF 722
           YEL  ++VH G    +GHY++  K+ +  W    DETV  V E  VL       +  + +
Sbjct: 602 YELAGIVVHMGGGPQHGHYVSLCKHEKFGWLLFDDETVEAVKEETVLEFTGESPNMATAY 661

Query: 723 MLFYE 727
           +LFY+
Sbjct: 662 VLFYK 666

>KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} similar
           to uniprot|P50102 Saccharomyces cerevisiae YMR223W UBP8
           Ubiquitin-specific protease that is a component of the
           SAGA (Spt-Ada-Gcn5- Acetyltransferase) acetylation
           complex required for SAGA- mediated deubiquitination of
           histone H2B
          Length = 453

 Score = 40.0 bits (92), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 2/58 (3%)

Query: 670 LTYELRSVIVHYGTHNYGHYIAFRKY-RGTWWRISDETVHMVDEAEVLSTPSVFMLFY 726
           + YEL +VI   G+ N GHY    K   G W+R +D  +  + E +VL   + ++LFY
Sbjct: 391 MVYELVAVISQEGSVNQGHYTCMCKVPGGQWFRFNDTMIVSITEEDVLRQQA-YLLFY 447

 Score = 32.3 bits (72), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 18/21 (85%)

Query: 34  VGGLVNEGNTCFMNSVLQSLA 54
           + GLVN G+TCFM+S++Q+L 
Sbjct: 135 LCGLVNMGSTCFMSSIIQTLV 155

>TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_5.443
            YOR124C
          Length = 1320

 Score = 40.4 bits (93), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 33/65 (50%), Gaps = 8/65 (12%)

Query: 670  LTYELRSVIVHYGTHNYGHYIAFRK---YRGTWWRISDETVHMVDEAEVL-----STPSV 721
            L Y L +V +H G  +YGHY  + K     G W + +DE+V  V E EV      +T + 
Sbjct: 1235 LAYSLFAVFIHRGEASYGHYWVYIKDHSKNGIWRKYNDESVTEVPEQEVFNFTEGNTATP 1294

Query: 722  FMLFY 726
            + L Y
Sbjct: 1295 YFLVY 1299

>CAGL0I06600g Chr9 (639096..641546) [2451 bp, 816 aa] {ON} similar
           to uniprot|Q01477 Saccharomyces cerevisiae YER151c UBP3
           ubiquitin-specific proteinase
          Length = 816

 Score = 40.0 bits (92), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 30/49 (61%), Gaps = 3/49 (6%)

Query: 671 TYELRSVIVHYG-THNYGHYIA--FRKYRGTWWRISDETVHMVDEAEVL 716
           TYEL  VI H+G + + GHY A  F K   TW+RI D  +  +++ +VL
Sbjct: 746 TYELSGVIYHHGMSPDGGHYTADVFHKQTKTWYRIDDVNITKLEDDDVL 794

>KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 861

 Score = 39.7 bits (91), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 33  FVGGLVNEGNTCFMNSVLQSLASSHEIVR-FLD 64
           F  GL N GN+C+MN ++Q L  +HE+ + FLD
Sbjct: 493 FTVGLTNLGNSCYMNCIIQCLLGTHELTQIFLD 525

>KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5.443
            YOR124C
          Length = 1262

 Score = 39.7 bits (91), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 3/48 (6%)

Query: 672  YELRSVIVHYGTHNYGHYIAFRK---YRGTWWRISDETVHMVDEAEVL 716
            Y L +V +H G  +YGHY  + K     G W + +DETV  V E EV 
Sbjct: 1179 YSLFAVFIHRGEASYGHYWVYVKDFKNSGIWRKYNDETVSEVPEEEVF 1226

>KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {ON}
           Anc_7.390 YBL067C
          Length = 776

 Score = 39.7 bits (91), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 39/74 (52%), Gaps = 10/74 (13%)

Query: 671 TYELRSVIVHYGTH-NYGHYIAF-RKYRGTWWRISDETVHMVDEAEVL-------STPSV 721
           +Y L+ V+VH G   ++GHY++        W    DETV  VDE+ VL       S  + 
Sbjct: 610 SYRLQGVVVHMGNGPHHGHYVSLCHTELFGWLLFDDETVESVDESYVLDFVGSHESPTTA 669

Query: 722 FMLFY-EYDFDEKS 734
           ++LFY E D  E++
Sbjct: 670 YVLFYSEIDGSERA 683

>KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712
           YIL156W possible pseudogene; NNN added to avoid internal
           stop codon
          Length = 656

 Score = 39.3 bits (90), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 64/277 (23%), Positives = 111/277 (40%), Gaps = 50/277 (18%)

Query: 172 EQEDAQEFFQTILYELEKNIKFLDSDREKLDKKPIPESDLPSNALIGQNNLSHVGTVYIP 231
           +Q+D QEF   +L  L   + + D              DL SN  +  +   ++G  Y+P
Sbjct: 324 DQQDTQEFLVILLDILHDELVYTD--------------DLISNNYVSDD--INLGKEYMP 367

Query: 232 TAHLDPNSLLDKDPSTNYFTPFRLVTPLDGIVAERIGCLNCGETGGIRYSVSSGLSLNLP 291
                    L  +   N  +P  L+    G +   + C  CG T    YS+   LSL +P
Sbjct: 368 --------WLQNNLKANGKSPIDLI--FQGQIENCLQCQRCGNTS-YNYSMFYMLSLAIP 416

Query: 292 S---ENIGDTLKLSQLLNEWCKPEIIEGV---NCYRCSLNAVLEH--------LENQLKT 337
               EN  + +KL   +N +   EI+ G    NC +C    +  +        +EN++K 
Sbjct: 417 KIAKENSKNRVKLEDCINFFTSDEILTGENAWNCPKCCPTTIETYDEADSPATVENRVKN 476

Query: 338 MSEKPKGSIP-DKLISAIKTRIKALNETLSKPVIDDEEYKKMHTDNMVRKSSKSKQIILA 396
            S  P       K++S         +        D +   K   + ++      KQ+   
Sbjct: 477 KSINPLNFFKLHKVLSPSSGNHHRHHHHHHHHKSDGKNKNKYKNEKLI----TLKQLNFI 532

Query: 397 RPPPLLSIHINRSVFDTRTFMIKKNNSRLAFKARLNL 433
           + PP+L IH++R  +++     KKNN+ + +   LN+
Sbjct: 533 KLPPILVIHLSRFYYNST----KKNNAVITYPLILNI 565

>NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5.443
            YOR124C
          Length = 1295

 Score = 39.7 bits (91), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 35/70 (50%), Gaps = 8/70 (11%)

Query: 672  YELRSVIVHYGTHNYGHYIAFRK---YRGTWWRISDETVHMVDEAEVL-----STPSVFM 723
            Y L +V +H G  +YGHY  + K     G W + +DETV  V + EV      +T + + 
Sbjct: 1214 YSLFAVFIHRGEASYGHYWVYIKDYNQNGIWRKYNDETVSEVPDEEVFNFTEGNTATPYF 1273

Query: 724  LFYEYDFDEK 733
            L Y  +  EK
Sbjct: 1274 LVYVKEGSEK 1283

>Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON}
           YBL067C (REAL)
          Length = 748

 Score = 39.3 bits (90), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 9/68 (13%)

Query: 672 YELRSVIVHYGTH-NYGHYIAFRKYR-GTWWRISDETVHMVDEAEVL-------STPSVF 722
           YEL  ++VH G    +GHY++  K+    W    DETV  V E  VL       +  + +
Sbjct: 604 YELSGIVVHMGGGPQHGHYVSLCKHEIFGWLLFDDETVEAVKEEAVLEFTGESPNMATAY 663

Query: 723 MLFYEYDF 730
           +LFY+  +
Sbjct: 664 VLFYKTKY 671

>TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {ON}
            Anc_7.390 YBL067C
          Length = 1171

 Score = 39.3 bits (90), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 9/65 (13%)

Query: 672  YELRSVIVHYGTH-NYGHYIAFRKY-RGTWWRISDETVHMVDEAEVLST-------PSVF 722
            YEL  ++VH G    +GHY+A  K  +  W  + DETV  + E  VL          + +
Sbjct: 1006 YELNGIVVHMGGGPQHGHYVAICKNDKFGWLLMDDETVETISEETVLRCKGDSKDLTTAY 1065

Query: 723  MLFYE 727
            +LFY+
Sbjct: 1066 VLFYK 1070

>SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] {ON}
            similar to uniprot|Q01476 Saccharomyces cerevisiae
            YOR124C UBP2 Ubiquitin-specific protease that removes
            ubiquitin from ubiquitinated proteins cleaves at the C
            terminus of ubiquitin fusions capable of cleaving
            polyubiquitin and possesses isopeptidase activity
          Length = 1237

