Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0B059702.292ON71971935200.0
YIL091C (UTP25)2.292ON72171923710.0
Suva_9.1082.292ON72272523700.0
Smik_9.882.292ON72472523490.0
NDAI0B035302.292ON73972323300.0
Skud_9.822.292ON72271323300.0
KAFR0J013402.292ON72856422940.0
KNAG0A054002.292ON72171822720.0
NCAS0B062302.292ON72372722450.0
TDEL0G022202.292ON71056322230.0
SAKL0E07546g2.292ON71856522130.0
Kpol_1039.462.292ON70456321940.0
CAGL0D04180g2.292ON70057021880.0
TPHA0D015202.292ON71656321800.0
KLTH0G10494g2.292ON74756521820.0
Kwal_27.115032.292ON72756421660.0
ZYRO0A02002g2.292ON70956221420.0
KLLA0E08229g2.292ON70456521340.0
Ecym_33312.292ON70856621060.0
ADL209C2.292ON70456620470.0
KAFR0B03200na 1ON444169733.6
TDEL0F050508.381ON1470144734.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0B05970
         (719 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0B05970 Chr2 complement(1410055..1412214) [2160 bp, 719 aa] ...  1360   0.0  
YIL091C Chr9 complement(191030..193195) [2166 bp, 721 aa] {ON}  ...   917   0.0  
Suva_9.108 Chr9 complement(185226..187394) [2169 bp, 722 aa] {ON...   917   0.0  
Smik_9.88 Chr9 complement(170163..172337) [2175 bp, 724 aa] {ON}...   909   0.0  
NDAI0B03530 Chr2 (887479..889698) [2220 bp, 739 aa] {ON} Anc_2.2...   902   0.0  
Skud_9.82 Chr9 complement(167750..169918) [2169 bp, 722 aa] {ON}...   902   0.0  
KAFR0J01340 Chr10 (245485..247671) [2187 bp, 728 aa] {ON} Anc_2....   888   0.0  
KNAG0A05400 Chr1 (795728..797893) [2166 bp, 721 aa] {ON} Anc_2.2...   879   0.0  
NCAS0B06230 Chr2 (1175844..1178015) [2172 bp, 723 aa] {ON} Anc_2...   869   0.0  
TDEL0G02220 Chr7 complement(434650..436782) [2133 bp, 710 aa] {O...   860   0.0  
SAKL0E07546g Chr5 (610979..613135) [2157 bp, 718 aa] {ON} simila...   857   0.0  
Kpol_1039.46 s1039 complement(138925..141039) [2115 bp, 704 aa] ...   849   0.0  
CAGL0D04180g Chr4 complement(411498..413600) [2103 bp, 700 aa] {...   847   0.0  
TPHA0D01520 Chr4 (310797..312947) [2151 bp, 716 aa] {ON} Anc_2.2...   844   0.0  
KLTH0G10494g Chr7 complement(885735..887978) [2244 bp, 747 aa] {...   845   0.0  
Kwal_27.11503 s27 (828115..830298) [2184 bp, 727 aa] {ON} YIL091...   838   0.0  
ZYRO0A02002g Chr1 complement(164386..166515) [2130 bp, 709 aa] {...   829   0.0  
KLLA0E08229g Chr5 (742066..744180) [2115 bp, 704 aa] {ON} simila...   826   0.0  
Ecym_3331 Chr3 complement(631944..634070) [2127 bp, 708 aa] {ON}...   815   0.0  
ADL209C Chr4 complement(334817..336931) [2115 bp, 704 aa] {ON} S...   793   0.0  
KAFR0B03200 Chr2 (661966..663300) [1335 bp, 444 aa] {ON}  YMR210W      33   3.6  
TDEL0F05050 Chr6 (947571..951983) [4413 bp, 1470 aa] {ON} Anc_8....    33   4.3  

>TBLA0B05970 Chr2 complement(1410055..1412214) [2160 bp, 719 aa]
           {ON} Anc_2.292 YIL091C
          Length = 719

 Score = 1360 bits (3520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 670/719 (93%), Positives = 670/719 (93%)

Query: 1   MSGFKPQNNYSEGYGKRGRSQKRSIKKSSGAKRFKTEDTRIVKETIEDESSDEDVSNTSI 60
           MSGFKPQNNYSEGYGKRGRSQKRSIKKSSGAKRFKTEDTRIVKETIEDESSDEDVSNTSI
Sbjct: 1   MSGFKPQNNYSEGYGKRGRSQKRSIKKSSGAKRFKTEDTRIVKETIEDESSDEDVSNTSI 60

Query: 61  DKEAEVTEDLEKKKQVYDALVTILKSEHKEPKMRDNLNETSKXXXXXXXXXXXXXXXXXX 120
           DKEAEVTEDLEKKKQVYDALVTILKSEHKEPKMRDNLNETSK                  
Sbjct: 61  DKEAEVTEDLEKKKQVYDALVTILKSEHKEPKMRDNLNETSKEEHLTDEDLDEDEKFETE 120

Query: 121 XXXXXXXXXSIKXXXXXXXXXXXXXXXXXXXXXXKSDPFDSHFNQPTEQFTNKFADAFKN 180
                    SIK                      KSDPFDSHFNQPTEQFTNKFADAFKN
Sbjct: 121 EQEIENNLLSIKDDEEEGENNDDNAGESDDESDNKSDPFDSHFNQPTEQFTNKFADAFKN 180

Query: 181 KQIKYRSIKYKINEYESSIYSEPRILEDEQTKVKSPVLKSSIHSYALKKRLKINNDLLDP 240
           KQIKYRSIKYKINEYESSIYSEPRILEDEQTKVKSPVLKSSIHSYALKKRLKINNDLLDP
Sbjct: 181 KQIKYRSIKYKINEYESSIYSEPRILEDEQTKVKSPVLKSSIHSYALKKRLKINNDLLDP 240

Query: 241 AVNNLTTIQKELVDPMFQYKDILYEYGNYGKDEEEYRSLYCLHVLNHIYKTRDRILKNNS 300
           AVNNLTTIQKELVDPMFQYKDILYEYGNYGKDEEEYRSLYCLHVLNHIYKTRDRILKNNS
Sbjct: 241 AVNNLTTIQKELVDPMFQYKDILYEYGNYGKDEEEYRSLYCLHVLNHIYKTRDRILKNNS 300

Query: 301 KVQDNPDAEFLDQGFTRPKVLIVAPTRDAGYSIVNEIIKKSGIDQIDKKSKFRDQFYEES 360
           KVQDNPDAEFLDQGFTRPKVLIVAPTRDAGYSIVNEIIKKSGIDQIDKKSKFRDQFYEES
Sbjct: 301 KVQDNPDAEFLDQGFTRPKVLIVAPTRDAGYSIVNEIIKKSGIDQIDKKSKFRDQFYEES 360

Query: 361 LLPASKPKSFQAVFKGNSNDYFVLGIKFTRKAIKLYSNFYQSDIIVCSPLGLHMILENTD 420
           LLPASKPKSFQAVFKGNSNDYFVLGIKFTRKAIKLYSNFYQSDIIVCSPLGLHMILENTD
Sbjct: 361 LLPASKPKSFQAVFKGNSNDYFVLGIKFTRKAIKLYSNFYQSDIIVCSPLGLHMILENTD 420

Query: 421 KKKRQDDFLSSIELMIIDQLHSMEFQNISHVTSIFEHINKIPKEQHDTDFSRIKMWYIND 480
           KKKRQDDFLSSIELMIIDQLHSMEFQNISHVTSIFEHINKIPKEQHDTDFSRIKMWYIND
Sbjct: 421 KKKRQDDFLSSIELMIIDQLHSMEFQNISHVTSIFEHINKIPKEQHDTDFSRIKMWYIND 480

Query: 481 QAKLFRQTMIFTKYISPSANFFLNGKCQNWSGRWKNHKMITPNESSIGQLGLRVKQMFHR 540
           QAKLFRQTMIFTKYISPSANFFLNGKCQNWSGRWKNHKMITPNESSIGQLGLRVKQMFHR
Sbjct: 481 QAKLFRQTMIFTKYISPSANFFLNGKCQNWSGRWKNHKMITPNESSIGQLGLRVKQMFHR 540

Query: 541 FDIIGGSIVDEPDYRFKYFTSVIVQSITKSTSYEDGMLIYITDYTDYVRVRNYLKEKTTI 600
           FDIIGGSIVDEPDYRFKYFTSVIVQSITKSTSYEDGMLIYITDYTDYVRVRNYLKEKTTI
Sbjct: 541 FDIIGGSIVDEPDYRFKYFTSVIVQSITKSTSYEDGMLIYITDYTDYVRVRNYLKEKTTI 600

Query: 601 LFGDINEYSDQKQVNSNRALFQQRRVKVLLYTERLHHFRRYEIKGVKNIVFYKAPTNPEF 660
           LFGDINEYSDQKQVNSNRALFQQRRVKVLLYTERLHHFRRYEIKGVKNIVFYKAPTNPEF
Sbjct: 601 LFGDINEYSDQKQVNSNRALFQQRRVKVLLYTERLHHFRRYEIKGVKNIVFYKAPTNPEF 660

Query: 661 YNEVVRYIGKNAFTGNTDINISNVRTIYSKLDGLALERIMGTKRAAVLTHGQNETYEFK 719
           YNEVVRYIGKNAFTGNTDINISNVRTIYSKLDGLALERIMGTKRAAVLTHGQNETYEFK
Sbjct: 661 YNEVVRYIGKNAFTGNTDINISNVRTIYSKLDGLALERIMGTKRAAVLTHGQNETYEFK 719

>YIL091C Chr9 complement(191030..193195) [2166 bp, 721 aa] {ON}
           UTP25Nucleolar protein required for 35S pre-RNA
           processing and 40S ribosomal subunit biogenesis
          Length = 721

 Score =  917 bits (2371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/719 (61%), Positives = 552/719 (76%), Gaps = 2/719 (0%)

Query: 2   SGFKPQNNYSEGYGKRGRSQKRSIKKSSG-AKRFKTEDTRIVKETIEDESSDEDVSNTSI 60
           S  + +N+   GY KRGR + R IK+SS   +   TE    V E I+  S +++VS+   
Sbjct: 4   SSVREKNDNFRGYRKRGRQELRKIKRSSARTEGGSTETLEDVAEDIDHRSDEDEVSDVDS 63

Query: 61  DKEAEVTEDLEKKKQVYDALVTILKSEHKEPKMRDNLNETSKXXXXXXXXXXXXXXXXXX 120
             + ++ ++  KK++VYDAL+TILKSEH EPK R    + S                   
Sbjct: 64  GDDFDIEDEEGKKEKVYDALLTILKSEHPEPKRRRREADESNKAPAEVGEDEHENTEHGP 123

Query: 121 XXXXXXXXXSIKXXXXXXXXXXXXXXXXXXXXXXKSDPFDSHFNQPTEQFTNKFADAFKN 180
                     +                       + DPF+SHFNQ  E+F +K ++AFK 
Sbjct: 124 VDDQLEIENGLLGNHEDDNDDDSSGDEKDIDSEDEQDPFESHFNQVPEKFVDKLSNAFKT 183

Query: 181 KQIKYRSIKYKINEYESSIYSEPRILEDEQTKVKSPVLKSSIHSYALKKRLKINNDLLDP 240
           K +KY+S+K  +++ ES IY++P ++  E+  V+SP   SSI+SY LK+RLK+ N LLD 
Sbjct: 184 KSVKYKSVKGSLSDSESYIYAKPVVI-GEEALVESPYRSSSIYSYFLKQRLKVQNGLLDK 242

Query: 241 AVNNLTTIQKELVDPMFQYKDILYEYGNYGKDEEEYRSLYCLHVLNHIYKTRDRILKNNS 300
             + LT +QK+LVDPMFQYKDILYEY +Y KDE+EYR LY LHVLNHIYKTRDRILKNN 
Sbjct: 243 KTDPLTALQKKLVDPMFQYKDILYEYDSYEKDEDEYRDLYALHVLNHIYKTRDRILKNNQ 302

Query: 301 KVQDNPDAEFLDQGFTRPKVLIVAPTRDAGYSIVNEIIKKSGIDQIDKKSKFRDQFYEES 360
           ++QDNPD E LDQGFTRPKVLIV PTR+  Y +V++II KSGIDQ+DKK KF DQF ++S
Sbjct: 303 RLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDS 362

Query: 361 LLPASKPKSFQAVFKGNSNDYFVLGIKFTRKAIKLYSNFYQSDIIVCSPLGLHMILENTD 420
           L P SKPKSFQ +F+GN+ND+FV+G+KFTRKAIKLYSNFYQSDIIVCSPLG+ MILENTD
Sbjct: 363 LPPKSKPKSFQHIFRGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTD 422

Query: 421 KKKRQDDFLSSIELMIIDQLHSMEFQNISHVTSIFEHINKIPKEQHDTDFSRIKMWYIND 480
           KKKRQDDFLSSIELM+IDQLHS+E+QNISH+ +IF+H+NKIP +QH+ DFSRI+MWYIN+
Sbjct: 423 KKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHLNKIPDQQHEADFSRIRMWYINE 482

Query: 481 QAKLFRQTMIFTKYISPSANFFLNGKCQNWSGRWKNHKMITPNESSIGQLGLRVKQMFHR 540
           QAKLFRQTM+FTKYISP+AN  +NG+C+N +GRWKNHK+I    SSIGQ GL+++Q+F R
Sbjct: 483 QAKLFRQTMVFTKYISPAANSLINGRCRNMAGRWKNHKVIGSENSSIGQSGLKIRQIFQR 542

Query: 541 FDIIGGSIVDEPDYRFKYFTSVIVQSITKSTSYEDGMLIYITDYTDYVRVRNYLKEKTTI 600
           FDIIG SI++EPDYRFK+FTSVI+  I KST YEDG+LIYI DYTD++R+RNY+KEKTTI
Sbjct: 543 FDIIGNSIIEEPDYRFKFFTSVIIPGIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTI 602

Query: 601 LFGDINEYSDQKQVNSNRALFQQRRVKVLLYTERLHHFRRYEIKGVKNIVFYKAPTNPEF 660
           LFGDINEYS Q+Q+N+NR+LFQQ R+KV+LYTERLHH+RRYEIKGVK++VFYK P NPEF
Sbjct: 603 LFGDINEYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKPPNNPEF 662

Query: 661 YNEVVRYIGKNAFTGNTDINISNVRTIYSKLDGLALERIMGTKRAAVLTHGQNETYEFK 719
           YNEVVR+IGKNAF GNTD+NIS VR IYSKLDGL+LERI+GTKRAAVL+H Q E YEFK
Sbjct: 663 YNEVVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKEIYEFK 721

>Suva_9.108 Chr9 complement(185226..187394) [2169 bp, 722 aa] {ON}
           YIL091C (REAL)
          Length = 722

 Score =  917 bits (2370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/725 (61%), Positives = 557/725 (76%), Gaps = 9/725 (1%)

Query: 1   MSGFKPQNN--YSEGYGKRGRSQKRSIKKSSGAKRFKTEDT----RIVKETIEDESSDED 54
           MSG   + N  +  G+ KRGR + R IK+++ A+R +  DT     + +E++E ++ D  
Sbjct: 1   MSGKSARENDEHFRGHRKRGRQEMRKIKRTT-ARRTEDVDTNEVDHVAEESVETKAEDA- 58

Query: 55  VSNTSIDKEAEVTEDLEKKKQVYDALVTILKSEHKEPKMRDNLNETSKXXXXXXXXXXXX 114
           +S+   + + ++ ++ EK+++VYDAL+TILKSEH EPK +                    
Sbjct: 59  ISDAGSESDLDIGDEEEKQEKVYDALLTILKSEHPEPKRKKTKATGENNEAVDQTGVNEN 118

Query: 115 XXXXXXXXXXXXXXXSIKXXXXXXXXXXXXXXXXXXXXXXKSDPFDSHFNQPTEQFTNKF 174
                           +                       + DPF+SHFNQ +E++ +  
Sbjct: 119 TDSEPVDDQLEIENGLLSDQEDDSDDDGDENEQDEVDSEDEQDPFESHFNQVSEKYVDDV 178

Query: 175 ADAFKNKQIKYRSIKYKINEYESSIYSEPRILEDEQTKVKSPVLKSSIHSYALKKRLKIN 234
           ++AFK   IKY+S+K  + + ES IYS+P +  DE T V+ P   SSI+SY LK+RLKI 
Sbjct: 179 SNAFKANNIKYKSVKSPLGDDESCIYSKPVVNGDE-TPVERPYKSSSIYSYFLKQRLKIQ 237

Query: 235 NDLLDPAVNNLTTIQKELVDPMFQYKDILYEYGNYGKDEEEYRSLYCLHVLNHIYKTRDR 294
           N LLD  ++ LT++QK+LVDPMFQYKDILYEY +Y KDE+EYR LY LH LNHIYKTRDR
Sbjct: 238 NGLLDKKIDPLTSLQKKLVDPMFQYKDILYEYDSYEKDEDEYRDLYTLHALNHIYKTRDR 297

Query: 295 ILKNNSKVQDNPDAEFLDQGFTRPKVLIVAPTRDAGYSIVNEIIKKSGIDQIDKKSKFRD 354
           ILKNN ++QDNPD E LDQGFTRPKVLIV PTRDA Y +V++IIKKSGIDQ+DKK KF D
Sbjct: 298 ILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTRDAAYHVVDKIIKKSGIDQVDKKGKFYD 357

Query: 355 QFYEESLLPASKPKSFQAVFKGNSNDYFVLGIKFTRKAIKLYSNFYQSDIIVCSPLGLHM 414
           QF ++SL P+SKPKSFQ +F+GN++D+FV+G+KFTRKAIKLYSNFYQSDIIVCSPLG+ M
Sbjct: 358 QFRDDSLPPSSKPKSFQHIFRGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQM 417

Query: 415 ILENTDKKKRQDDFLSSIELMIIDQLHSMEFQNISHVTSIFEHINKIPKEQHDTDFSRIK 474
           ILENTDKKKRQDDFLSSIELM+IDQLHS+E+QNISH+ +IF+HINKIP +QH+ DFSRI+
Sbjct: 418 ILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFSRIR 477

Query: 475 MWYINDQAKLFRQTMIFTKYISPSANFFLNGKCQNWSGRWKNHKMITPNESSIGQLGLRV 534
           MWYIN+QAKL RQTM+FTKYISP+AN  +NG+C+N +GRWKNHK+I    SSIGQLGL++
Sbjct: 478 MWYINEQAKLLRQTMVFTKYISPAANSLINGRCRNLAGRWKNHKVIESETSSIGQLGLKI 537

Query: 535 KQMFHRFDIIGGSIVDEPDYRFKYFTSVIVQSITKSTSYEDGMLIYITDYTDYVRVRNYL 594
           +Q+F RFDIIG SI++EPDYRFK+FTSVI+ SI KST YEDG+LIYI DYTD++R+RNY+
Sbjct: 538 RQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVKSTGYEDGILIYIPDYTDFIRIRNYM 597

Query: 595 KEKTTILFGDINEYSDQKQVNSNRALFQQRRVKVLLYTERLHHFRRYEIKGVKNIVFYKA 654
           KEKTTILFGDINEYS QKQ+N+NR+LFQQ RVKVLLYTERLHH+RRYEIKGVKN++FYK 
Sbjct: 598 KEKTTILFGDINEYSSQKQLNANRSLFQQGRVKVLLYTERLHHYRRYEIKGVKNVIFYKP 657

Query: 655 PTNPEFYNEVVRYIGKNAFTGNTDINISNVRTIYSKLDGLALERIMGTKRAAVLTHGQNE 714
           P NPEFYNE VRYIGKNAF GNTD+NIS VR +YSKLDGL+LERI+GTKRA VL+H Q E
Sbjct: 658 PNNPEFYNETVRYIGKNAFLGNTDLNISTVRCVYSKLDGLSLERIVGTKRAGVLSHAQKE 717

Query: 715 TYEFK 719
            YEFK
Sbjct: 718 VYEFK 722

>Smik_9.88 Chr9 complement(170163..172337) [2175 bp, 724 aa] {ON}
           YIL091C (REAL)
          Length = 724

 Score =  909 bits (2349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/725 (61%), Positives = 554/725 (76%), Gaps = 17/725 (2%)

Query: 5   KPQNNYSEGYGKRGRSQKRSIKKSSGAKRFKTEDTRIVKETIEDESSDEDVSNTSIDKEA 64
           + +N++  GY KRGR + R IK+SS  +R K E    V     D  +DE V +T  DK +
Sbjct: 7   REKNDHFRGYRKRGRQELRKIKRSS-VRRTKDESVNEV-----DHVADEIVHSTGEDKIS 60

Query: 65  EV--------TEDLE-KKKQVYDALVTILKSEHKEPKMRDN-LNETSKXXXXXXXXXXXX 114
           ++         ED E KK++VYDAL+TILKSEH EPK R    +E +K            
Sbjct: 61  DIGSEEDNLDVEDEEGKKEKVYDALLTILKSEHPEPKRRKTQADEDNKAAAKPAGNENVN 120

Query: 115 XXXXXXXXXXXXXXXSIKXXXXXXXXXXXXXXXXXXXXXXKSDPFDSHFNQPTEQFTNKF 174
                           +                       + DPF+SHFNQ +E++ +  
Sbjct: 121 VEYEPVDEQLEIENGLLGDREDDNDDDSNENEKDDMDSEDEQDPFESHFNQVSEKYVDDL 180

Query: 175 ADAFKNKQIKYRSIKYKINEYESSIYSEPRILEDEQTKVKSPVLKSSIHSYALKKRLKIN 234
           ++AFK+K IKY+S+K  + + ES IY++P  +  E+  V+SP   SSI+SY LK+RLK+ 
Sbjct: 181 SNAFKSKSIKYKSVKASLGDDESYIYAKP-FMVGEEALVESPYRSSSIYSYFLKQRLKVQ 239

Query: 235 NDLLDPAVNNLTTIQKELVDPMFQYKDILYEYGNYGKDEEEYRSLYCLHVLNHIYKTRDR 294
           N LLD  ++ LT +QK+L+DPMFQYKDILYEY +Y KDE EYR LY LHVLNHIYKTRDR
Sbjct: 240 NGLLDKKIDPLTCMQKKLIDPMFQYKDILYEYDSYEKDESEYRDLYALHVLNHIYKTRDR 299

Query: 295 ILKNNSKVQDNPDAEFLDQGFTRPKVLIVAPTRDAGYSIVNEIIKKSGIDQIDKKSKFRD 354
           ILKNN ++QDNPD E LDQGFTRPKVLIV PTR+  Y +V++II KSGIDQ+DKK KF D
Sbjct: 300 ILKNNQRLQDNPDTEHLDQGFTRPKVLIVVPTREVAYRVVDKIISKSGIDQVDKKGKFYD 359

Query: 355 QFYEESLLPASKPKSFQAVFKGNSNDYFVLGIKFTRKAIKLYSNFYQSDIIVCSPLGLHM 414
           QF ++SL P SKPKSFQ +FKGN++D+FV+G+KFTRKAIKLYSNFYQSDII+CSPLG+ M
Sbjct: 360 QFRDDSLPPESKPKSFQHIFKGNTSDFFVVGLKFTRKAIKLYSNFYQSDIIICSPLGIQM 419

Query: 415 ILENTDKKKRQDDFLSSIELMIIDQLHSMEFQNISHVTSIFEHINKIPKEQHDTDFSRIK 474
           ILENTDKKKRQDDFLSSIELM+IDQLHS+E+QNISH+ +IF+HINKIP +QH+ DFSRI+
Sbjct: 420 ILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNISHIFTIFDHINKIPDQQHEADFSRIR 479

Query: 475 MWYINDQAKLFRQTMIFTKYISPSANFFLNGKCQNWSGRWKNHKMITPNESSIGQLGLRV 534
           MWYIN+QAKLFRQTM+FTKYISP+AN  +NG+C N +GRWKNHK+I    SSIGQLGL+V
Sbjct: 480 MWYINEQAKLFRQTMVFTKYISPAANSLINGRCCNMAGRWKNHKVIGSESSSIGQLGLKV 539

Query: 535 KQMFHRFDIIGGSIVDEPDYRFKYFTSVIVQSITKSTSYEDGMLIYITDYTDYVRVRNYL 594
           +Q+F RFDIIG SI++EPDYRFK+FTSVI+ SI KS  YEDG+L+YI DYTD++R+RNY+
Sbjct: 540 RQIFQRFDIIGNSIIEEPDYRFKFFTSVIIPSIVKSVGYEDGILVYIPDYTDFIRIRNYM 599

Query: 595 KEKTTILFGDINEYSDQKQVNSNRALFQQRRVKVLLYTERLHHFRRYEIKGVKNIVFYKA 654
           KEKTTILFGDINEYS+Q+Q+N+NR+LFQQ R+KV+LYTERLHH+RRYEIKGVK++VFYK 
Sbjct: 600 KEKTTILFGDINEYSNQRQLNANRSLFQQGRLKVMLYTERLHHYRRYEIKGVKSVVFYKP 659

Query: 655 PTNPEFYNEVVRYIGKNAFTGNTDINISNVRTIYSKLDGLALERIMGTKRAAVLTHGQNE 714
           P NPEFYNE VR+IGKNAF GNTD+NIS VR IYSKLDGL+LERI+GTKRAAVL+H Q E
Sbjct: 660 PNNPEFYNETVRFIGKNAFLGNTDLNISTVRCIYSKLDGLSLERIVGTKRAAVLSHAQKE 719

Query: 715 TYEFK 719
            YEFK
Sbjct: 720 VYEFK 724

>NDAI0B03530 Chr2 (887479..889698) [2220 bp, 739 aa] {ON} Anc_2.292
           YIL091C
          Length = 739