 Score = 38.9 bits (89), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 34/65 (52%), Gaps = 8/65 (12%)

Query: 670  LTYELRSVIVHYGTHNYGHYIAF---RKYRGTWWRISDETVHMVDEAEVL-----STPSV 721
            + Y L +  +H G  +YGHY  +   RK  G W + +DE+V  V ++EV      +T + 
Sbjct: 1155 IGYSLFAAFIHRGEASYGHYWIYIKDRKKNGIWRKYNDESVTEVPQSEVFNFTEGNTATP 1214

Query: 722  FMLFY 726
            + L Y
Sbjct: 1215 YFLVY 1219

>AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR223W (UBP8)
          Length = 469

 Score = 38.9 bits (89), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 35/62 (56%), Gaps = 2/62 (3%)

Query: 666 PTGPLTYELRSVIVHYGTHNYGHYIAFRKYRG-TWWRISDETVHMVDEAEVLSTPSVFML 724
           P   LT++L ++I H GT + GHY    +  G  W + +D  V ++ E ++L   + ++L
Sbjct: 406 PVPNLTFKLSAIIPHQGTVDKGHYTTICRINGDVWAKFNDSMVTLISEEDMLKEQA-YLL 464

Query: 725 FY 726
           +Y
Sbjct: 465 YY 466

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 24/34 (70%)

Query: 30  RGGFVGGLVNEGNTCFMNSVLQSLASSHEIVRFL 63
           RG  + GLVN G+TCFM+SV+Q+      +++++
Sbjct: 132 RGEGLLGLVNMGSTCFMSSVIQTFLHLPHVLQYM 165

>Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON}
           YBL067C (REAL)
          Length = 750

 Score = 38.9 bits (89), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 34/65 (52%), Gaps = 9/65 (13%)

Query: 672 YELRSVIVHYGTH-NYGHYIAFRKY-RGTWWRISDETVHMVDEAEVL-------STPSVF 722
           Y+L  ++VH G    +GHY++  K+ +  W    DETV  V E  VL       +  + +
Sbjct: 605 YQLAGIVVHMGGGPQHGHYVSLCKHEKFGWLLFDDETVEAVKEETVLEFTGESPNMATAY 664

Query: 723 MLFYE 727
           +LFY+
Sbjct: 665 VLFYK 669

>Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar to
           Ashbya gossypii AFR551W
          Length = 466

 Score = 38.5 bits (88), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 35/62 (56%), Gaps = 2/62 (3%)

Query: 666 PTGPLTYELRSVIVHYGTHNYGHYIAFRKYRG-TWWRISDETVHMVDEAEVLSTPSVFML 724
           P   + Y+L ++I H+GT + GHY    +  G  W + +D  V ++ E ++L   + ++L
Sbjct: 403 PVPNMMYKLSAIISHHGTVHQGHYTTICRINGDIWAKFNDSMVTVISEEDMLKEQA-YLL 461

Query: 725 FY 726
           +Y
Sbjct: 462 YY 463

 Score = 33.1 bits (74), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 17/19 (89%)

Query: 36  GLVNEGNTCFMNSVLQSLA 54
           GLVN G+TCFM+SV+Q+L 
Sbjct: 137 GLVNMGSTCFMSSVIQTLV 155

>TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.188
           YDR069C
          Length = 970

 Score = 38.9 bits (89), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 33  FVGGLVNEGNTCFMNSVLQSLASSHEIVRFL 63
           F  GL N GN+C++N ++Q L SSHE  R  
Sbjct: 606 FSIGLENMGNSCYLNCIIQCLLSSHEFTRIF 636

 Score = 36.6 bits (83), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 36/73 (49%), Gaps = 5/73 (6%)

Query: 659 PTYSTKVPT----GPLTYELRSVIVHYGTHNYGHYIAFRKYRGTWWRISDET-VHMVDEA 713
           P  + ++PT     P  Y+L +V  H+G+   GHY ++       WR  D+T +  +  +
Sbjct: 892 PGVTEELPTRGQIPPFNYKLNAVAAHFGSLYGGHYTSYVDKGKFGWRYFDDTKIRPLKNS 951

Query: 714 EVLSTPSVFMLFY 726
               T + ++LFY
Sbjct: 952 YECITSNAYVLFY 964

>KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {ON}
           Anc_7.390 YBL067C
          Length = 753

 Score = 38.5 bits (88), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 37/71 (52%), Gaps = 9/71 (12%)

Query: 666 PTGPLTYELRSVIVHYGTH-NYGHYIAFRKYRG-TWWRISDETVHMVDEAEVLS------ 717
           P+    YEL  V++H G    +GHY++  K     W    DETV  +DE +VL+      
Sbjct: 589 PSVSKKYELTGVVLHMGGGPQHGHYVSVCKTDNFGWLFFDDETVETLDEPQVLNFTGDTT 648

Query: 718 -TPSVFMLFYE 727
            + + ++LFY+
Sbjct: 649 TSTTAYVLFYK 659

>SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 893

 Score = 38.5 bits (88), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 21/31 (67%)

Query: 33  FVGGLVNEGNTCFMNSVLQSLASSHEIVRFL 63
           F  GLVN GN+C+MN ++Q L  +HE+ +  
Sbjct: 521 FSVGLVNLGNSCYMNCIIQCLLGTHELSQMF 551

>TPHA0L01670 Chr12 complement(351116..352690) [1575 bp, 524 aa] {ON}
           Anc_8.540 YPL072W
          Length = 524

 Score = 38.1 bits (87), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 85/187 (45%), Gaps = 22/187 (11%)

Query: 258 PLDGIVAERIGCLNCGETGGIRYSVSSGLSLNLP---SENIGDTLKLSQLLNEWCKPEII 314
           P  G   + + CL C  T  +R      L+L+LP   S+ + +T+  +Q+       E I
Sbjct: 216 PFLGCQTDSLICLTCNRTSNVREHEFIILTLHLPRIQSDTLLNTINKNQV-------EEI 268

Query: 315 EGVNCYRCSLNAVLEHLENQLKTMSEKPKGSIPDKLISAIKTRIK--ALNETLSKPVIDD 372
               C  C +N++L + E   +  + K   +   + I  ++  +    +NE L   VI  
Sbjct: 269 TDYACLVCQINSILANEEYLKRNNNGKTINAEESRYIDTLRQLVPKICINEELPDDVI-- 326

Query: 373 EEYKKMHTDNMVR-----KSSKSKQIILARPPPLLSIHINRSVFDTRTFMIKKNNSRLAF 427
             Y K +  N +      +S   K+ ++ + P  L +H++RS ++    +  +N+  +A+
Sbjct: 327 -YYIKSYNKNGLNVCQKIRSKIIKKTVITKAPLALILHLSRSSYNGMISV--RNSCNIAY 383

Query: 428 KARLNLK 434
            ++L L+
Sbjct: 384 DSKLELQ 390

 Score = 32.7 bits (73), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 20/34 (58%)

Query: 672 YELRSVIVHYGTHNYGHYIAFRKYRGTWWRISDE 705
           Y L++++ H GTH  GHY  +RK      RIS E
Sbjct: 407 YSLQAMVKHTGTHMEGHYQCYRKKPNLVKRISYE 440

>Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON}
           YDR069C (REAL)
          Length = 926

 Score = 38.5 bits (88), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 2/60 (3%)

Query: 669 PLTYELRSVIVHYGTHNYGHYIAFRK--YRGTWWRISDETVHMVDEAEVLSTPSVFMLFY 726
           P  YEL  V  H+GT   GHY A+ K   R  W    D     V     ++  + ++LFY
Sbjct: 861 PFKYELYGVACHFGTLYGGHYTAYVKKGLRKGWLYFDDTKFKPVKNKTDVTNSNAYVLFY 920

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 33  FVGGLVNEGNTCFMNSVLQSLASSHEIVR-FLD 64
           F  GL N GN+C+MN ++Q +  +HE+ + FLD
Sbjct: 560 FAVGLENLGNSCYMNCIIQCILGTHELTQIFLD 592

>KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.188
           YDR069C
          Length = 986

 Score = 38.5 bits (88), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 30/61 (49%), Gaps = 2/61 (3%)

Query: 669 PLTYELRSVIVHYGTHNYGHYIAF--RKYRGTWWRISDETVHMVDEAEVLSTPSVFMLFY 726
           P  Y+L  V  H+G+   GHY A+  +  +  W+   D +   +  +    T S ++LFY
Sbjct: 919 PFNYKLYGVACHFGSLYGGHYTAYVDKGIKNGWYYFDDTSCRPIKNSMEPITSSAYVLFY 978

Query: 727 E 727
           +
Sbjct: 979 K 979

 Score = 35.8 bits (81), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 25/33 (75%), Gaps = 1/33 (3%)

Query: 33  FVGGLVNEGNTCFMNSVLQSLASSHEIVR-FLD 64
           F+ GL N GN+C++N ++Q L  ++E+++ FLD
Sbjct: 618 FMVGLENMGNSCYLNCIIQCLLGNNELIKIFLD 650

>Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR124C
            (UBP2) - Ubiquitin-specific protease [contig 130] FULL
          Length = 1233

 Score = 38.5 bits (88), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 32/65 (49%), Gaps = 8/65 (12%)

Query: 670  LTYELRSVIVHYGTHNYGHYIAFRK---YRGTWWRISDETVHMVDEAEVL-----STPSV 721
            L Y L +V +H G  +YGHY  + K     G W + +DETV    E EV      +T + 
Sbjct: 1148 LGYSLFAVFIHRGEASYGHYWLYIKDHNRNGIWRKYNDETVTEAPENEVFNFTEGNTATP 1207

Query: 722  FMLFY 726
            + L Y
Sbjct: 1208 YFLVY 1212

>Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {ON}
           complement(57514..60162) [2649 nt, 883 aa]
          Length = 882

 Score = 38.1 bits (87), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 20/27 (74%)

Query: 33  FVGGLVNEGNTCFMNSVLQSLASSHEI 59
           F  GL N GN+C+MN ++Q L S+HE+
Sbjct: 517 FTVGLENMGNSCYMNCIIQCLLSTHEL 543

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 39/75 (52%), Gaps = 8/75 (10%)

Query: 659 PTYSTKVPT----GPLTYELRSVIVHYGTHNYGHYIAF-RKYRGTWWRISDETVH--MVD 711
           P  + ++PT     P  Y+L +V  H G+   GHY A+  K     W   D+T +  + +
Sbjct: 803 PGVTDELPTRGQVPPFRYKLNAVASHVGSLYGGHYTAYVNKGINRGWHYFDDTSYRPIKN 862

Query: 712 EAEVLSTPSVFMLFY 726
           E E + TP+ ++LFY
Sbjct: 863 ETECI-TPNAYVLFY 876

>Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {ON}
           complement(95235..97373) [2139 nt, 713 aa]
          Length = 712

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 33/65 (50%), Gaps = 9/65 (13%)

Query: 672 YELRSVIVHYGTH-NYGHYIAFRKYRGTWWRI-SDETVHMVDEAEVL-------STPSVF 722
           YEL  ++VH G    +GHYI+  K     W +  DETV  + E  VL       S  + +
Sbjct: 574 YELGGLVVHIGIGPQHGHYISVCKTSDYGWLLFDDETVECISEDTVLSFVGDSNSAGTAY 633

Query: 723 MLFYE 727
           +LFY+
Sbjct: 634 VLFYK 638

 Score = 32.3 bits (72), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 25/42 (59%), Gaps = 4/42 (9%)

Query: 18  KNNLQIQNTVMKRGGFVGGLVNEGNTCFMNSVLQSLASSHEI 59
           +NNL I   + K    V GL N GNTC+ NS+LQ L + +E 
Sbjct: 118 ENNLDIDIDIHK----VYGLENFGNTCYCNSILQCLYNMNEF 155

>ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOR124C
            (UBP2)
          Length = 1389

 Score = 38.1 bits (87), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 8/63 (12%)

Query: 672  YELRSVIVHYGTHNYGHYIAFRK---YRGTWWRISDETVHMVDEAEVL-----STPSVFM 723
            Y L +V +H G  +YGHY  + K     G W + +DE+V  V E+EV      +T + + 
Sbjct: 1310 YSLGAVFIHRGEASYGHYWVYIKDCQNGGIWRKYNDESVTEVPESEVFDFSEENTATPYF 1369

Query: 724  LFY 726
            L Y
Sbjct: 1370 LVY 1372

>KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} similar
           to uniprot|P39944 Saccharomyces cerevisiae YER144C UBP5
           Putative ubiquitin-specific protease that does not
           associate with the proteasome
          Length = 796

 Score = 37.7 bits (86), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 6/41 (14%)

Query: 25  NTVMKRG------GFVGGLVNEGNTCFMNSVLQSLASSHEI 59
           N+V K G       F  GLVN GN+C++N ++Q L   HE+
Sbjct: 416 NSVAKSGHPSINLDFAIGLVNLGNSCYLNCIIQCLLGCHEL 456

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 28/59 (47%), Gaps = 1/59 (1%)

Query: 669 PLTYELRSVIVHYGTHNYGHYIAFR-KYRGTWWRISDETVHMVDEAEVLSTPSVFMLFY 726
           P  Y L +V  H GT   GHY +F  K R  W    D +   +   +   TP+ ++LFY
Sbjct: 733 PFNYRLFAVASHSGTLYGGHYTSFVDKGRVGWCSFDDVSWRKIRRKDEYITPNAYVLFY 791

>Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {ON}
           similar to Ashbya gossypii AGR370W
          Length = 778

 Score = 37.7 bits (86), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 32/68 (47%), Gaps = 10/68 (14%)

Query: 672 YELRSVIVHYGTH-NYGHYIAFRKYRGTWWRI-SDETVHMVDEAEVLS--------TPSV 721
           YEL  +++H G    +GHY+A  K+    W +  DETV  +DE  V          T + 
Sbjct: 637 YELNGIVIHMGGGPQHGHYVAICKHDMFGWLLYDDETVESIDEETVFKFVGDEKDMTTAY 696

Query: 722 FMLFYEYD 729
            + F E D
Sbjct: 697 VLFFKEVD 704

>KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {ON}
           Anc_8.188 YDR069C
          Length = 978

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 22/31 (70%)

Query: 33  FVGGLVNEGNTCFMNSVLQSLASSHEIVRFL 63
           F+ GL N GN+C+MN ++Q +  +H++++  
Sbjct: 603 FIVGLENMGNSCYMNCIIQCILGTHDLIKIF 633

 Score = 36.2 bits (82), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 38/75 (50%), Gaps = 8/75 (10%)

Query: 659 PTYSTKVPT----GPLTYELRSVIVHYGTHNYGHYIAFR-KYRGTWWRISDETVH--MVD 711
           P  S ++P      P  Y L  V  H+G+   GHY A+  K  G  W   D+T +  + +
Sbjct: 898 PGVSNELPARGQIKPFNYRLYGVACHFGSLYGGHYTAYVDKGIGNGWYYFDDTTYRPLKN 957

Query: 712 EAEVLSTPSVFMLFY 726
           + E +S+ S ++LFY
Sbjct: 958 DKEPISS-SAYVLFY 971

>AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER098W (UBP9) and
           YBL067C (UBP13)
          Length = 740

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 9/65 (13%)

Query: 672 YELRSVIVHYGTH-NYGHYIAFRKYRGTWWRI-SDETVHMVDEAEVLS-------TPSVF 722
           YEL  +++H G    +GHY+A  K+    W +  DETV  V E  VL          + +
Sbjct: 592 YELNGIVIHMGGGPQHGHYVAICKHELFGWLLYDDETVESVGEDAVLRFIGDVNDMTTAY 651

Query: 723 MLFYE 727
           +LFY+
Sbjct: 652 VLFYK 656

>Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON}
           YDR069C (REAL)
          Length = 927

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 33  FVGGLVNEGNTCFMNSVLQSLASSHEIVR-FLD 64
           F  GL N GN+C+MN ++Q +  +HE+ + FLD
Sbjct: 561 FAVGLENLGNSCYMNCIIQCILGTHELTQIFLD 593

>YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}
           DOA4Ubiquitin isopeptidase, required for recycling
           ubiquitin from proteasome-bound ubiquitinated
           intermediates, acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 926

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 33  FVGGLVNEGNTCFMNSVLQSLASSHEIVR-FLD 64
           F  GL N GN+C+MN ++Q +  +HE+ + FLD
Sbjct: 560 FAVGLENLGNSCYMNCIIQCILGTHELTQIFLD 592

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 25/60 (41%), Gaps = 2/60 (3%)

Query: 669 PLTYELRSVIVHYGTHNYGHYIAFRK--YRGTWWRISDETVHMVDEAEVLSTPSVFMLFY 726
           P  YEL  V  H+GT   GHY A+ K   +  W    D     V         + ++LFY
Sbjct: 861 PFKYELYGVACHFGTLYGGHYTAYVKKGLKKGWLYFDDTKYKPVKNKADAINSNAYVLFY 920

>NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON} 
          Length = 1116

 Score = 37.7 bits (86), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 21/31 (67%)

Query: 33  FVGGLVNEGNTCFMNSVLQSLASSHEIVRFL 63
           F+ GL N GN+C++N ++Q L  +HE+ +  
Sbjct: 745 FIIGLQNMGNSCYLNCIIQCLLGTHELTKIF 775

 Score = 35.0 bits (79), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 4/61 (6%)