 Score =  902 bits (2330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/723 (61%), Positives = 549/723 (75%), Gaps = 12/723 (1%)

Query: 8   NNYSEGYGKRGRSQKRSIKKSSGAK-RFK---TEDTRIVKETIEDESSDEDVSNTSIDKE 63
           NN ++ + KRGR + R+I++S+  K R+    TE     +   E+    E+       ++
Sbjct: 18  NNSNDHHRKRGRQELRTIRRSAAKKSRYDSNVTEHNDTEELLQEESEEGEEDEEDDQSEQ 77

Query: 64  AEVTEDLEKKKQVYDALVTILKSEHKEPKMRDN-----LNETSKXXXXXXXXXXXXXXXX 118
            EV ED E+K +VY AL+TIL++EH EPK +       L E                   
Sbjct: 78  EEVDED-ERKGKVYGALLTILETEHPEPKHKRQPKEKLLKEQVSDSNLNNTGDRETEDSI 136

Query: 119 XXXXXXXXXXXSIKXXXXXXXXXXXXXXXXXXXXXXKSDPFDSHFNQPTEQFTNKFADAF 178
                       +                       + DPF+SHFN+PTEQF +K   AF
Sbjct: 137 IEEDETEQIENGLLDRDDEQSDDDQLNDSNDVESDDEQDPFESHFNKPTEQFVDKLHAAF 196

Query: 179 KNKQIKYRSIKYKINEYESSIYSEPRIL--EDEQTKVKSPVLKSSIHSYALKKRLKINND 236
           ++++IKY++ K  I++  S I S+P I   E E  ++ S     SI SY +K+RLKI N+
Sbjct: 197 ESREIKYKATKIVIDDSHSVISSKPTIFGEELETNRLSSSKHGQSIFSYFIKQRLKIQNN 256

Query: 237 LLDPAVNNLTTIQKELVDPMFQYKDILYEYGNYGKDEEEYRSLYCLHVLNHIYKTRDRIL 296
           LL+P V+ LT +QKEL+DPMFQYKDILYEY +YGKDE+EYR LY LH LNH+YKTRDRIL
Sbjct: 257 LLNPKVDPLTPLQKELLDPMFQYKDILYEYDSYGKDEDEYRDLYALHALNHVYKTRDRIL 316

Query: 297 KNNSKVQDNPDAEFLDQGFTRPKVLIVAPTRDAGYSIVNEIIKKSGIDQIDKKSKFRDQF 356
           KNN ++QDN D E+LDQGFTRPKVLIV PTRD  Y + ++IIKKSG+DQ+DKK KF DQF
Sbjct: 317 KNNQRLQDNTDTEYLDQGFTRPKVLIVVPTRDTAYEVTDKIIKKSGLDQVDKKGKFYDQF 376

Query: 357 YEESLLPASKPKSFQAVFKGNSNDYFVLGIKFTRKAIKLYSNFYQSDIIVCSPLGLHMIL 416
            ++SL P+SKPKSFQ +FKGN+ND+FVLG+KFTRKAIKLYSNFYQSDIIVCSPLG+ MI+
Sbjct: 377 KDDSLPPSSKPKSFQQIFKGNTNDFFVLGLKFTRKAIKLYSNFYQSDIIVCSPLGMQMIV 436

Query: 417 ENTDKKKRQDDFLSSIELMIIDQLHSMEFQNISHVTSIFEHINKIPKEQHDTDFSRIKMW 476
           ENTDKKKRQDDFLSSIEL+I+DQLHS+E+QN++H+ +IF+H+NKIP EQHD DFSRI+MW
Sbjct: 437 ENTDKKKRQDDFLSSIELLIVDQLHSLEYQNLAHIFTIFDHLNKIPTEQHDADFSRIRMW 496

Query: 477 YINDQAKLFRQTMIFTKYISPSANFFLNGKCQNWSGRWKNHKMITPNESSIGQLGLRVKQ 536
           YINDQAKLFRQTM+FTKY+SP+AN  +N +C+NW GRWKNHK++ P  SSIG+LGL++KQ
Sbjct: 497 YINDQAKLFRQTMVFTKYVSPAANAIINNRCRNWEGRWKNHKIVAPEVSSIGKLGLKIKQ 556

Query: 537 MFHRFDIIGGSIVDEPDYRFKYFTSVIVQSITKSTSYEDGMLIYITDYTDYVRVRNYLKE 596
           +F RFDI+GGSIVDEPDYRFK+FTSVI+ SI KSTSY+DG+LIYI DYTDYVR+RNYLKE
Sbjct: 557 IFQRFDIMGGSIVDEPDYRFKHFTSVIIPSIVKSTSYDDGILIYIPDYTDYVRIRNYLKE 616

Query: 597 KTTILFGDINEYSDQKQVNSNRALFQQRRVKVLLYTERLHHFRRYEIKGVKNIVFYKAPT 656
           KT ILFGDINEYS+Q+++NSNR+L QQ RVKVLLYTERLHH+RRYEIKGVK++VFYK PT
Sbjct: 617 KTRILFGDINEYSEQRELNSNRSLLQQGRVKVLLYTERLHHYRRYEIKGVKSVVFYKPPT 676

Query: 657 NPEFYNEVVRYIGKNAFTGNTDINISNVRTIYSKLDGLALERIMGTKRAAVLTHGQNETY 716
           NPEFYNEVVR+IGKNAF GNTD+NIS VRT+Y KLDGL+LERI+GTKRA +L H QNE Y
Sbjct: 677 NPEFYNEVVRFIGKNAFLGNTDLNISTVRTVYCKLDGLSLERIVGTKRAGILCHAQNEVY 736

Query: 717 EFK 719
           EFK
Sbjct: 737 EFK 739

>Skud_9.82 Chr9 complement(167750..169918) [2169 bp, 722 aa] {ON}
           YIL091C (REAL)
          Length = 722

 Score =  902 bits (2330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/713 (60%), Positives = 545/713 (76%), Gaps = 3/713 (0%)

Query: 9   NYSEGYGKRGRSQKRSIKKSSGAKRFKTEDTRI--VKETIEDESSDEDVSNTSIDKEAEV 66
           ++  G+ KRGR + R IK+SSG +    +  +I  V E     + ++ VS+   + + +V
Sbjct: 11  DHHRGHRKRGRQELRKIKRSSGRRTEDVDADKIDYVAEEPVGRNDNDAVSDVGSEDDLDV 70

Query: 67  TEDLEKKKQVYDALVTILKSEHKEPKMRDNLNETSKXXXXXXXXXXXXXXXXXXXXXXXX 126
            ++ EKKK+VYDAL+TILKSEH EPK      E S                         
Sbjct: 71  GDEDEKKKKVYDALLTILKSEHPEPKRMKTKAEESSDRTTQSDGNENAESEPVDDQLEIE 130

Query: 127 XXXSIKXXXXXXXXXXXXXXXXXXXXXXKSDPFDSHFNQPTEQFTNKFADAFKNKQIKYR 186
                                       + DPF+SHFNQ  E+  +  ++AFK+K I+Y+
Sbjct: 131 NGLLGDREDESEDDGSEDEKHDDVDSEDEQDPFESHFNQVPEKDVDDLSNAFKSKNIRYK 190

Query: 187 SIKYKINEYESSIYSEPRILEDEQTKVKSPVLKSSIHSYALKKRLKINNDLLDPAVNNLT 246
           S+K  +N  ES IY++P ++  E++ V+SP   SSI+SY LK+RLKI N L D  ++ L 
Sbjct: 191 SVKAPLNGDESYIYAQPVVV-GEESSVESPYKSSSIYSYFLKQRLKIQNGLQDKKIDPLN 249

Query: 247 TIQKELVDPMFQYKDILYEYGNYGKDEEEYRSLYCLHVLNHIYKTRDRILKNNSKVQDNP 306
            +Q++LVDPMFQYKDILYEY +Y KDE+EYR LY LHVLNHIYKTRDRILKNN ++QDNP
Sbjct: 250 ALQRKLVDPMFQYKDILYEYDSYEKDEDEYRDLYTLHVLNHIYKTRDRILKNNQRLQDNP 309

Query: 307 DAEFLDQGFTRPKVLIVAPTRDAGYSIVNEIIKKSGIDQIDKKSKFRDQFYEESLLPASK 366
           D E LDQGFTRPKVLIV PTRD  Y +V++II KSGIDQ+DKK KF DQF ++SL P SK
Sbjct: 310 DTEHLDQGFTRPKVLIVVPTRDVAYRVVDKIISKSGIDQVDKKGKFYDQFRDDSLPPKSK 369

Query: 367 PKSFQAVFKGNSNDYFVLGIKFTRKAIKLYSNFYQSDIIVCSPLGLHMILENTDKKKRQD 426
           P+SFQ +FKGN+ND+FV+G+KFTRKAIKLYSNFYQSDIIVCSPLG+ MILENTDKKKRQD
Sbjct: 370 PRSFQHIFKGNTNDFFVVGLKFTRKAIKLYSNFYQSDIIVCSPLGIQMILENTDKKKRQD 429

Query: 427 DFLSSIELMIIDQLHSMEFQNISHVTSIFEHINKIPKEQHDTDFSRIKMWYINDQAKLFR 486
           DFLSSIE+M+IDQLHS+E+QNISH+ +IF+H+NKIP +QH+ DFSRI+MWYIN+QAK FR
Sbjct: 430 DFLSSIEIMVIDQLHSIEYQNISHILTIFDHLNKIPDQQHEADFSRIRMWYINEQAKFFR 489

Query: 487 QTMIFTKYISPSANFFLNGKCQNWSGRWKNHKMITPNESSIGQLGLRVKQMFHRFDIIGG 546
           QTM+FTKYISP+ N  +NG+C+N +GRWKNH+ I P  SSIGQLGL+++Q+F RFD IG 
Sbjct: 490 QTMVFTKYISPTVNSLINGRCRNMAGRWKNHRTIGPETSSIGQLGLKIRQIFQRFDTIGN 549

Query: 547 SIVDEPDYRFKYFTSVIVQSITKSTSYEDGMLIYITDYTDYVRVRNYLKEKTTILFGDIN 606
           SIV+EPDYRFK+FTSV++ SI KST YEDG+LIYI DYTD++R+RNY+KEKTTILFGDIN
Sbjct: 550 SIVEEPDYRFKFFTSVMIPSIVKSTGYEDGILIYIPDYTDFIRIRNYMKEKTTILFGDIN 609

Query: 607 EYSDQKQVNSNRALFQQRRVKVLLYTERLHHFRRYEIKGVKNIVFYKAPTNPEFYNEVVR 666
           EYS Q+Q+N+NR+LFQQ R+KV+LYTERLHH+RRY+IKGVK+++FYK P NPEFY+E VR
Sbjct: 610 EYSSQRQLNANRSLFQQGRLKVMLYTERLHHYRRYDIKGVKSVIFYKPPNNPEFYSETVR 669

Query: 667 YIGKNAFTGNTDINISNVRTIYSKLDGLALERIMGTKRAAVLTHGQNETYEFK 719
           +IGKNAF+GNTD+NIS VR IYSKLDG++LERI+GTKRAAVL+H Q E YEFK
Sbjct: 670 FIGKNAFSGNTDLNISTVRCIYSKLDGISLERIVGTKRAAVLSHAQKEVYEFK 722

>KAFR0J01340 Chr10 (245485..247671) [2187 bp, 728 aa] {ON} Anc_2.292
           YIL091C
          Length = 728

 Score =  888 bits (2294), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/564 (73%), Positives = 489/564 (86%), Gaps = 1/564 (0%)

Query: 157 DPFDSHFNQPTEQFTNKFADAFKNKQIKYRSIKYKINEYESSIYSEPRILEDE-QTKVKS 215
           DPF++HFN   E+FT+K   +FKN  IKY+S K  I+E E +I+S+P I  DE ++ V+ 
Sbjct: 165 DPFETHFNSVDEKFTDKLDVSFKNNDIKYKSTKLPISEDEYAIFSKPVIKSDEIESPVEL 224

Query: 216 PVLKSSIHSYALKKRLKINNDLLDPAVNNLTTIQKELVDPMFQYKDILYEYGNYGKDEEE 275
            V KSSIHSY LK+RLK+ N+L+DP V+ LT +QK+LVDPMFQYKDILY+Y +YGKDE+E
Sbjct: 225 SVNKSSIHSYFLKQRLKMQNNLMDPKVDPLTPLQKQLVDPMFQYKDILYQYDSYGKDEDE 284

Query: 276 YRSLYCLHVLNHIYKTRDRILKNNSKVQDNPDAEFLDQGFTRPKVLIVAPTRDAGYSIVN 335
           YR LY LHVLNH+YKTRD+ILKNN ++QDN D E LDQGFTRPKVLIV PTRD  Y ++ 
Sbjct: 285 YRDLYSLHVLNHLYKTRDKILKNNQRLQDNNDTECLDQGFTRPKVLIVVPTRDTAYQVIE 344