Query: 669  PLTYELRSVIVHYGTHNYGHYIAF--RKYRGTWWRISDETVHMV-DEAEVLSTPSVFMLF 725
            P  Y L    +H+G+   GHY AF  +  R  W+   D     + +E E +S+ + ++LF
Sbjct: 1051 PFKYRLYGAALHFGSLYGGHYTAFVNKGIRNGWYYFDDTNYRPIKNEREPISS-NAYVLF 1109

Query: 726  Y 726
            Y
Sbjct: 1110 Y 1110

>NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188
          Length = 922

 Score = 37.4 bits (85), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 21/31 (67%)

Query: 33  FVGGLVNEGNTCFMNSVLQSLASSHEIVRFL 63
           F+ GL N GN+C++N ++Q L  +HE+ +  
Sbjct: 557 FIVGLQNIGNSCYLNCIIQCLLGTHELTKIF 587

 Score = 35.8 bits (81), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 29/65 (44%), Gaps = 2/65 (3%)

Query: 669 PLTYELRSVIVHYGTHNYGHYIAF--RKYRGTWWRISDETVHMVDEAEVLSTPSVFMLFY 726
           P  Y+L  V  H+G+   GHY A+  +  +  W+   D     +       T S ++LFY
Sbjct: 857 PFKYKLYGVASHFGSLYGGHYTAYVDKGPKHGWYYFDDTNYRSIKNKNEPITSSAYLLFY 916

Query: 727 EYDFD 731
              +D
Sbjct: 917 HRIYD 921

>Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON}
           YDR069C (REAL)
          Length = 929

 Score = 37.4 bits (85), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 33  FVGGLVNEGNTCFMNSVLQSLASSHEIVR-FLD 64
           F  GL N GN+C+MN ++Q +  +HE+ + FLD
Sbjct: 563 FAVGLENLGNSCYMNCIIQCILGTHELTQIFLD 595

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 25/60 (41%), Gaps = 2/60 (3%)

Query: 669 PLTYELRSVIVHYGTHNYGHYIAFRK--YRGTWWRISDETVHMVDEAEVLSTPSVFMLFY 726
           P  YEL  V  H+GT   GHY A+ K   +  W    D     V         + ++LFY
Sbjct: 864 PFKYELYGVACHFGTLYGGHYTAYVKKGLKKGWLYFDDTKYKPVKNQTDAINSNAYVLFY 923

>TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8.202
           YER151C
          Length = 1019

 Score = 37.4 bits (85), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%), Gaps = 3/49 (6%)

Query: 671 TYELRSVIVHYG-THNYGHYIA--FRKYRGTWWRISDETVHMVDEAEVL 716
           TYEL  V+ H+G + + GHY A  + K    W+RI D TV  +++ +VL
Sbjct: 951 TYELTGVVYHHGLSSDGGHYTADIYHKEVDKWYRIDDVTVTELEKDDVL 999

>KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5.18
           YMR304W
          Length = 1213

 Score = 37.4 bits (85), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 4/59 (6%)

Query: 660 TYSTKVPTGPLTYELRSVIVHYGTHNYGHYIAFRK--YRGTWWRISDETVHMVDEAEVL 716
           T  T++P  P  Y+L  V+VH G  + GHY A  K      W+R  DE V  V + +V 
Sbjct: 421 TEDTEMP--PCIYKLHGVLVHAGDISTGHYYAMIKPSTEDQWYRFDDEKVWKVTKTQVF 477

>KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} similar
            to uniprot|Q01476 Saccharomyces cerevisiae YOR124C UBP2
            Ubiquitin-specific protease that removes ubiquitin from
            ubiquitinated proteins cleaves at the C terminus of
            ubiquitin fusions capable of cleaving polyubiquitin and
            possesses isopeptidase activity
          Length = 1241

 Score = 37.0 bits (84), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 8/63 (12%)

Query: 672  YELRSVIVHYGTHNYGHYIAFRK---YRGTWWRISDETVHMVDEAEVL-----STPSVFM 723
            Y L +V +H G  +YGHY  + K     G W + +DE+V    E+EV      +T + + 
Sbjct: 1158 YSLFAVFIHRGEASYGHYWIYIKDSGKNGIWRKYNDESVTEAPESEVFNFSEGNTATPYF 1217

Query: 724  LFY 726
            L Y
Sbjct: 1218 LVY 1220

>TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]
           {ON} Anc_1.137 YJL197W
          Length = 1178

 Score = 37.0 bits (84), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 26/45 (57%), Gaps = 3/45 (6%)

Query: 15  WVTKNNLQIQNTVMKRGGFVGGLVNEGNTCFMNSVLQSLASSHEI 59
           W++  N  I NT+    G + GL N GNTC+MNS LQ L    E+
Sbjct: 285 WLS--NYFIYNTLQPSQG-ITGLTNLGNTCYMNSALQCLVHIPEL 326

>TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5.443
            YOR124C
          Length = 1283

 Score = 36.6 bits (83), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 8/65 (12%)

Query: 670  LTYELRSVIVHYGTHNYGHYIAFRK---YRGTWWRISDETVHMVDEAEVL-----STPSV 721
            + Y L +V +H G  +YGHY  + K       W + +DET+  V ++EV      +T + 
Sbjct: 1199 IKYNLFAVFIHRGEASYGHYWTYIKDFQQNSIWRKYNDETITEVPDSEVFNFIEGNTATP 1258

Query: 722  FMLFY 726
            + L Y
Sbjct: 1259 YFLVY 1263

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 36.2 bits (82), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 13/23 (56%), Positives = 19/23 (82%)

Query: 31  GGFVGGLVNEGNTCFMNSVLQSL 53
           G F  GL+N GN+C++NS+LQ+L
Sbjct: 315 GNFGCGLINLGNSCYLNSILQAL 337

>KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {ON}
           Anc_8.188 YDR069C
          Length = 671

 Score = 36.2 bits (82), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 28/58 (48%), Gaps = 3/58 (5%)

Query: 672 YELRSVIVHYGTHNYGHYIA--FRKYRGTWWRISDETVHMVDEAEVLSTPSVFMLFYE 727
           Y+L +V  H GT   GHY A  F+     W+   D     V   E +S  S ++LFY+
Sbjct: 612 YKLVAVACHTGTLFSGHYTAYCFKNSENGWYHFDDTQCKPVSNGECISQ-SAYLLFYQ 668

>KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] {ON}
            uniprot|O42726 Kluyveromyces lactis UBP2 Ubiquitin
            carboxyl-terminal hydrolase 2
          Length = 1220

 Score = 36.2 bits (82), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 34/65 (52%), Gaps = 8/65 (12%)

Query: 670  LTYELRSVIVHYGTHNYGHYIAFRK---YRGTWWRISDETVHMVDEAEVL-----STPSV 721
            + Y L +V +H G  +YGHY  + K     G W + +D++V  V ++EV      +T + 
Sbjct: 1135 IGYSLFAVFIHRGEASYGHYWVYIKDHTKNGIWRKYNDDSVTEVPQSEVFNFTEGNTATP 1194

Query: 722  FMLFY 726
            + L Y
Sbjct: 1195 YFLVY 1199

>TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5.712
           YIL156W
          Length = 1025

 Score = 35.8 bits (81), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 84/192 (43%), Gaps = 19/192 (9%)

Query: 256 VTPLDGIVAERIG----CLNCGETGGIRYSVSSGLSLNLPSENI-----GDTLKLSQLLN 306
           + P+D I   +I     C  CG +    YS    LSL +P  +         +KL   +N
Sbjct: 755 LAPIDHIFQGQIENILECQRCGNSS-FSYSTFYVLSLAIPKPSTSTFSRAKRVKLEDCIN 813

Query: 307 EWCKPEIIEGVNCYRCSL--NAVLEHLENQLKTMSEKPKGSIPDKLISAIKT-RIKALNE 363
            +   EI+ G N + C    +AV +   N LK   +K K  + ++  S     RI + ++
Sbjct: 814 MFTNDEILSGENAWDCPKCGSAVTDMGPNHLKKSKKKKKSELGEERRSKSGFFRIHSKSK 873

Query: 364 TLSKP--VIDDEEYKKMHTDNMVRKSSKSKQIILARPPPLLSIHINRSVFDTRTFMIKKN 421
               P  ++   ++     D   ++ S  K +     PP+L IH++R  +D    + KKN
Sbjct: 874 RSKSPFRMLGSTKFPLAMEDWKSKELSTKKTLNFIFLPPVLIIHLSRFYYD----LTKKN 929

Query: 422 NSRLAFKARLNL 433
           ++ + +   LN+
Sbjct: 930 DTIVTYPLVLNI 941

>NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5.18
           YMR304W
          Length = 1197

 Score = 36.2 bits (82), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 669 PLTYELRSVIVHYGTHNYGHYIAFRK--YRGTWWRISDETVHMVDEAEVL 716
           P  Y L  V+VH G  + GHY A  K      W+R  DE V  V + +V 
Sbjct: 435 PCIYNLHGVLVHTGDISTGHYYAMIKPDLEDQWYRFDDEKVWKVTKKQVF 484

>AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL156W
            (UBP7) and YKR098C (UBP11)
          Length = 1169

 Score = 35.8 bits (81), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 47/200 (23%), Positives = 81/200 (40%), Gaps = 27/200 (13%)

Query: 256  VTPLDGI----VAERIGCLNCGETGGIRYSVSSGLSLNLP---SENIGDT--LKLSQLLN 306
            ++P+D I    +  ++ C  C +     YS    LSL LP   S+  G    L+L   +N
Sbjct: 891  LSPIDSIFQGQIEHQLSCQRC-DFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCIN 949

Query: 307  EWCKPEIIEGVNCYRCSLNAVLEHLENQLKTMSEKPKGSI-------------PDKLISA 353
             +   E++ G N + C    V    + Q+ +   K K                 D L   
Sbjct: 950  FFTCDEVLTGQNPWDCPKCGVNSSGDRQMNSEKSKRKNKFFMGSENANSANSNRDHLPRL 1009

Query: 354  IKTRIKALNETLSKPVIDDEEYKKMHTDNMVRKSSKSKQIILARPPPLLSIHINRSVFDT 413
             K   K+ + + S  +   +   K H     +K +  K +     P +L IH++R V+D 
Sbjct: 1010 FKIGSKSRSRSSSPFISGPKSSGKTHEKRYNKKLATIKSLNFITLPRILIIHLSRFVYD- 1068

Query: 414  RTFMIKKNNSRLAFKARLNL 433
               + KKNN+ + +   LN+
Sbjct: 1069 ---LTKKNNTVVTYPLILNI 1085

>TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1247

 Score = 35.8 bits (81), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 668 GPLTYELRSVIVHYGTHNYGHYIAFRK--YRGTWWRISDETVHMVDEAEVL 716
           GP  Y L  V+VH G  + GHY A  K      W+R  DE V  V + +V 
Sbjct: 492 GPNNYNLHGVLVHTGDISTGHYYAMIKPTTDDKWYRFDDEKVWRVTKKQVF 542

>Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W
           (REAL)
          Length = 1255

 Score = 35.8 bits (81), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 18/27 (66%)

Query: 28  MKRGGFVGGLVNEGNTCFMNSVLQSLA 54
           ++ G    GLVN GNTC+MNS LQ L 
Sbjct: 357 LEPGSGTTGLVNLGNTCYMNSALQCLV 383

>Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON}
           similar to Ashbya gossypii AFR627C
          Length = 1264

 Score = 35.8 bits (81), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 25/46 (54%), Gaps = 3/46 (6%)

Query: 9   PSGYRKWVTKNNLQIQNTVMKRGGFVGGLVNEGNTCFMNSVLQSLA 54
           P+  + W +  N  I N +    G VG L N GNTC+MNS LQ L 
Sbjct: 326 PAKNQHWAS--NYYIYNQMTPSNGTVG-LGNLGNTCYMNSALQCLV 368

>ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa]
           {ON} similar to uniprot|P50101 Saccharomyces cerevisiae
           YMR304W UBP15 Ubiquitin-specific protease that may play
           a role in ubiquitin precursor processing
          Length = 1193

 Score = 35.8 bits (81), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 24/51 (47%), Gaps = 2/51 (3%)

Query: 668 GPLTYELRSVIVHYGTHNYGHYIAFRK--YRGTWWRISDETVHMVDEAEVL 716
           GP  Y L  V+VH G  + GHY A  K      W+R  DE V  V + +  
Sbjct: 436 GPRWYGLHGVLVHTGDISTGHYYALIKPGLEDQWYRFDDERVWKVSKKQAF 486

>TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8.188
            YDR069C
          Length = 1144

 Score = 35.4 bits (80), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 28/59 (47%), Gaps = 2/59 (3%)

Query: 669  PLTYELRSVIVHYGTHNYGHYIAF--RKYRGTWWRISDETVHMVDEAEVLSTPSVFMLF 725
            P  YEL  V +H G+   GHY A+  +  +  W+   D     +  +  + T + ++LF
Sbjct: 1036 PFKYELSGVALHMGSLYGGHYTAYVNKGLKNGWYYFDDTVYRSIKYSSEMITQNAYVLF 1094

 Score = 35.0 bits (79), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 21/31 (67%)

Query: 33  FVGGLVNEGNTCFMNSVLQSLASSHEIVRFL 63
           F  GL N GN+C++N ++Q L ++HE+ +  
Sbjct: 733 FKVGLENMGNSCYLNCIIQCLLNNHELTKMF 763

>TDEL0B04220 Chr2 (747864..750341) [2478 bp, 825 aa] {ON} Anc_8.188
           YDR069C
          Length = 825

 Score = 35.4 bits (80), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 34/74 (45%), Gaps = 6/74 (8%)

Query: 659 PTYSTKVPT----GPLTYELRSVIVHYGTHNYGHYIAF--RKYRGTWWRISDETVHMVDE 712
           P  + ++PT     P  Y+L  +  H G+   GHY ++  +  +  W    D +   V  
Sbjct: 746 PGVTEELPTRGQSPPFNYKLYGIASHVGSLYGGHYTSYVDKGPKRGWCYFDDTSFRPVRN 805

Query: 713 AEVLSTPSVFMLFY 726
           A    TP+ ++LFY
Sbjct: 806 ATECITPNAYVLFY 819

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 19/27 (70%)

Query: 33  FVGGLVNEGNTCFMNSVLQSLASSHEI 59
           F  GL N GN+C++N ++Q L  +HE+
Sbjct: 461 FAVGLENMGNSCYINCIVQCLLGTHEL 487

>AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL197W
           (UBP12)
          Length = 1287

 Score = 35.4 bits (80), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 22/35 (62%), Gaps = 1/35 (2%)

Query: 19  NNLQIQNTVMKRGGFVGGLVNEGNTCFMNSVLQSL 53
           +N  + N ++   G +G L N GNTC+MNS LQ L
Sbjct: 331 SNFYVYNQLLSSKGTIG-LSNLGNTCYMNSALQCL 364

>NCAS0A03840 Chr1 (780031..782784) [2754 bp, 917 aa] {ON} Anc_8.202
           YER151C
          Length = 917

 Score = 35.0 bits (79), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 24/48 (50%)

Query: 17  TKNNLQIQNTVMKRGGFVGGLVNEGNTCFMNSVLQSLASSHEIVRFLD 64
           TK N  +  T+  +     G+VN  N CFM+SVLQ L      +  L+
Sbjct: 412 TKQNSNVDRTIPIKSIIPRGIVNMANICFMSSVLQVLLYCKPFIDILN 459

>AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER151C
           (UBP3)
          Length = 789

 Score = 35.0 bits (79), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 32  GFVGGLVNEGNTCFMNSVLQSLASSHEIVRFLD 64
           G   G++N+GN CFM+SVLQ L      +  L+
Sbjct: 346 GIPRGIMNKGNICFMSSVLQVLLFCEPFIEMLN 378

>KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa]
           {ON} similar to uniprot|P50101 Saccharomyces cerevisiae
           YMR304W UBP15 Ubiquitin-specific protease that may play
           a role in ubiquitin precursor processing
          Length = 1189

 Score = 35.0 bits (79), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 24/51 (47%), Gaps = 2/51 (3%)

Query: 668 GPLTYELRSVIVHYGTHNYGHYIAFRK--YRGTWWRISDETVHMVDEAEVL 716
           GP  Y L  V+VH G  + GHY A  K      W+R  D+ V  V + +  
Sbjct: 435 GPCVYNLHGVLVHSGEISVGHYYAMIKPDVGDQWFRFDDDKVWRVTKEQAF 485

>Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {ON}
           YJL197W (REAL)
          Length = 1256

 Score = 35.0 bits (79), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 24/44 (54%), Gaps = 3/44 (6%)

Query: 11  GYRKWVTKNNLQIQNTVMKRGGFVGGLVNEGNTCFMNSVLQSLA 54
           G   WV+  N  + N +    G   GLVN GNTC+MNS LQ L 
Sbjct: 340 GNHHWVS--NHFVYNKLEPASG-TTGLVNLGNTCYMNSALQCLV 380

>CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156w UBP7
          Length = 1081

 Score = 34.7 bits (78), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 21/26 (80%)

Query: 34  VGGLVNEGNTCFMNSVLQSLASSHEI 59
           V GL N GNTC++N +LQSL +++E+
Sbjct: 647 VTGLRNLGNTCYINCMLQSLFATNEL 672

>Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar to
           Ashbya gossypii AGR139C
          Length = 834

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 30/56 (53%), Gaps = 8/56 (14%)

Query: 12  YRKWV---TKNNLQIQNTVMKRGGFVGGLVNEGNTCFMNSVLQSLASSHEIVRFLD 64
           Y+K+V        +  NT++ RG     ++N+GN CFM+SVLQ L      +  L+
Sbjct: 368 YKKYVNDTAPETTKAINTIVPRG-----ILNKGNICFMSSVLQVLLFCKPFISMLN 418

>CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {ON}
           similar to uniprot|P32571 Saccharomyces cerevisiae
           YDR069c DOA4 ubiquitin-specific protease
          Length = 947

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/60 (25%), Positives = 29/60 (48%), Gaps = 2/60 (3%)

Query: 669 PLTYELRSVIVHYGTHNYGHYIAF--RKYRGTWWRISDETVHMVDEAEVLSTPSVFMLFY 726
           P  Y L +V  H+G+   GHY ++  +     W+   D+   +V +   +   + ++LFY
Sbjct: 882 PFKYSLYAVANHFGSLYGGHYTSYVNKGLSRGWYYFDDQNYRLVKKTSEVVNSNAYVLFY 941

 Score = 33.9 bits (76), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 20/31 (64%)

Query: 33  FVGGLVNEGNTCFMNSVLQSLASSHEIVRFL 63
           F  GL N GN+C+MN +LQ +  ++E+ +  
Sbjct: 581 FTVGLENMGNSCYMNCILQCIMGTNELSQIF 611

>YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}
           UBP12Ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1254

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/19 (73%), Positives = 15/19 (78%)

Query: 36  GLVNEGNTCFMNSVLQSLA 54
           GLVN GNTC+MNS LQ L 
Sbjct: 365 GLVNLGNTCYMNSALQCLV 383

>Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W
           (REAL)
          Length = 1247

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/19 (73%), Positives = 15/19 (78%)

Query: 36  GLVNEGNTCFMNSVLQSLA 54
           GLVN GNTC+MNS LQ L 
Sbjct: 365 GLVNLGNTCYMNSALQCLV 383

>NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1201

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/21 (61%), Positives = 16/21 (76%)

Query: 34  VGGLVNEGNTCFMNSVLQSLA 54
           + GLVN GNTC+MNS LQ + 
Sbjct: 320 ITGLVNLGNTCYMNSALQCIT 340

>Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {ON}
           (53632..53653,53786..55254) [1491 nt, 497 aa]
          Length = 496

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 16/18 (88%)

Query: 36  GLVNEGNTCFMNSVLQSL 53
           GL+N GNTC+MNS LQ+L
Sbjct: 110 GLLNMGNTCYMNSTLQAL 127

>Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR304W
           (REAL)
          Length = 1231

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 2/50 (4%)

Query: 669 PLTYELRSVIVHYGTHNYGHYIAFRK--YRGTWWRISDETVHMVDEAEVL 716
           P  Y L  V+VH G  + GHY    K      W+R  DE V  V + +V 
Sbjct: 446 PYVYNLHGVLVHSGDISTGHYYTLIKPGVEDQWYRFDDERVWRVTKKQVF 495

>YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}
           UBP15Ubiquitin-specific protease involved in protein
           deubiquitination; catalytic activity regulated by an
           N-terminal TRAF-like domain and and C-terminal
           sequences; physically interacts with anaphase-promoting
           complex/cyclosome (APC/C) activator, Cdh1p
          Length = 1230

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 2/50 (4%)

Query: 669 PLTYELRSVIVHYGTHNYGHYIAFRK--YRGTWWRISDETVHMVDEAEVL 716
           P  Y L  V+VH G  + GHY    K      W+R  DE V  V + +V 
Sbjct: 446 PYVYNLHGVLVHSGDISTGHYYTLIKPGVEDQWYRFDDERVWRVTKKQVF 495

>ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some
           similarities with uniprot|P32571 Saccharomyces
           cerevisiae YDR069C DOA4 Ubiquitin hydrolase required for
           recycling ubiquitin from proteasome-bound ubiquitinated
           intermediates acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 877

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 19/27 (70%)

Query: 33  FVGGLVNEGNTCFMNSVLQSLASSHEI 59
           F  GL N GN+C++N ++Q L  +HE+
Sbjct: 513 FTVGLENMGNSCYINCIIQCLLGTHEL 539

>NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1253

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 21/36 (58%), Gaps = 1/36 (2%)

Query: 19  NNLQIQNTVMKRGGFVGGLVNEGNTCFMNSVLQSLA 54
           +N  I N +    G +G L N GNTC+MNS LQ + 
Sbjct: 315 SNFLIYNNLQSSPGTIG-LTNLGNTCYMNSALQCIT 349

>Kwal_56.24074 s56 (836209..837888) [1680 bp, 559 aa] {ON} YGL066W
           (SGF73) - Probable 73KkDa Subunit of SAGA histone
           acetyltransferase complex [contig 166] FULL
          Length = 559

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 45/98 (45%), Gaps = 17/98 (17%)

Query: 319 CYRC----SLNAVLEHLENQLKTMSE-------KPKGSIPDKLISAIKTRIKALNETLSK 367
           C  C    SL+A++EHL+   K + +       K +GS P + +S++K +  A N   S 
Sbjct: 83  CEGCGKPVSLSAIVEHLQTYCKGLPDWETSQGVKVEGSDPVEDMSSVKKKATASNSKRST 142

Query: 368 PVIDDEE------YKKMHTDNMVRKSSKSKQIILARPP 399
           P++ D E       KK          SK+K+ I  R P
Sbjct: 143 PLVGDVEPEGSPAVKKQRKTTSTPAPSKAKRRIKQRNP 180

>TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1462

 Score = 34.7 bits (78), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/18 (77%), Positives = 15/18 (83%)

Query: 36  GLVNEGNTCFMNSVLQSL 53
           GLVN GNTC+MNS LQ L
Sbjct: 415 GLVNLGNTCYMNSALQCL 432

>Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR304W
           (REAL)
          Length = 1230

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 2/50 (4%)

Query: 669 PLTYELRSVIVHYGTHNYGHYIAFRK--YRGTWWRISDETVHMVDEAEVL 716
           P  Y L  V+VH G  + GHY    K      W+R  DE V  V + +V 
Sbjct: 445 PYIYNLHGVLVHSGDISTGHYYTLIKPGVEDQWYRFDDERVWRVTKKQVF 494

>CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa]
          {ON} weakly similar to uniprot|Q02863 Saccharomyces
          cerevisiae YPL072w UBP16
          Length = 483

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 13/23 (56%), Positives = 19/23 (82%)

Query: 33 FVGGLVNEGNTCFMNSVLQSLAS 55
          +  GLVN+GN C+ NSV+Q+L+S
Sbjct: 70 YTTGLVNKGNYCYANSVIQALSS 92

>Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR304W
           (REAL)
          Length = 1231

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 2/50 (4%)

Query: 669 PLTYELRSVIVHYGTHNYGHYIAFRK--YRGTWWRISDETVHMVDEAEVL 716
           P  Y L  V+VH G  + GHY    K      W+R  DE V  V + +V 
Sbjct: 446 PYIYNLHGVLVHSGDISTGHYYTLIKPGVEDQWYRFDDERVWRVTKKQVF 495

>TPHA0D04350 Chr4 complement(934597..937161) [2565 bp, 854 aa] {ON}
           Anc_8.202 YER151C
          Length = 854

 Score = 34.3 bits (77), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 6/48 (12%)

Query: 17  TKNNLQIQNTVMKRGGFVGGLVNEGNTCFMNSVLQSLASSHEIVRFLD 64
           ++ +L I+N V +      G++N  N CFM+SVLQ L S    +  L+
Sbjct: 407 SEKSLPIKNIVPR------GIINSANICFMSSVLQVLLSCAPFINILN 448

>ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P39538 Saccharomyces cerevisiae
           YJL197W UBP12 Ubiquitin-specific protease present in the
           nucleus and cytoplasm that cleaves ubiquitin from
           ubiquitinated proteins
          Length = 1204

 Score = 34.3 bits (77), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 3/45 (6%)

Query: 15  WVTKNNLQIQNTVMKRGGFVGGLVNEGNTCFMNSVLQSLASSHEI 59
           W++  N  + N +    G + GL N GNTC+MNS LQ L    E+
Sbjct: 276 WLS--NYFMYNQLTPSSG-ITGLYNLGNTCYMNSALQCLVHIPEL 317

>Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 33.9 bits (76), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 17/18 (94%)

Query: 36  GLVNEGNTCFMNSVLQSL 53
           GL+N GN+C++NSVLQSL
Sbjct: 324 GLINLGNSCYLNSVLQSL 341

>NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {ON}
           Anc_5.18
          Length = 1211