Query: 336 EIIKKSGIDQIDKKSKFRDQFYEESLLPASKPKSFQAVFKGNSNDYFVLGIKFTRKAIKL 395
           +II KSGIDQ+DKK KF+DQF+E+SL P+SKPKSFQ +FKGN+ND+FVLG+KFTRKAIKL
Sbjct: 345 KIIAKSGIDQVDKKGKFKDQFFEDSLPPSSKPKSFQDIFKGNTNDFFVLGVKFTRKAIKL 404

Query: 396 YSNFYQSDIIVCSPLGLHMILENTDKKKRQDDFLSSIELMIIDQLHSMEFQNISHVTSIF 455
           YSNFYQSDII+CSPLG+ MILENTDKKKRQDDFLSSIELMIIDQLHS+E+QNISH+ +I 
Sbjct: 405 YSNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIELMIIDQLHSIEYQNISHLFTIC 464

Query: 456 EHINKIPKEQHDTDFSRIKMWYINDQAKLFRQTMIFTKYISPSANFFLNGKCQNWSGRWK 515
            HINKIP+EQHD DFSR++MWYINDQAKLFRQTM+FTKYISP AN  LNGKCQNWSGRWK
Sbjct: 465 NHINKIPQEQHDADFSRVRMWYINDQAKLFRQTMLFTKYISPMANSLLNGKCQNWSGRWK 524

Query: 516 NHKMITPNESSIGQLGLRVKQMFHRFDIIGGSIVDEPDYRFKYFTSVIVQSITKSTSYED 575
           NHK+I+ N SSI ++G++++Q+F RF+ + GS+VDEPDYRFK+FTSV V +I K+T YED
Sbjct: 525 NHKVISTNSSSISKVGIKIRQIFQRFETVNGSVVDEPDYRFKFFTSVTVPNIVKTTGYED 584

Query: 576 GMLIYITDYTDYVRVRNYLKEKTTILFGDINEYSDQKQVNSNRALFQQRRVKVLLYTERL 635
           G LIYI +YTDY+RVRNYLK+KTTILFGDINEYSDQKQ+NSNR+LFQQ RVKVLLYTERL
Sbjct: 585 GTLIYIPEYTDYIRVRNYLKDKTTILFGDINEYSDQKQLNSNRSLFQQGRVKVLLYTERL 644

Query: 636 HHFRRYEIKGVKNIVFYKAPTNPEFYNEVVRYIGKNAFTGNTDINISNVRTIYSKLDGLA 695
           HH+RRYEIKGVKN+VFY+ P NPEFY EVVRYIGKNAF GNTD+NIS VR +YSKLD L+
Sbjct: 645 HHYRRYEIKGVKNVVFYQPPKNPEFYTEVVRYIGKNAFLGNTDLNISTVRCLYSKLDALS 704

Query: 696 LERIMGTKRAAVLTHGQNETYEFK 719
           LE I+G+KRA VL H QNE YEFK
Sbjct: 705 LENIVGSKRAGVLCHAQNEVYEFK 728

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 50/87 (57%), Gaps = 12/87 (13%)

Query: 12 EGYGKRGRSQKRSIKKSSGAKRFK----------TEDTRIVKETIEDESSDEDVSNTSID 61
          +G  KRGR + R+I+++ G K             +E+T  V+E     ++ +DV +   D
Sbjct: 12 DGVRKRGRKELRNIRRAGGRKPRDAQENGNGISVSENTGEVEEEPSSAANGDDVGDEVGD 71

Query: 62 KEAEVTEDLEKKKQVYDALVTILKSEH 88
          + ++  E++  KKQVY AL+TILKSEH
Sbjct: 72 EASDDEEEM--KKQVYGALLTILKSEH 96

>KNAG0A05400 Chr1 (795728..797893) [2166 bp, 721 aa] {ON} Anc_2.292
           YIL091C
          Length = 721

 Score =  879 bits (2272), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/718 (61%), Positives = 533/718 (74%), Gaps = 15/718 (2%)

Query: 15  GKRGRSQKRSIKKSSGAKRFKTEDTRIVKETIEDE---SSDE--DVSNTSIDKEAEVTED 69
           GKRGR + R +K+++  KR   +D       +ED+    +D+  +VS+++ D +   ++ 
Sbjct: 6   GKRGRKELRHLKRTT--KRPAIDDPPRESAPVEDDFVGPADQMVNVSDSAEDGDGSDSDA 63

Query: 70  LEKKKQVYDALVTILKSEHKEPKMRDNLNETSKXXXXXXXXXXXXXXXXXXXXXXXXXXX 129
             +K +VY AL+TILKSEH E K R     +                             
Sbjct: 64  EARKGKVYGALLTILKSEHPEAKKRKTKKSSDGGEVDKILVHDDNHEELEEENEEEQIDN 123

Query: 130 SI-KXXXXXXXXXXXXXXXXXXXXXXKSDPFDSHFNQPTEQFTNKFADAFKNKQIKYRSI 188
           +I                        + DPF+SHFNQ  E   N    AFK+KQ++YRS+
Sbjct: 124 AILDNRTQSDSEDEQDVAAEEFDSEDEQDPFESHFNQFPETEINTLDAAFKSKQLQYRSV 183

Query: 189 KYKINEY-----ESSIYSEPRILEDEQT--KVKSPVLKSSIHSYALKKRLKINNDLLDPA 241
           K +  +      E  IYSEP +   +Q   K+     K SI SY LKKRLKI NDLL+  
Sbjct: 184 KLQPAKVTKVKDEYLIYSEPTVPGGKQLSKKLIESNTKCSIGSYFLKKRLKIQNDLLENK 243

Query: 242 VNNLTTIQKELVDPMFQYKDILYEYGNYGKDEEEYRSLYCLHVLNHIYKTRDRILKNNSK 301
            +NL +IQKELVDPMFQYKDILYEY NYGK E+EYR LY LH LNH+YKTRDRILKNN +
Sbjct: 244 PDNLASIQKELVDPMFQYKDILYEYENYGKSEDEYRQLYALHALNHVYKTRDRILKNNQR 303

Query: 302 VQDNPDAEFLDQGFTRPKVLIVAPTRDAGYSIVNEIIKKSGIDQIDKKSKFRDQFYEESL 361
           +Q+N D E LDQGFTRPKVLI+APTRD  YSIV  II KSGIDQ+DK+ KF+DQFYE+SL
Sbjct: 304 LQENSDTECLDQGFTRPKVLIIAPTRDTAYSIVTTIINKSGIDQVDKRGKFKDQFYEDSL 363

Query: 362 LPASKPKSFQAVFKGNSNDYFVLGIKFTRKAIKLYSNFYQSDIIVCSPLGLHMILENTDK 421
            P+SKPKSFQ++FKGN+ND+FVLG+KFTRKAIKLYSNFYQSDIIVCSPLGL MI+ENTDK
Sbjct: 364 PPSSKPKSFQSIFKGNTNDFFVLGMKFTRKAIKLYSNFYQSDIIVCSPLGLQMIVENTDK 423

Query: 422 KKRQDDFLSSIELMIIDQLHSMEFQNISHVTSIFEHINKIPKEQHDTDFSRIKMWYINDQ 481
           KKRQDDFLSSIE+ IIDQLHS+E+QNISH+ +IFEH+N IP EQHD DFSRI+MWYINDQ
Sbjct: 424 KKRQDDFLSSIEITIIDQLHSIEYQNISHLYTIFEHLNNIPDEQHDADFSRIRMWYINDQ 483

Query: 482 AKLFRQTMIFTKYISPSANFFLNGKCQNWSGRWKNHKMITPNESSIGQLGLRVKQMFHRF 541
           A+ FRQTM+FTKYISP+AN  +NGKC+NWSGRWKNH++++   S IG+L LRV+Q+F RF
Sbjct: 484 ARFFRQTMVFTKYISPTANSIINGKCRNWSGRWKNHRIVSNEASHIGKLSLRVRQIFQRF 543

Query: 542 DIIGGSIVDEPDYRFKYFTSVIVQSITKSTSYEDGMLIYITDYTDYVRVRNYLKEKTTIL 601
           ++ GGSIVDEPDYRFK+FTSVI+  I KST YEDG+LIYI +YTDYVRVRNYLKEKT IL
Sbjct: 544 EVTGGSIVDEPDYRFKFFTSVIIPGILKSTGYEDGILIYIPEYTDYVRVRNYLKEKTRIL 603

Query: 602 FGDINEYSDQKQVNSNRALFQQRRVKVLLYTERLHHFRRYEIKGVKNIVFYKAPTNPEFY 661
           FGDINEYS QKQ+ +NR+LFQQ R+KVLLYTERLHH+RRYEIKGVK+++FYK P++PEFY
Sbjct: 604 FGDINEYSSQKQLTANRSLFQQGRLKVLLYTERLHHYRRYEIKGVKSVIFYKPPSDPEFY 663

Query: 662 NEVVRYIGKNAFTGNTDINISNVRTIYSKLDGLALERIMGTKRAAVLTHGQNETYEFK 719
            EVVR IG+NAF GNTD+NIS VR IYSKLD LALE ++GT+RA VL HGQNE YEFK
Sbjct: 664 TEVVRNIGRNAFLGNTDLNISTVRCIYSKLDALALENVVGTQRAGVLCHGQNEIYEFK 721

>NCAS0B06230 Chr2 (1175844..1178015) [2172 bp, 723 aa] {ON}
           Anc_2.292 YIL091C
          Length = 723

 Score =  869 bits (2245), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/727 (58%), Positives = 544/727 (74%), Gaps = 12/727 (1%)

Query: 1   MSGFKPQNNYSEGYGKRGRSQKRSIKKSSGAKRFKTEDTRIVKETIEDESSDEDVSNTSI 60
           MS    + +   G  KRGR + R+I++S+GAK    E   +   +I D+  +++++ ++ 
Sbjct: 1   MSKRSHEGSQHAGSKKRGRQELRTIRRSAGAKVSSQE---VFNSSIVDDE-EQELNESNE 56

Query: 61  DKEAEVTEDLEKKKQVYDALVTILKSEHKE------PKMRDNLNETSKXXXXXXXXXXXX 114
            ++ E  ++ EKK +VY AL+TILKSEH E       ++ D+ +   K            
Sbjct: 57  SEQEEDIDEEEKKNKVYGALLTILKSEHPELKKKKKKRVDDSKSGEDKGSELASDDGKDD 116

Query: 115 XXXXXXXXXXXXXXXSIKXXXXXXXXXXXXXXXXXXXXXXKSDPFDSHFNQPTEQFTNKF 174
                          S                        + DPF+SHFNQ +E+  +  
Sbjct: 117 EIDEAQQIEDGLARGSDGQPSDDEEDNDAHSNVEDIDSEDEQDPFESHFNQVSEKTADDL 176

Query: 175 ADAFKNKQIKYRSIKYKINEYESSIYSEPRILEDEQTKVK--SPVLKSSIHSYALKKRLK 232
             AF    +KY+S K  I + ++ I S P I+  E T+ +  S    SSIHSY LK+RL+
Sbjct: 177 NTAFNTGSVKYKSTKSVIGDNKTVISSIPTIIGKENTEEEKDSAPKSSSIHSYFLKQRLR 236

Query: 233 INNDLLDPAVNNLTTIQKELVDPMFQYKDILYEYGNYGKDEEEYRSLYCLHVLNHIYKTR 292
           + ND+LD   + L  +QKELVDPMFQY+DIL EY +Y KDE+EYR LY LH LNH+YKTR
Sbjct: 237 VANDMLDSKKDPLGPLQKELVDPMFQYRDILCEYSSYEKDEDEYRDLYALHALNHVYKTR 296

Query: 293 DRILKNNSKVQDNPDAEFLDQGFTRPKVLIVAPTRDAGYSIVNEIIKKSGIDQIDKKSKF 352
           DRILK+N ++QDN D E+ DQGFTRPKVLIV PTRD  Y ++++II KSG+DQ+DKK KF
Sbjct: 297 DRILKDNGRLQDNSDTEYFDQGFTRPKVLIVVPTRDTAYEVISKIISKSGLDQVDKKGKF 356

Query: 353 RDQFYEESLLPASKPKSFQAVFKGNSNDYFVLGIKFTRKAIKLYSNFYQSDIIVCSPLGL 412
            DQF++E+L P+SKPKSFQ +FKGN+ND+FVLG+KFTRKAIKLYSNFYQSDIIVCSPLG+
Sbjct: 357 NDQFHDETLPPSSKPKSFQHIFKGNTNDFFVLGVKFTRKAIKLYSNFYQSDIIVCSPLGM 416

Query: 413 HMILENTDKKKRQDDFLSSIELMIIDQLHSMEFQNISHVTSIFEHINKIPKEQHDTDFSR 472
            MI+ENTDKK RQDDFLSSIE++IIDQLHS+E+QN++HV +IF+H+NKIP++QH+ DFSR
Sbjct: 417 QMIVENTDKKNRQDDFLSSIEVLIIDQLHSIEYQNLAHVFTIFDHLNKIPEQQHEADFSR 476

Query: 473 IKMWYINDQAKLFRQTMIFTKYISPSANFFLNGKCQNWSGRWKNHKMITPNESSIGQLGL 532
           I+MWYINDQA+LFRQTMIFTKY++P+AN  +N +C+NW+GRWKNH++I P  S+I QLGL
Sbjct: 477 IRMWYINDQARLFRQTMIFTKYVTPAANALINNRCRNWAGRWKNHEIIEPEASAISQLGL 536

Query: 533 RVKQMFHRFDIIGGSIVDEPDYRFKYFTSVIVQSITKSTSYEDGMLIYITDYTDYVRVRN 592
           +VKQ F RFD++GGS++DEPDYRFK+F+SVI+ SI KSTSY DG+LIYI DYTDYVR+RN
Sbjct: 537 KVKQTFQRFDMMGGSVIDEPDYRFKHFSSVIIPSIVKSTSYSDGILIYIPDYTDYVRIRN 596

Query: 593 YLKEKTTILFGDINEYSDQKQVNSNRALFQQRRVKVLLYTERLHHFRRYEIKGVKNIVFY 652
           YLKEKTT+LFGDINEYS+Q+++NSNR+LFQQ RVKVLLYTERLHH+RRYE+KGVK++VFY
Sbjct: 597 YLKEKTTLLFGDINEYSEQRELNSNRSLFQQGRVKVLLYTERLHHYRRYELKGVKSVVFY 656

Query: 653 KAPTNPEFYNEVVRYIGKNAFTGNTDINISNVRTIYSKLDGLALERIMGTKRAAVLTHGQ 712
           K PTNPEFYNEVVRYIGK+AF GN D+NIS VRT+Y KLDGL+LERI+G+KRA +L H Q
Sbjct: 657 KPPTNPEFYNEVVRYIGKSAFLGNADLNISTVRTLYCKLDGLSLERIVGSKRAGILCHAQ 716

Query: 713 NETYEFK 719
           NE YEF+
Sbjct: 717 NEVYEFQ 723

>TDEL0G02220 Chr7 complement(434650..436782) [2133 bp, 710 aa] {ON}
           Anc_2.292 YIL091C
          Length = 710

 Score =  860 bits (2223), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/563 (70%), Positives = 477/563 (84%), Gaps = 3/563 (0%)

Query: 157 DPFDSHFNQPTEQFTNKFADAFKNKQIKYRSIKYKINEYESSIYSEPRILEDEQTKVKSP 216
           D FDSHFNQ  E   +K   AFK +Q+KY+S K  I E ES +YS+P +LED+  K++ P
Sbjct: 151 DTFDSHFNQVPENVVDKLDAAFKERQLKYKSAKVPIGENESMVYSKPLLLEDQSKKLEIP 210

Query: 217 VLKSSIHSYALKKRLKINNDLLDPAVNNLTTIQKELVDPMFQYKDILYEYGNYGKDEEEY 276
               S+ SY  K+RLKI NDL      NLT+ Q+ LVDPM QY D+LYEY +Y KDE+EY
Sbjct: 211 SRHESLKSYVFKQRLKIQNDL---EHENLTSTQRTLVDPMLQYNDLLYEYNSYEKDEDEY 267

Query: 277 RSLYCLHVLNHIYKTRDRILKNNSKVQDNPDAEFLDQGFTRPKVLIVAPTRDAGYSIVNE 336
           R LY LHVLNH+YKTRD+ILKNN ++ DNPDA++LDQGFTRPKVLIV PTRD  Y ++ +
Sbjct: 268 RDLYALHVLNHVYKTRDKILKNNQRISDNPDADYLDQGFTRPKVLIVVPTRDTAYQVLEK 327

Query: 337 IIKKSGIDQIDKKSKFRDQFYEESLLPASKPKSFQAVFKGNSNDYFVLGIKFTRKAIKLY 396
           II KSGIDQIDKK KFRDQF+EESL P+SKPKSFQ VFKGN+ND+FVLG+KFTRKAIKLY
Sbjct: 328 IIDKSGIDQIDKKGKFRDQFFEESLPPSSKPKSFQHVFKGNTNDFFVLGVKFTRKAIKLY 387

Query: 397 SNFYQSDIIVCSPLGLHMILENTDKKKRQDDFLSSIELMIIDQLHSMEFQNISHVTSIFE 456
           SNFYQSDII+CSPLG+ +ILENTDKKKRQDDFLSSIE+ I DQLHS+E+QN+SHV +IF+
Sbjct: 388 SNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIEISIFDQLHSIEYQNVSHVMTIFD 447

Query: 457 HINKIPKEQHDTDFSRIKMWYINDQAKLFRQTMIFTKYISPSANFFLNGKCQNWSGRWKN 516
           H+N IP+EQHDTDF R+++WYIN+QAKLFRQTMIFTKY+SP+AN  +N KCQN +GRWKN
Sbjct: 448 HLNLIPQEQHDTDFGRVRLWYINEQAKLFRQTMIFTKYVSPTANALINNKCQNMTGRWKN 507

Query: 517 HKMITPNESSIGQLGLRVKQMFHRFDIIGGSIVDEPDYRFKYFTSVIVQSITKSTSYEDG 576
           H  I PN+SSIG+LGL+V+Q+F R D+   SI++E D+RFK+FTSVI+ SI KST YEDG
Sbjct: 508 HHFIEPNQSSIGKLGLKVRQIFQRIDLGAASILEESDFRFKFFTSVIIPSIIKSTGYEDG 567

Query: 577 MLIYITDYTDYVRVRNYLKEKTTILFGDINEYSDQKQVNSNRALFQQRRVKVLLYTERLH 636
           +L+YI DY D++RVRNY+KEKTTI+FGDINEYS+QKQ+NSNRALFQQ R KVLLYTERLH
Sbjct: 568 ILVYIPDYADFIRVRNYMKEKTTIIFGDINEYSNQKQLNSNRALFQQGRAKVLLYTERLH 627

Query: 637 HFRRYEIKGVKNIVFYKAPTNPEFYNEVVRYIGKNAFTGNTDINISNVRTIYSKLDGLAL 696
           HFRRYEIKGVK++VFY+ PTNPEFY+EVVR+I K+A  G TD+NIS VRTIYSKLDG++L
Sbjct: 628 HFRRYEIKGVKSVVFYQPPTNPEFYSEVVRFIAKSAALGTTDLNISTVRTIYSKLDGISL 687

Query: 697 ERIMGTKRAAVLTHGQNETYEFK 719
           ERI+GTKRAA+LTHGQNE YEFK
Sbjct: 688 ERIVGTKRAAILTHGQNEVYEFK 710

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 49/91 (53%), Gaps = 3/91 (3%)

Query: 13  GYGKRGRSQKRSIKKSSGAKRFKTEDTRIVKETIEDESSDEDVSNTSIDKEAEVTEDLE- 71
           G  KRGR + RSI++    K    E+   + E+ E E  +        ++ A V ED E 
Sbjct: 15  GTLKRGRKELRSIRRPQRNK--AHEEPEHLNESSEGEVKNHHNGMQHNEEIANVEEDEEN 72

Query: 72  KKKQVYDALVTILKSEHKEPKMRDNLNETSK 102
           K+++VY AL+TIL SEH +PK +  +   S+
Sbjct: 73  KRRKVYGALLTILNSEHPKPKPKQEVTVQSR 103

>SAKL0E07546g Chr5 (610979..613135) [2157 bp, 718 aa] {ON} similar
           to uniprot|P40498 Saccharomyces cerevisiae YIL091C
           Protein required for cell viability
          Length = 718

 Score =  857 bits (2213), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/565 (69%), Positives = 481/565 (85%), Gaps = 1/565 (0%)

Query: 155 KSDPFDSHFNQPTEQFTNKFADAFKNKQIKYRSIKYKINEYESSIYSEPRILEDEQTKVK 214
           K+D F+ HFN  +E    K A AF++K+I+Y+S+K  +NE E  IYS P +  ++ + V 
Sbjct: 155 KADSFELHFNNVSELQATKLASAFRDKKIRYKSVKVPVNEDEFFIYSRPTVEGEDGSSVV 214

Query: 215 SPVLKSSIHSYALKKRLKINNDLLDPAVNNLTTIQKELVDPMFQYKDILYEYGNYGKDEE 274
           +P  K S+HSY +K++LKI N+LLD     L  +QK LVDPMFQY+D+LYEY +Y + EE
Sbjct: 215 APSCKKSLHSYFIKQKLKIQNNLLDDKKEALAPLQKNLVDPMFQYQDLLYEYRSY-EQEE 273

Query: 275 EYRSLYCLHVLNHIYKTRDRILKNNSKVQDNPDAEFLDQGFTRPKVLIVAPTRDAGYSIV 334
           EYR LY LHVLNH+YKTRDRIL+N+ K+QDN D E LDQGFTRPKVLIV PTRD  Y IV
Sbjct: 274 EYRDLYALHVLNHVYKTRDRILRNSQKLQDNSDQELLDQGFTRPKVLIVVPTRDVAYQIV 333

Query: 335 NEIIKKSGIDQIDKKSKFRDQFYEESLLPASKPKSFQAVFKGNSNDYFVLGIKFTRKAIK 394
            +II+KSG+DQ+DK+ KF+DQF++ SL P+SKPKSF+ +FKGN+ND+FVLG KFTRK +K
Sbjct: 334 TKIIEKSGLDQVDKRGKFQDQFFDASLPPSSKPKSFKHIFKGNTNDFFVLGAKFTRKTLK 393

Query: 395 LYSNFYQSDIIVCSPLGLHMILENTDKKKRQDDFLSSIELMIIDQLHSMEFQNISHVTSI 454
           LYSNFYQSD+I CSPLG+ +ILENTDKKKRQDDFLSSIELM+IDQLHS+E+QN+SH+T+I
Sbjct: 394 LYSNFYQSDVIFCSPLGIQLILENTDKKKRQDDFLSSIELMVIDQLHSIEYQNLSHITTI 453

Query: 455 FEHINKIPKEQHDTDFSRIKMWYINDQAKLFRQTMIFTKYISPSANFFLNGKCQNWSGRW 514
           F+HINKIP++QHD DFSRI+MWYIN+QA LFRQTM+FTKY SP AN  +NGKC+N +GRW
Sbjct: 454 FQHINKIPQQQHDADFSRIRMWYINEQATLFRQTMVFTKYASPFANSLINGKCRNHAGRW 513

Query: 515 KNHKMITPNESSIGQLGLRVKQMFHRFDIIGGSIVDEPDYRFKYFTSVIVQSITKSTSYE 574
           KNH ++ P +SSI QLGL+V+Q+F RFD++GGS +DEPDYRFK+FTSVI+ SI KST YE
Sbjct: 514 KNHNIVLPEKSSINQLGLKVRQIFQRFDLVGGSAMDEPDYRFKFFTSVIIASIIKSTGYE 573

Query: 575 DGMLIYITDYTDYVRVRNYLKEKTTILFGDINEYSDQKQVNSNRALFQQRRVKVLLYTER 634
           DG+L+YI DYTDYVRVRN+L+EKTT+LFGDINEYS+QKQ+ SNRALFQQ +VKVLLYTER
Sbjct: 574 DGILLYIPDYTDYVRVRNHLREKTTLLFGDINEYSEQKQLTSNRALFQQGKVKVLLYTER 633

Query: 635 LHHFRRYEIKGVKNIVFYKAPTNPEFYNEVVRYIGKNAFTGNTDINISNVRTIYSKLDGL 694
           LHHFRRYEIKGVK+++FYK PTNPEFY EVVRYIGK+AF G+ D+NIS VR +Y KLDGL
Sbjct: 634 LHHFRRYEIKGVKSVIFYKPPTNPEFYREVVRYIGKSAFLGSADLNISTVRCVYCKLDGL 693

Query: 695 ALERIMGTKRAAVLTHGQNETYEFK 719
           +LER++GTKRAAVLTHGQNE YEFK
Sbjct: 694 SLERVVGTKRAAVLTHGQNEIYEFK 718

>Kpol_1039.46 s1039 complement(138925..141039) [2115 bp, 704 aa]
           {ON} complement(138925..141039) [2115 nt, 705 aa]
          Length = 704

 Score =  849 bits (2194), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/563 (67%), Positives = 485/563 (86%)

Query: 157 DPFDSHFNQPTEQFTNKFADAFKNKQIKYRSIKYKINEYESSIYSEPRILEDEQTKVKSP 216
           D F+SHFN  ++   +  +  FK+KQIKY+S+KY +++ ES+I+ +P +L  +   + +P
Sbjct: 142 DTFESHFNDVSQDLVDDISAGFKDKQIKYKSMKYSLDKKESAIFGKPLLLTQQDETIDNP 201

Query: 217 VLKSSIHSYALKKRLKINNDLLDPAVNNLTTIQKELVDPMFQYKDILYEYGNYGKDEEEY 276
           VL SS  SY +K+RLKI NDLLD +  NLT ++K+L+DPMFQYKD+L EY NY  DE+EY
Sbjct: 202 VLTSSYDSYFIKQRLKIQNDLLDSSKENLTPLKKKLLDPMFQYKDVLCEYTNYENDEKEY 261