 Score = 33.9 bits (76), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 672 YELRSVIVHYGTHNYGHYIAFRK--YRGTWWRISDETVHMVDEAEVL 716
           Y L  V+VH G  + GHY A  K   +  W+R  DE V  V + +V 
Sbjct: 444 YTLHGVLVHTGDISTGHYYAMIKPDLQDQWYRFDDEKVWKVTKKQVF 490

>TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5.18
           YMR304W
          Length = 1193

 Score = 33.9 bits (76), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 2/47 (4%)

Query: 672 YELRSVIVHYGTHNYGHYIAFRK--YRGTWWRISDETVHMVDEAEVL 716
           Y+L  V+VH G  + GHY    K      W+R  DE V  VD  +V 
Sbjct: 448 YKLHGVLVHTGDISTGHYYTMIKPDLGDQWYRFDDERVWKVDRKQVF 494

>YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}
            UBP7Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 1071

 Score = 33.9 bits (76), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 34/76 (44%), Gaps = 14/76 (18%)

Query: 670  LTYELRSVIVHYGTHNYGHYIAFRKY---------RGTWWRISDETV-----HMVDEAEV 715
            + Y+L  V+ H GT   GHY +             R  W+   DE V     H  D+   
Sbjct: 996  MKYKLFGVVNHTGTLISGHYTSLVNKDLEHNVNIGRSKWYYFDDEVVKADRKHGSDKNLK 1055

Query: 716  LSTPSVFMLFYEYDFD 731
            +S+  V++LFYE  +D
Sbjct: 1056 ISSSDVYVLFYERVYD 1071

>Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {ON}
           YKR098C (REAL)
          Length = 721

 Score = 33.9 bits (76), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 41/188 (21%), Positives = 79/188 (42%), Gaps = 18/188 (9%)

Query: 256 VTPLDGIVAER----IGCLNCGETGGIRYSVSSGLSLNLPSENI------GDTLKLSQLL 305
           ++P+D I   +    + C  CG +    YS    LSL +P  ++         +KL   +
Sbjct: 450 LSPIDYIFRGQMENILKCQRCGNSSH-SYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCI 508

Query: 306 NEWCKPEIIEGVNCYRCSLNAVLEHLENQLKTMSEKPKGSIPDKLISAIKTRIKALNETL 365
           N +   E + G N + C  N     L+ ++   + + K S      S  +++    +   
Sbjct: 509 NLFTSDEELSGDNSWDCP-NCGTTDLKTKINESTSQKKKSTFFSFHSRSRSKSPHHHHHH 567

Query: 366 SKPVIDDEEYKKMHTDNMVRKSSKSKQIILARPPPLLSIHINRSVFDTRTFMIKKNNSRL 425
                D+ E      ++    + KS   I+   PP+L IH++R  +D    + +KNN+ +
Sbjct: 568 HHHSHDNTEKHSKKWNSRKLTTVKSSDFIVL--PPILVIHLSRFYYD----LTRKNNTVI 621

Query: 426 AFKARLNL 433
            +   LN+
Sbjct: 622 TYPLILNV 629

>YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON}
           UBP11Ubiquitin-specific protease that cleaves ubiquitin
           from ubiquitinated proteins
          Length = 717

 Score = 33.9 bits (76), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 43/187 (22%), Positives = 81/187 (43%), Gaps = 17/187 (9%)

Query: 256 VTPLDGIVAERI-GCLNCGETGGIRYSVSSG--LSLNLPSENI------GDTLKLSQLLN 306
           ++P+D I   ++   L C   G   YS S+   LSL +P  ++         +KL   +N
Sbjct: 445 LSPIDHIYRGQLENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCIN 504

Query: 307 EWCKPEIIEGVNCYRCSLNAVLEHLENQLKTMSEKPKGSIPDKLISAIKTRIKALNETLS 366
            +   E + G N + C    + +    + +  S+K K +I        ++R K+ +    
Sbjct: 505 LFTGDEELSGDNAWDCPNCRITDSKSKKEEITSQKKKSTI---FGFHSRSRSKSPHHHHH 561

Query: 367 KPVIDDEEYKKMHTDNMVRKSSKSKQIILARPPPLLSIHINRSVFDTRTFMIKKNNSRLA 426
                D+  K     N  +K +  K +     PP+L IH++R  +D    + KKN++ + 
Sbjct: 562 HHHSSDDSTKNAKKRNS-KKLTTIKSLDFIVLPPILVIHLSRFYYD----LTKKNSTVIT 616

Query: 427 FKARLNL 433
           +   LN+
Sbjct: 617 YPLILNI 623

>CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069c DOA4
           ubiquitin-specific protease
          Length = 887

 Score = 33.9 bits (76), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 28/60 (46%), Gaps = 2/60 (3%)

Query: 669 PLTYELRSVIVHYGTHNYGHYIAFR-KYRGTWWRISDETVHM-VDEAEVLSTPSVFMLFY 726
           P  Y L     H+GT   GHY ++  K     W   D+TV+  V       +PS ++LFY
Sbjct: 823 PFNYRLYGAACHFGTLYGGHYTSYVDKGPEKGWIYFDDTVYRPVRFQNEFISPSAYVLFY 882

>AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YFR010W (UBP6)
          Length = 446

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 12/18 (66%), Positives = 15/18 (83%)

Query: 36 GLVNEGNTCFMNSVLQSL 53
          G+VN GNTC+MN+ LQ L
Sbjct: 61 GIVNMGNTCYMNATLQGL 78

>Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (REAL)
          Length = 1060

 Score = 33.9 bits (76), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 33/76 (43%), Gaps = 14/76 (18%)

Query: 670  LTYELRSVIVHYGTHNYGHYIAFRKY---------RGTWWRISDETV-----HMVDEAEV 715
            + Y L  V+ H GT   GHY +             R  W+   DE V     H  D+   
Sbjct: 985  MKYRLFGVVNHTGTLISGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADKKHGSDKNLK 1044

Query: 716  LSTPSVFMLFYEYDFD 731
            +S+  V++LFYE  +D
Sbjct: 1045 ISSSDVYVLFYERVYD 1060

>NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712
          Length = 1030

 Score = 33.5 bits (75), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 64/306 (20%), Positives = 118/306 (38%), Gaps = 61/306 (19%)

Query: 149 YYRTNNLLKTMSKAPNKNIILGYEQEDAQEFFQTILYELEKNIKFLDSDREKLDKKPIPE 208
           + +  N+L+   K P+       +Q+D QEF   IL          D   ++L  +    
Sbjct: 680 FLKNCNVLRPDLKIPD-------DQQDTQEFLMIIL----------DRLHDELSNQQEVV 722

Query: 209 SDLPSNALIGQNNLSHVGTVYIPTAHLDPNSLLDKDPSTNYFTPFRLVTPLDGIVAERIG 268
           ++ PS  L   N+L           H +     +K    N  +P   +    G +   + 
Sbjct: 723 NEYPSLMLYDTNHLR--------VQHEEYKHWFEKSVIGNGLSPIDEI--FQGQIENGLQ 772

Query: 269 CLNCGETGGIRYSVSSGLSLNLPSENI-----GDTLKLSQLLNEWCKPEIIEGVN---CY 320
           C  CG +    YS    LSL +P  +         +KL   +N +   E++ G N   C 
Sbjct: 773 CQRCGHSS-FNYSTFYVLSLAIPKPSPTGFSRSKRVKLEDCINMFTNDEMLSGENAWDCP 831

Query: 321 RCSLNAVLEHLENQLKTMSEKPKG-------------SIPDKLISAIKTRIKALNETLSK 367
            C  NA      N  +++ +K +G             + P + +S  +    +   + SK
Sbjct: 832 NCGSNAQDRVRVNTDQSVKKKRQGEEHRHKSRFFGLPTRPHRSLSPFRKSGSSSTNSTSK 891

Query: 368 PVIDDEEYKKMHTDNMVRKSSKSKQIILARPPPLLSIHINRSVFDTRTFMIKKNNSRLAF 427
            +  ++++K        +K    K +     PP+L IH++R  +D    + KKN + + +
Sbjct: 892 -IKHEQQWK-------TKKLITIKTLNFIMLPPVLVIHLSRFFYD----LTKKNKTVITY 939

Query: 428 KARLNL 433
              LN+
Sbjct: 940 PLILNI 945

>Kwal_14.1957 s14 (549510..550844) [1335 bp, 444 aa] {ON} YER151C
           (UBP3) - Ubiquitin-specific protease [contig 231]
           PARTIAL
          Length = 444

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 3/49 (6%)

Query: 671 TYELRSVIVHYGTHNYG-HYI--AFRKYRGTWWRISDETVHMVDEAEVL 716
           TY+L  V+ H+G  + G HY    +++ +  W+RI D  V  ++  EVL
Sbjct: 376 TYKLIGVVYHHGVSSSGGHYTCDVYQEAQKKWFRIDDINVQEIEMEEVL 424

>AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR304W (UBP15)
          Length = 1166