Query: 277 RSLYCLHVLNHIYKTRDRILKNNSKVQDNPDAEFLDQGFTRPKVLIVAPTRDAGYSIVNE 336
           R LY LHVLNHIYKTRD+ILK+N ++Q+N D E LDQGFTRPKVLIV PTRD  Y +V  
Sbjct: 262 RELYSLHVLNHIYKTRDKILKDNQRLQENDDLECLDQGFTRPKVLIVVPTRDTAYQVVET 321

Query: 337 IIKKSGIDQIDKKSKFRDQFYEESLLPASKPKSFQAVFKGNSNDYFVLGIKFTRKAIKLY 396
           II+KSG+DQIDKK KF+DQF+++SL P SKPKSF+ VFKGN+ND+FVLG+KFTRKAIKLY
Sbjct: 322 IIEKSGLDQIDKKGKFKDQFFDDSLPPTSKPKSFRHVFKGNTNDFFVLGMKFTRKAIKLY 381

Query: 397 SNFYQSDIIVCSPLGLHMILENTDKKKRQDDFLSSIELMIIDQLHSMEFQNISHVTSIFE 456
           SNFYQSDII+CSPLG+ MILENTDKKKRQDDFLSSIE+MI+DQLHS+E+QNISHV +I E
Sbjct: 382 SNFYQSDIIICSPLGIQMILENTDKKKRQDDFLSSIEVMIVDQLHSIEYQNISHVYTILE 441

Query: 457 HINKIPKEQHDTDFSRIKMWYINDQAKLFRQTMIFTKYISPSANFFLNGKCQNWSGRWKN 516
           HINKIP++Q + DFSRI+MWYINDQAK  RQTM+FT+YISP+AN  +NGKC N +GRWKN
Sbjct: 442 HINKIPQQQREADFSRIRMWYINDQAKFLRQTMLFTRYISPTANAIINGKCHNMAGRWKN 501

Query: 517 HKMITPNESSIGQLGLRVKQMFHRFDIIGGSIVDEPDYRFKYFTSVIVQSITKSTSYEDG 576
           +++I+  +SSIGQLG+++KQ+F RFD++GG++VDE DYRFKYFTSV++Q+I KST YEDG
Sbjct: 502 NQIISSEDSSIGQLGIKIKQIFQRFDLVGGTVVDESDYRFKYFTSVVMQNIVKSTGYEDG 561

Query: 577 MLIYITDYTDYVRVRNYLKEKTTILFGDINEYSDQKQVNSNRALFQQRRVKVLLYTERLH 636
           +L+YI +YTDY+R+RNY+KEKTTILF +INEYS QKQ++SNR++FQQ R KVLLYTERLH
Sbjct: 562 ILVYIPEYTDYMRLRNYMKEKTTILFSEINEYSTQKQLDSNRSMFQQGRTKVLLYTERLH 621

Query: 637 HFRRYEIKGVKNIVFYKAPTNPEFYNEVVRYIGKNAFTGNTDINISNVRTIYSKLDGLAL 696
           H+RRYE+KG+K+++FYK PTNPEFYNEV+R+  KNAF G +DINIS +RT+YSKLDGLAL
Sbjct: 622 HYRRYELKGIKSVIFYKPPTNPEFYNEVIRFTAKNAFLGKSDINISTIRTVYSKLDGLAL 681

Query: 697 ERIMGTKRAAVLTHGQNETYEFK 719
           +RI+G+KRAA+L HGQNE+Y+FK
Sbjct: 682 QRIVGSKRAAILCHGQNESYDFK 704

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 52/82 (63%), Gaps = 2/82 (2%)

Query: 11 SEGYGKRGRSQKRSIKKSSGAKRFKTEDTRIVKETIEDESSDEDVSNTSIDKEAEVTEDL 70
          SEG  KRGR++ RSI++ + ++  K  D ++V E+  ++S +    +     +AE  E+ 
Sbjct: 8  SEGPKKRGRTELRSIRRPNRSQHSK-HDQQVVHESENEDSLESSSDDDEDIAQAEA-ENS 65

Query: 71 EKKKQVYDALVTILKSEHKEPK 92
          ++K++VY AL+TIL SEH E K
Sbjct: 66 DRKEKVYGALLTILNSEHPERK 87

>CAGL0D04180g Chr4 complement(411498..413600) [2103 bp, 700 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091c
          Length = 700

 Score =  847 bits (2188), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/570 (68%), Positives = 477/570 (83%), Gaps = 8/570 (1%)

Query: 157 DPFDSHFN-QPTEQFTNKFADAFKNKQIKYRSIKYKINEY------ESSIYSEPRILEDE 209
           DPFD+HFN +   +      +A K+ +++Y+SIK K+         E +I+S P I E E
Sbjct: 132 DPFDTHFNGEEAAKHGEALGNALKDNKLRYKSIKLKVGSADEDQVQEDAIFSVPYI-EGE 190

Query: 210 QTKVKSPVLKSSIHSYALKKRLKINNDLLDPAVNNLTTIQKELVDPMFQYKDILYEYGNY 269
             K++ P LK S+ SY LKKRL+I N+LLD   N LT +Q+++VDPM QYKDILYEY  Y
Sbjct: 191 TPKIEDPKLKCSLSSYFLKKRLRIQNNLLDTESNALTDLQRKIVDPMMQYKDILYEYDTY 250

Query: 270 GKDEEEYRSLYCLHVLNHIYKTRDRILKNNSKVQDNPDAEFLDQGFTRPKVLIVAPTRDA 329
           GKDE+EYR LY LHVLNH+YKTRD+I+KNN K+QDNPD+EFLDQGFTRPKVLI+APTRD+
Sbjct: 251 GKDEDEYRDLYTLHVLNHVYKTRDKIIKNNQKLQDNPDSEFLDQGFTRPKVLIIAPTRDS 310

Query: 330 GYSIVNEIIKKSGIDQIDKKSKFRDQFYEESLLPASKPKSFQAVFKGNSNDYFVLGIKFT 389
            Y IV ++I+KSG+DQ+DKK KFRDQFY+ S  P+SKPKSFQ +FKGN+NDYFVLG+KFT
Sbjct: 311 AYQIVTKLIEKSGLDQVDKKGKFRDQFYDPSFPPSSKPKSFQHIFKGNTNDYFVLGVKFT 370

Query: 390 RKAIKLYSNFYQSDIIVCSPLGLHMILENTDKKKRQDDFLSSIELMIIDQLHSMEFQNIS 449
           RKAIKLYSNFYQSDIIVCSPLGL MI+ENTDKKKRQDDFLSS+E+ IIDQ HS+E+QN +
Sbjct: 371 RKAIKLYSNFYQSDIIVCSPLGLQMIVENTDKKKRQDDFLSSVEVTIIDQFHSIEYQNYT 430

Query: 450 HVTSIFEHINKIPKEQHDTDFSRIKMWYINDQAKLFRQTMIFTKYISPSANFFLNGKCQN 509
           H+ +IF+H+NKIP+EQHD DFSRI+MWYINDQAK FRQTMIFTKYISP AN  LN KC+N
Sbjct: 431 HLFTIFDHLNKIPQEQHDADFSRIRMWYINDQAKFFRQTMIFTKYISPVANSLLNIKCRN 490

Query: 510 WSGRWKNHKMITPNESSIGQLGLRVKQMFHRFDIIGGSIVDEPDYRFKYFTSVIVQSITK 569
             GRWKNHK+++  +SS+G +GL+V+Q+F RF+++G S+ DEPDYRFK+FTSV++ +ITK
Sbjct: 491 LEGRWKNHKIVSSEDSSVGTVGLKVRQIFQRFNVLGNSVADEPDYRFKFFTSVVISNITK 550

Query: 570 STSYEDGMLIYITDYTDYVRVRNYLKEKTTILFGDINEYSDQKQVNSNRALFQQRRVKVL 629
           ST Y+DG LIYI +Y+DYVRVRNY+KEKT+ILFGDINEYS+Q+ + SNR LF Q R+KVL
Sbjct: 551 STGYDDGTLIYIPEYSDYVRVRNYMKEKTSILFGDINEYSEQRSLTSNRTLFNQGRLKVL 610

Query: 630 LYTERLHHFRRYEIKGVKNIVFYKAPTNPEFYNEVVRYIGKNAFTGNTDINISNVRTIYS 689
           LYTERLHHFRRYE+KGVKN+VFYK P++PEFY EVVRYIGK  F G+ D+NIS VR  YS
Sbjct: 611 LYTERLHHFRRYELKGVKNVVFYKPPSDPEFYKEVVRYIGKTVFLGDADLNISTVRCCYS 670

Query: 690 KLDGLALERIMGTKRAAVLTHGQNETYEFK 719
           KLDGLALE+I+GTKR  VLTHGQNETYEFK
Sbjct: 671 KLDGLALEKIVGTKRTGVLTHGQNETYEFK 700

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/82 (43%), Positives = 47/82 (57%), Gaps = 11/82 (13%)

Query: 16 KRGRSQKRSIKKSSGAKRFKTEDTRIVKETIEDESSDEDVSNTSIDKEAEVTEDLEK--- 72
          KRGR + RSI++   AKR     T+I  E      S   V       E +V +D EK   
Sbjct: 3  KRGRKELRSIRR---AKR-----TKIEPEADAGVESSGSVLEAGPAVEEKVQDDGEKEDD 54

Query: 73 KKQVYDALVTILKSEHKEPKMR 94
          K+QVY+AL+TILKSEHKE K++
Sbjct: 55 KEQVYNALLTILKSEHKEDKVK 76

>TPHA0D01520 Chr4 (310797..312947) [2151 bp, 716 aa] {ON} Anc_2.292
           YIL091C
          Length = 716

 Score =  844 bits (2180), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/563 (68%), Positives = 486/563 (86%), Gaps = 3/563 (0%)

Query: 159 FDSHFNQPTEQFTNKFADAFKNKQIKYRSIKYKINEYESS--IYSEPRILEDEQTKVKSP 216
           FD HFNQ  E   +K ++ F NK+IKY S K ++  +E    IYS+P + +  + KV+SP
Sbjct: 155 FDIHFNQVPENVVDKISNGFDNKKIKYVSKKIQLPHHEKDFFIYSKPIVDDGNKHKVESP 214

Query: 217 VLKSSIHSYALKKRLKINNDLLDPAVNNLTTIQKELVDPMFQYKDILYEYGNYGKDEEEY 276
           + KSS+ SY +KKRL+I N+LLD   +NLT +QK LVDPMFQY DIL+EY NYG DE+EY
Sbjct: 215 IKKSSLDSYFIKKRLEITNNLLD-GKDNLTKLQKSLVDPMFQYVDILHEYENYGSDEQEY 273

Query: 277 RSLYCLHVLNHIYKTRDRILKNNSKVQDNPDAEFLDQGFTRPKVLIVAPTRDAGYSIVNE 336
           R LY LH+LNH+YKTRD++LK+N ++Q+N ++EFLDQGFTRPKVLIV PTRD  Y++V  
Sbjct: 274 RELYTLHILNHLYKTRDKVLKDNQRLQENNESEFLDQGFTRPKVLIVVPTRDTAYNVVET 333

Query: 337 IIKKSGIDQIDKKSKFRDQFYEESLLPASKPKSFQAVFKGNSNDYFVLGIKFTRKAIKLY 396
           II+KSG+DQ++KK KF+ QF+E+SL P+SKPKSFQ++FKGN+ND+FVLG+KFTRKA+KLY
Sbjct: 334 IIRKSGLDQVEKKGKFKSQFFEDSLPPSSKPKSFQSIFKGNTNDFFVLGLKFTRKALKLY 393

Query: 397 SNFYQSDIIVCSPLGLHMILENTDKKKRQDDFLSSIELMIIDQLHSMEFQNISHVTSIFE 456
           SNFYQSD+I+CSPLGLHMI ENTDKKK+QDDFLSSIE+ I+DQLHSME+QNISH+ +IFE
Sbjct: 394 SNFYQSDVIICSPLGLHMITENTDKKKKQDDFLSSIEITILDQLHSMEYQNISHIMNIFE 453

Query: 457 HINKIPKEQHDTDFSRIKMWYINDQAKLFRQTMIFTKYISPSANFFLNGKCQNWSGRWKN 516
           H+NKIP+EQHD DFSRI+MWYINDQA+LFRQTMIFTKY+SP+AN  +NGKC+N +GRW+N
Sbjct: 454 HLNKIPREQHDADFSRIRMWYINDQARLFRQTMIFTKYVSPTANAMINGKCRNIAGRWRN 513

Query: 517 HKMITPNESSIGQLGLRVKQMFHRFDIIGGSIVDEPDYRFKYFTSVIVQSITKSTSYEDG 576
              +T  ESS+G+LGL+++Q+F RFD++GG++ DEPD+RFK+F SV++ SI KST YEDG
Sbjct: 514 KIQLTSEESSLGKLGLKIRQIFQRFDLVGGTLADEPDFRFKFFVSVVMNSILKSTGYEDG 573