 Score = 33.1 bits (74), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 27/61 (44%), Gaps = 2/61 (3%)

Query: 672 YELRSVIVHYGTHNYGHYIAFRK--YRGTWWRISDETVHMVDEAEVLSTPSVFMLFYEYD 729
           Y L  V+VH G  + GHY A  K      W+R  D+ V  V + +V      F    EYD
Sbjct: 427 YNLHGVLVHTGDISTGHYYAMIKPGLEDAWYRFDDDKVWRVTKKQVFEQNFGFDKLSEYD 486

Query: 730 F 730
            
Sbjct: 487 L 487

>YBR058C Chr2 complement(353672..356017) [2346 bp, 781 aa] {ON}
           UBP14Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains; involved in
           fructose-1,6-bisphosphatase (Fbp1p) degradation; similar
           to human isopeptidase T
          Length = 781

 Score = 33.1 bits (74), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 12/19 (63%), Positives = 17/19 (89%)

Query: 36  GLVNEGNTCFMNSVLQSLA 54
           GL+N GN+C++NSV+QSL 
Sbjct: 324 GLINLGNSCYLNSVIQSLV 342

>TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1186

 Score = 33.1 bits (74), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 25/51 (49%), Gaps = 2/51 (3%)

Query: 668 GPLTYELRSVIVHYGTHNYGHYIAFRK--YRGTWWRISDETVHMVDEAEVL 716
           GP  Y+L  V+VH G  + GHY    K   +  W+R  D+ V    + ++ 
Sbjct: 436 GPKIYKLHGVLVHTGDISTGHYYTLIKPSTKDEWYRFDDDRVWRATKKQIF 486

>Suva_4.295 Chr4 complement(520439..522787) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 33.1 bits (74), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 12/18 (66%), Positives = 17/18 (94%)

Query: 36  GLVNEGNTCFMNSVLQSL 53
           GL+N GN+C++NSV+QSL
Sbjct: 324 GLINLGNSCYLNSVMQSL 341

>Smik_2.189 Chr2 complement(335612..337960) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 33.1 bits (74), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 12/18 (66%), Positives = 17/18 (94%)

Query: 36  GLVNEGNTCFMNSVLQSL 53
           GL+N GN+C++NSV+QSL
Sbjct: 324 GLINLGNSCYLNSVMQSL 341

>Kpol_251.7 s251 (12280..13719) [1440 bp, 480 aa] {ON}
           (12280..13719) [1440 nt, 480 aa]
          Length = 480

 Score = 32.7 bits (73), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 13/18 (72%), Positives = 16/18 (88%)

Query: 36  GLVNEGNTCFMNSVLQSL 53
           GL+N GN+C+MNSVLQ L
Sbjct: 323 GLINLGNSCYMNSVLQLL 340

>NDAI0C05950 Chr3 complement(1361343..1364585) [3243 bp, 1080 aa]
           {ON} Anc_8.202 YER151C
          Length = 1080

 Score = 32.7 bits (73), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 27/57 (47%)

Query: 8   DPSGYRKWVTKNNLQIQNTVMKRGGFVGGLVNEGNTCFMNSVLQSLASSHEIVRFLD 64
           D + Y    T NN    + V  +     G+VN  N CFM+S+LQ L S    +  L+
Sbjct: 539 DFTNYALETTSNNNTKDHKVPIKSIVSRGIVNVANICFMSSILQMLLSCKPFIDVLN 595

>Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [3501
           bp, 1166 aa] {ON} ANNOTATED BY YGOB -
          Length = 1166

 Score = 32.7 bits (73), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 669 PLTYELRSVIVHYGTHNYGHYIAFRK--YRGTWWRISDETVHMVDEAEVL 716
           P  Y L  V+VH G  + GHY A  +    G+W+R  D+ V    + +V 
Sbjct: 428 PADYILHGVLVHSGDISTGHYYAMIQPDAHGSWYRFDDDRVIKATDKQVF 477

>TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512
           bp, 503 aa] {ON} Anc_1.369 YFR010W
          Length = 503

 Score = 32.3 bits (72), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 4/49 (8%)

Query: 671 TYELRSVIVHYGTHN-YGHYIAF---RKYRGTWWRISDETVHMVDEAEV 715
            Y L  +I H G ++  GHY AF   R+    W++ +D+ V +VD+ ++
Sbjct: 433 VYNLIGIITHQGANSESGHYQAFIRDREDEEIWYKFNDDKVTIVDKEKI 481

>Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W (REAL)
          Length = 1064

 Score = 32.3 bits (72), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 33/77 (42%), Gaps = 14/77 (18%)

Query: 670  LTYELRSVIVHYGTHNYGHYIAFRKY---------RGTWWRISDETV-----HMVDEAEV 715
            + Y L  V+ H GT   GHY +             R  W+   DE V     H  D+   
Sbjct: 988  MKYRLFGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKNLK 1047

Query: 716  LSTPSVFMLFYEYDFDE 732
            +S+  V++LFYE   D+
Sbjct: 1048 ISSSDVYVLFYERVHDQ 1064

>TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {ON}
           Anc_1.225 YJL128C
          Length = 690

 Score = 32.3 bits (72), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 22/102 (21%), Positives = 46/102 (45%), Gaps = 4/102 (3%)

Query: 347 PDKLISAIKTRIKALNETLSKPVIDDEEYKKMHTDNMVRKSSKSKQIILARPPPLLSIHI 406
           PDK   ++++ + +L  ++ +  + D  Y     DN+  + S     I+  PPP L    
Sbjct: 564 PDKSTYSVQSDVWSLGLSILELALGDYPYPPETFDNIFSQLSA----IVDGPPPKLPERF 619

Query: 407 NRSVFDTRTFMIKKNNSRLAFKARLNLKPWCCDVNDINLDAR 448
           +    +  T  ++KN  R     +L + PW     D++++ +
Sbjct: 620 SPEAQEFVTLCLQKNPDRRPTYTQLLMHPWLLKYRDVDVNMK 661

>Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {ON}
           similar to Ashbya gossypii AGL357W
          Length = 1176

 Score = 32.3 bits (72), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 2/55 (3%)

Query: 664 KVPTGPLTYELRSVIVHYGTHNYGHYIAFRK--YRGTWWRISDETVHMVDEAEVL 716
           K+    + Y L  V+VH G  + GHY A  K      W+R  D+ V  V + +V 
Sbjct: 428 KIRPESMMYNLHGVLVHTGDISTGHYYAMIKPGLDDKWYRFDDDKVWQVTKKQVF 482

>SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} similar to
            uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
            Ubiquitin-specific protease present in the nucleus and
            cytoplasm that cleaves ubiquitin from ubiquitinated
            proteins
          Length = 1297

 Score = 32.3 bits (72), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 3/58 (5%)

Query: 671  TYELRSVIVHYGTHNYGHYIAFRK--YRGTWWRISDETVHMVDEAEVLSTPSVFMLFY 726
             Y+L +V  H+G    GHY A+ K      W+   D  V  VD AE +++   ++LFY
Sbjct: 1031 VYDLIAVDNHFGGLGSGHYTAYVKNPVDDKWYLFDDSEVREVD-AESVASSFGYLLFY 1087

>CAGL0H10186g Chr8 complement(993354..995690) [2337 bp, 778 aa] {ON}
           similar to uniprot|P38237 Saccharomyces cerevisiae
           YBR058c UBP14 ubiquitin specific protease
          Length = 778

 Score = 32.0 bits (71), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 3/60 (5%)

Query: 270 LNCGETGGIRYSVSSGLSLNLPSENIGDTLKLSQLLNEWCKPEIIEGVNCYRCS--LNAV 327
           L C E  G++YS  +   + LP +   D   L + +N +   E+IE   C  C   +NAV
Sbjct: 458 LQCQECHGVKYSTETSNVIQLPLQESNDAQDLEERINAYFSGEVIE-FKCPNCKKMVNAV 516

>CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON}
           similar to uniprot|P50101 Saccharomyces cerevisiae
           YMR304w UBP15
          Length = 1196

 Score = 32.0 bits (71), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 22/48 (45%), Gaps = 2/48 (4%)

Query: 671 TYELRSVIVHYGTHNYGHYIAFRK--YRGTWWRISDETVHMVDEAEVL 716
            Y L  V+VH G  + GHY    K      W+R  DE V  V + +V 
Sbjct: 438 VYNLHGVLVHAGDISTGHYYTLIKPGLEDQWYRFDDERVWKVTKNQVF 485

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.131    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 82,217,751
Number of extensions: 3593958
Number of successful extensions: 16502
Number of sequences better than 10.0: 478
Number of HSP's gapped: 16743
Number of HSP's successfully gapped: 602
Length of query: 824
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 706
Effective length of database: 39,950,811
Effective search space: 28205272566
Effective search space used: 28205272566
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 70 (31.6 bits)