Query: 577 MLIYITDYTDYVRVRNYLKEKTTILFGDINEYSDQKQVNSNRALFQQRRVKVLLYTERLH 636
           +L+YI +Y+DY+RVRNY+KEKTT+LFGDINEYSDQ+++NSNR+LFQQ RVKVLLYTERLH
Sbjct: 574 ILVYIPNYSDYMRVRNYMKEKTTLLFGDINEYSDQRELNSNRSLFQQGRVKVLLYTERLH 633

Query: 637 HFRRYEIKGVKNIVFYKAPTNPEFYNEVVRYIGKNAFTGNTDINISNVRTIYSKLDGLAL 696
           H+RRYEIKGVK+++FY  PTNPEFYNEVVR+IGKNAF GN DINI+ VR +YSKLD L+L
Sbjct: 634 HYRRYEIKGVKSVIFYGPPTNPEFYNEVVRFIGKNAFLGNVDINIATVRMVYSKLDSLSL 693

Query: 697 ERIMGTKRAAVLTHGQNETYEFK 719
           ERI+GT+RAAVL+  +NE YEFK
Sbjct: 694 ERIVGTQRAAVLSRAENEVYEFK 716

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 48/82 (58%), Gaps = 8/82 (9%)

Query: 14 YGKRGRSQKRSIKKSSGAKR---FKTEDTRIVKETIEDESSDEDVSNTSIDKEAEVTEDL 70
          + KRGRSQ R+I++S  AK+    +  DT   K   E + +D  VS    + E++  +D 
Sbjct: 7  FKKRGRSQLRTIQRSKYAKKRNSGRNYDTN-TKHNDESKPADALVSGEEAESESDDAKDE 65

Query: 71 E----KKKQVYDALVTILKSEH 88
          E    K+ QVY AL+TILKSEH
Sbjct: 66 EDVGKKRNQVYGALLTILKSEH 87

>KLTH0G10494g Chr7 complement(885735..887978) [2244 bp, 747 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091C Protein required for cell viability
          Length = 747

 Score =  845 bits (2182), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/565 (68%), Positives = 481/565 (85%), Gaps = 2/565 (0%)

Query: 155 KSDPFDSHFNQPTEQFTNKFADAFKNKQIKYRSIKYKINEYESSIYSEPRILEDEQTKVK 214
           K D  + HFN  +E+ TN    AFK K+++YRS K  +++ +  IYS P ++ +  + V 
Sbjct: 185 KPDTLEIHFNSVSEKDTNALDAAFKAKEVRYRSCKLHVDKNQEFIYSRPTLVNEPASAVS 244

Query: 215 SPVLKSSIHSYALKKRLKINNDLLDPAVNNLTTIQKELVDPMFQYKDILYEYGNYGKDEE 274
           +P    S++SY +K+RLKI NDLLD + + LT +QK++VDPMFQY+D+LYEY +Y K E 
Sbjct: 245 APDGSQSLNSYFIKQRLKIQNDLLD-SQDKLTPLQKQIVDPMFQYQDLLYEYEDYDK-ET 302

Query: 275 EYRSLYCLHVLNHIYKTRDRILKNNSKVQDNPDAEFLDQGFTRPKVLIVAPTRDAGYSIV 334
           EYR LY LHVLNHIYKTRDRILKNN ++Q+NPD E LDQGFTRPKVLIVAPTRDA Y I+
Sbjct: 303 EYRDLYALHVLNHIYKTRDRILKNNQRLQENPDQELLDQGFTRPKVLIVAPTRDAAYDIL 362

Query: 335 NEIIKKSGIDQIDKKSKFRDQFYEESLLPASKPKSFQAVFKGNSNDYFVLGIKFTRKAIK 394
           ++II+KSG+DQ+DKK+KF+DQF++E+L P+ KPKSFQ +FKGN+ND+FVLG KFTRK IK
Sbjct: 363 SKIIQKSGLDQVDKKAKFKDQFFQEALPPSYKPKSFQQLFKGNTNDFFVLGAKFTRKTIK 422

Query: 395 LYSNFYQSDIIVCSPLGLHMILENTDKKKRQDDFLSSIELMIIDQLHSMEFQNISHVTSI 454
           LYSNFYQSDII+CSPLG+ +ILENTDKKKRQDDFLSSIEL+++DQLHS+EFQN+ H+TSI
Sbjct: 423 LYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIELLVVDQLHSIEFQNMLHLTSI 482

Query: 455 FEHINKIPKEQHDTDFSRIKMWYINDQAKLFRQTMIFTKYISPSANFFLNGKCQNWSGRW 514
           FEHINKIP++QHD DFSRIKMWYINDQAKLFRQT+IFTK+ SP AN  +NGKC+N++GRW
Sbjct: 483 FEHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTKFSSPFANSLINGKCRNYAGRW 542

Query: 515 KNHKMITPNESSIGQLGLRVKQMFHRFDIIGGSIVDEPDYRFKYFTSVIVQSITKSTSYE 574
           KNH++I P  SS+GQLG+R + +F RFD++G S+ +EPD RFK+F SVIV +I KST YE
Sbjct: 543 KNHRVIFPENSSLGQLGMRTRLIFQRFDLVGKSVSEEPDSRFKHFCSVIVPNIVKSTGYE 602

Query: 575 DGMLIYITDYTDYVRVRNYLKEKTTILFGDINEYSDQKQVNSNRALFQQRRVKVLLYTER 634
           DG+L+YI DYTD+VRVRNYL+EKTTILFGDINEYS+Q+Q+ SNRA+FQQ RVKVLLYTER
Sbjct: 603 DGILLYIPDYTDFVRVRNYLREKTTILFGDINEYSEQRQLTSNRAMFQQGRVKVLLYTER 662

Query: 635 LHHFRRYEIKGVKNIVFYKAPTNPEFYNEVVRYIGKNAFTGNTDINISNVRTIYSKLDGL 694
           LHHFRRYEIKGVK ++FYK PTNPEF+ EV RY+GK+AF G  D+NIS VR ++SKLDGL
Sbjct: 663 LHHFRRYEIKGVKTVIFYKPPTNPEFFEEVARYLGKSAFLGLADLNISVVRCLFSKLDGL 722

Query: 695 ALERIMGTKRAAVLTHGQNETYEFK 719
           +LERI+GT+RAAVLTHG NETYEFK
Sbjct: 723 SLERIVGTERAAVLTHGPNETYEFK 747

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 48/93 (51%), Gaps = 5/93 (5%)

Query: 2  SGFKPQNNYSEGYGKRGRSQKRSIKKSSGAKRFKTEDTRIVKETIEDESSDEDVSNTSID 61
          S  K  N Y     K GR Q R+I+K+SG +R   E++   +    +  +++ ++   ++
Sbjct: 9  SAIKGSNEYRSS--KSGRKQLRTIRKASGPRRGLAEESANEENNGSETEAEDKLAAPELN 66

Query: 62 KEAEVTEDLEKKKQVYDALVTILKSEHKEPKMR 94
          + A   +D     + Y AL+T+LK+EH  P  R
Sbjct: 67 EPA---QDQRAGGEAYAALLTLLKAEHGGPARR 96

>Kwal_27.11503 s27 (828115..830298) [2184 bp, 727 aa] {ON} YIL091C -
           Protein required for cell viability [contig 27] FULL
          Length = 727

 Score =  838 bits (2166), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/564 (68%), Positives = 476/564 (84%), Gaps = 2/564 (0%)

Query: 156 SDPFDSHFNQPTEQFTNKFADAFKNKQIKYRSIKYKINEYESSIYSEPRILEDEQTKVKS 215
           SDP ++HFN   E+ T+    AFK KQ++YRS K KI++ E  IYS P +  + +T ++ 
Sbjct: 166 SDPLEAHFNSVPEKDTDALDQAFKTKQVRYRSSKIKISKNEEFIYSRPDLNLESRTPIQV 225

Query: 216 PVLKSSIHSYALKKRLKINNDLLDPAVNNLTTIQKELVDPMFQYKDILYEYGNYGKDEEE 275
           P    S+  Y +K+RLKI NDLLD + NNLT +QK++VDP+FQY+D+LYEY NY + E E
Sbjct: 226 PQGTQSLSPYFIKQRLKIQNDLLD-SKNNLTPLQKKIVDPIFQYQDLLYEYENYDQ-ETE 283

Query: 276 YRSLYCLHVLNHIYKTRDRILKNNSKVQDNPDAEFLDQGFTRPKVLIVAPTRDAGYSIVN 335
           YR LY LH L+HIYKTRDRILKNN ++QDNPD E LDQGFTRPKVLIV PTRD  YS+++
Sbjct: 284 YRDLYALHALDHIYKTRDRILKNNQRLQDNPDQEVLDQGFTRPKVLIVVPTRDVAYSVLS 343

Query: 336 EIIKKSGIDQIDKKSKFRDQFYEESLLPASKPKSFQAVFKGNSNDYFVLGIKFTRKAIKL 395
           +II+KSG+DQ+DKKSKFRDQFY++SL P  KPKSFQ VFKGN+ND+FVLG KFTRK IKL
Sbjct: 344 KIIEKSGLDQVDKKSKFRDQFYQDSLPPKYKPKSFQQVFKGNTNDFFVLGAKFTRKTIKL 403

Query: 396 YSNFYQSDIIVCSPLGLHMILENTDKKKRQDDFLSSIELMIIDQLHSMEFQNISHVTSIF 455
           YSNFYQSDIIVCSPLG+ +ILENTDKKKRQDDFLSSIEL++IDQLHS+EFQN+ H+TSIF
Sbjct: 404 YSNFYQSDIIVCSPLGIQLILENTDKKKRQDDFLSSIELLVIDQLHSIEFQNVLHLTSIF 463

Query: 456 EHINKIPKEQHDTDFSRIKMWYINDQAKLFRQTMIFTKYISPSANFFLNGKCQNWSGRWK 515
           EHINKIP++QHD DFSRIKMWYINDQAKLFRQT+IFT++ +P AN  +NGKC+N++GRWK
Sbjct: 464 EHINKIPQQQHDADFSRIKMWYINDQAKLFRQTLIFTRHSTPFANSLINGKCRNYAGRWK 523

Query: 516 NHKMITPNESSIGQLGLRVKQMFHRFDIIGGSIVDEPDYRFKYFTSVIVQSITKSTSYED 575
           NH ++   +SS+ QLG+R + +F RFD+ GG+  DEPD+RFK+F SVIV +I +ST YED
Sbjct: 524 NHTIVGAEKSSLSQLGMRTRLVFQRFDVAGGAATDEPDFRFKHFCSVIVPNIVQSTGYED 583

Query: 576 GMLIYITDYTDYVRVRNYLKEKTTILFGDINEYSDQKQVNSNRALFQQRRVKVLLYTERL 635
           G+L+YI DYTD++RVRNYL+EKTTILFGDI+EYS+Q+Q+ +NRALFQQ RVKVLLYTERL
Sbjct: 584 GILLYIPDYTDFIRVRNYLREKTTILFGDISEYSEQRQLTANRALFQQGRVKVLLYTERL 643

Query: 636 HHFRRYEIKGVKNIVFYKAPTNPEFYNEVVRYIGKNAFTGNTDINISNVRTIYSKLDGLA 695
           HHFRRYEIKGVK ++FYK PTNPEF+ E VRY+ K+AF G  D+NIS VR +YSKLDGLA
Sbjct: 644 HHFRRYEIKGVKTVIFYKPPTNPEFFEETVRYLAKSAFLGVADLNISVVRCLYSKLDGLA 703

Query: 696 LERIMGTKRAAVLTHGQNETYEFK 719
           LERI+GT+RAA+LTHG NETYEFK
Sbjct: 704 LERIVGTERAAILTHGPNETYEFK 727

 Score = 41.6 bits (96), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 45/79 (56%), Gaps = 7/79 (8%)

Query: 11 SEGYGKRGRSQKRSIKKSSGAKRFKTEDTRIVKETIEDESSD-EDVSNTSIDKEAEVTED 69
           E + K GR Q RSI+K+S     K ED  +  ET E+E ++ EDV     ++  EV+  
Sbjct: 16 GEKFTKGGRKQLRSIRKASRYDSKKPEDEPV--ETPEEEINEVEDVH----EERTEVSRK 69

Query: 70 LEKKKQVYDALVTILKSEH 88
           E   + Y AL+T+LK+EH
Sbjct: 70 QESNGEAYAALLTLLKAEH 88

>ZYRO0A02002g Chr1 complement(164386..166515) [2130 bp, 709 aa] {ON}
           similar to uniprot|P40498 Saccharomyces cerevisiae
           YIL091C Protein required for cell viability
          Length = 709

 Score =  829 bits (2142), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/562 (67%), Positives = 478/562 (85%), Gaps = 3/562 (0%)

Query: 158 PFDSHFNQPTEQFTNKFADAFKNKQIKYRSIKYKINEYESSIYSEPRILEDEQTKVKSPV 217
           PF+SHFN  +E   +   +A+K K+I  +S K ++++ ES IY+  + L  +  + + P 
Sbjct: 151 PFESHFNMQSESI-DSLDEAWKQKKIVNKSGKIRVDDDESLIYT--KTLAGKGQEFELPS 207

Query: 218 LKSSIHSYALKKRLKINNDLLDPAVNNLTTIQKELVDPMFQYKDILYEYGNYGKDEEEYR 277
            K  + SY LK++LKI N+LL+   + LT +Q+++VDP+FQY+D+LYEY +Y +DE+EYR
Sbjct: 208 HKGHLSSYPLKRKLKIQNNLLESQDDVLTPLQRKIVDPIFQYRDLLYEYEDYEQDEDEYR 267

Query: 278 SLYCLHVLNHIYKTRDRILKNNSKVQDNPDAEFLDQGFTRPKVLIVAPTRDAGYSIVNEI 337
            LY LHVLNHIYKTRDRILK+N ++  NPD EFLDQGFTRPKVLIVAPTRD  Y IV+++
Sbjct: 268 DLYVLHVLNHIYKTRDRILKDNQRLATNPDGEFLDQGFTRPKVLIVAPTRDTAYQIVSKV 327

Query: 338 IKKSGIDQIDKKSKFRDQFYEESLLPASKPKSFQAVFKGNSNDYFVLGIKFTRKAIKLYS 397
           I+KSG+DQ+DKKSK RDQF+E+ L P+SKPKSF+  FKGN+ND+FVLG+KFTRKAI+LYS
Sbjct: 328 IEKSGLDQVDKKSKLRDQFFEDVLPPSSKPKSFRHTFKGNTNDFFVLGVKFTRKAIRLYS 387

Query: 398 NFYQSDIIVCSPLGLHMILENTDKKKRQDDFLSSIELMIIDQLHSMEFQNISHVTSIFEH 457
           NFYQSD+IVCSPLGL +ILENTD+KKRQDDFLSSIELMIIDQL+S+EFQN+SH+ +IF H
Sbjct: 388 NFYQSDLIVCSPLGLQLILENTDRKKRQDDFLSSIELMIIDQLNSIEFQNVSHLFTIFAH 447

Query: 458 INKIPKEQHDTDFSRIKMWYINDQAKLFRQTMIFTKYISPSANFFLNGKCQNWSGRWKNH 517
           +NKIPKEQHDTDF R++MWYIN+QAKL RQT+IFT+Y++P+ANF LNGKC+N  GRWKNH
Sbjct: 448 MNKIPKEQHDTDFGRVRMWYINEQAKLLRQTLIFTRYVTPTANFLLNGKCRNIGGRWKNH 507

Query: 518 KMITPNESSIGQLGLRVKQMFHRFDIIGGSIVDEPDYRFKYFTSVIVQSITKSTSYEDGM 577
             IT  +SS+ +LG RV+Q+F R D+ G S+VDEPDYRF++FTSVIV SITKST YEDG+
Sbjct: 508 HQITGEQSSVSKLGFRVRQIFQRVDLGGASVVDEPDYRFRFFTSVIVPSITKSTGYEDGI 567

Query: 578 LIYITDYTDYVRVRNYLKEKTTILFGDINEYSDQKQVNSNRALFQQRRVKVLLYTERLHH 637
           L+YI DY D++RVRNYLK+KTTILFGDINEYSD +Q+ S R+LFQQ R+KVLLYTERLHH
Sbjct: 568 LLYIPDYADFIRVRNYLKDKTTILFGDINEYSDVRQLTSTRSLFQQGRIKVLLYTERLHH 627

Query: 638 FRRYEIKGVKNIVFYKAPTNPEFYNEVVRYIGKNAFTGNTDINISNVRTIYSKLDGLALE 697
           FRRYEIKGVK+++FY+ P+NPEFYNEVVRYIGK+AF G+TD+NIS VR +YSKLDGLALE
Sbjct: 628 FRRYEIKGVKSVIFYQPPSNPEFYNEVVRYIGKSAFLGDTDLNISTVRCVYSKLDGLALE 687

Query: 698 RIMGTKRAAVLTHGQNETYEFK 719
           RI+ +KRAAVLTHGQNE YEFK
Sbjct: 688 RIVSSKRAAVLTHGQNEIYEFK 709

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/88 (38%), Positives = 48/88 (54%), Gaps = 12/88 (13%)

Query: 12 EGYGKRGRSQKRSIKKSSGAKRFKTEDTRIVKETIED----ESSDEDVSNTSIDKEAEVT 67
          +G  KRGR   RSI+++   K    E+  I   + ED    E S+ED +N       EV 
Sbjct: 13 DGSRKRGRKDLRSIRRARNDKE-PVEEPEIPVASEEDGELSEDSEEDATN-------EVQ 64

Query: 68 EDLEKKKQVYDALVTILKSEHKEPKMRD 95
          E  + K++ Y AL+TILKSEH E + R+
Sbjct: 65 EQEDSKEKAYGALLTILKSEHPEDRQRE 92

>KLLA0E08229g Chr5 (742066..744180) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40498 Saccharomyces cerevisiae YIL091C
           Protein required for cell viability
          Length = 704

 Score =  826 bits (2134), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/565 (68%), Positives = 476/565 (84%), Gaps = 5/565 (0%)

Query: 155 KSDPFDSHFNQPTEQFTNKFADAFKNKQIKYRSIKYKINEYESSIYSEPRILEDEQTKVK 214
           +SDPF+SHF++ +E     F   FK+K +KY+S K  ++E ES IYS+P + ++E   VK
Sbjct: 145 ESDPFESHFSKYSESRLYAFDKGFKDKTVKYKSSKTDVSEEESLIYSKPCLDDEEVLPVK 204

Query: 215 SPVLKSSIHSYALKKRLKINNDLLDPAVNNLTTIQKELVDPMFQYKDILYEYGNYGKDEE 274
               K ++ SY +K++LK+ ND  +  +  LT IQKELVDPMFQYKD+LYEY +Y  DE+
Sbjct: 205 G---KQTLSSYFIKQKLKLANDFQNNGLP-LTEIQKELVDPMFQYKDMLYEYDDYA-DED 259

Query: 275 EYRSLYCLHVLNHIYKTRDRILKNNSKVQDNPDAEFLDQGFTRPKVLIVAPTRDAGYSIV 334
           +YR LY LH LNH+YKTRDRILKNN K+Q+N D E LDQGFTRPKVLIV PTRDA + IV
Sbjct: 260 QYRDLYSLHALNHVYKTRDRILKNNQKLQENNDEELLDQGFTRPKVLIVVPTRDAAHKIV 319

Query: 335 NEIIKKSGIDQIDKKSKFRDQFYEESLLPASKPKSFQAVFKGNSNDYFVLGIKFTRKAIK 394
            +I++KSG+DQ DKKSKF DQF+E+SL P SKPKSFQ +F+GN+ND+FVLG+KFTRK++K
Sbjct: 320 RKIMEKSGLDQFDKKSKFEDQFFEDSLPPTSKPKSFQHIFQGNTNDFFVLGLKFTRKSLK 379

Query: 395 LYSNFYQSDIIVCSPLGLHMILENTDKKKRQDDFLSSIELMIIDQLHSMEFQNISHVTSI 454
           +YSNFYQSDII+CSPLG+ +ILENTDKKKRQDDFLSSIE+MIIDQLHS+E+QN  HVT+I
Sbjct: 380 IYSNFYQSDIIICSPLGIQLILENTDKKKRQDDFLSSIEVMIIDQLHSIEYQNAMHVTTI 439

Query: 455 FEHINKIPKEQHDTDFSRIKMWYINDQAKLFRQTMIFTKYISPSANFFLNGKCQNWSGRW 514
           F+HINKIP++Q + DFSRI+MWYIN+QAK FRQT++FTKYISP AN  LNGKC+N +GRW
Sbjct: 440 FQHINKIPEQQREADFSRIRMWYINEQAKFFRQTIVFTKYISPFANSILNGKCRNLAGRW 499

Query: 515 KNHKMITPNESSIGQLGLRVKQMFHRFDIIGGSIVDEPDYRFKYFTSVIVQSITKSTSYE 574
           KNH+ I P +SSIGQLGL+V+Q+F RFD+ GG+ +DEPDYRFK+FTSVIV SI KST YE
Sbjct: 500 KNHRKIKPEQSSIGQLGLKVRQIFQRFDLAGGTALDEPDYRFKFFTSVIVPSIVKSTGYE 559

Query: 575 DGMLIYITDYTDYVRVRNYLKEKTTILFGDINEYSDQKQVNSNRALFQQRRVKVLLYTER 634
           DG+L+YI DYTD++RVRNYLKEKTTI+FG+INEYS+QKQ+ SNRA FQ  +VKVLLYTER
Sbjct: 560 DGILLYIPDYTDFIRVRNYLKEKTTIIFGEINEYSNQKQLTSNRARFQHGKVKVLLYTER 619

Query: 635 LHHFRRYEIKGVKNIVFYKAPTNPEFYNEVVRYIGKNAFTGNTDINISNVRTIYSKLDGL 694
           LHHFRRYEIK VK+++FYK P NPEFY+EVVR IGKN F GN DINIS VR IYSK+DGL
Sbjct: 620 LHHFRRYEIKNVKSVIFYKPPGNPEFYSEVVRNIGKNVFLGNCDINISTVRCIYSKMDGL 679

Query: 695 ALERIMGTKRAAVLTHGQNETYEFK 719
           +LER++G+KRAAVL HGQNE YEFK
Sbjct: 680 SLERVVGSKRAAVLAHGQNEVYEFK 704

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 42/75 (56%), Gaps = 3/75 (4%)

Query: 16 KRGRSQKRSIKKSSGAKRFKTEDTRIVKETIEDESSDEDVSNTSIDKEAEVTEDLEKKKQ 75
          K GR Q R I ++ G KR + +D   V +   D  SD D +  S+  E E  E  + + Q
Sbjct: 9  KSGRKQLREITRA-GQKRVRYDDEATVADLTPDNESDSDNAEPSVAAEREDVE--QHRGQ 65

Query: 76 VYDALVTILKSEHKE 90
           Y+AL+T+LKSEH E
Sbjct: 66 AYNALLTLLKSEHPE 80

>Ecym_3331 Chr3 complement(631944..634070) [2127 bp, 708 aa] {ON}
           similar to Ashbya gossypii ADL209C
          Length = 708

 Score =  815 bits (2106), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/566 (67%), Positives = 470/566 (83%), Gaps = 4/566 (0%)

Query: 157 DPFDSHFNQPTEQFTNKFADAFKNKQIKYRSIKYK-INEYESSIYSEPRI--LEDEQTKV 213
           DPF+ HFNQ +E  TNK   AFK K ++Y S K   +++ E  I+S+P I  L+      
Sbjct: 144 DPFEYHFNQISEMDTNKLDAAFKEKTVQYESTKLPYMHDNEGFIFSKPVIEGLKGSDAVN 203

Query: 214 KSPVLKSSIHSYALKKRLKINNDLLDPAVNNLTTIQKELVDPMFQYKDILYEYGNYGKDE 273
            +PV K +IHSY +KK+LK++N LLD     LT + K LVDP+FQY+D+L+EY ++ + E
Sbjct: 204 DTPVCKGNIHSYFMKKKLKVHNGLLDDKKKPLTPLSKTLVDPIFQYRDLLFEYEDFSQ-E 262

Query: 274 EEYRSLYCLHVLNHIYKTRDRILKNNSKVQDNPDAEFLDQGFTRPKVLIVAPTRDAGYSI 333
            EYR LY LH+LNHIYKTRDRILKNN K+Q+N D E LDQGFTRPKVL+VAPTR+  Y I
Sbjct: 263 TEYRDLYTLHILNHIYKTRDRILKNNHKLQENDDQELLDQGFTRPKVLVVAPTRNTAYDI 322

Query: 334 VNEIIKKSGIDQIDKKSKFRDQFYEESLLPASKPKSFQAVFKGNSNDYFVLGIKFTRKAI 393
           + +II KSG+DQ+DKKSKF+DQFYE+SL P SKPKSFQ VFKGN+ND+FVLG+KFTRK +
Sbjct: 323 IEKIIDKSGLDQVDKKSKFKDQFYEDSLPPTSKPKSFQHVFKGNTNDFFVLGMKFTRKTL 382

Query: 394 KLYSNFYQSDIIVCSPLGLHMILENTDKKKRQDDFLSSIELMIIDQLHSMEFQNISHVTS 453
           KLYSNFYQSD+IVCSPLG+ +ILENTDKKKRQDDFLSSIE++++DQLHS+EFQN +HV S
Sbjct: 383 KLYSNFYQSDVIVCSPLGIQLILENTDKKKRQDDFLSSIEMLVVDQLHSLEFQNPAHVLS 442

Query: 454 IFEHINKIPKEQHDTDFSRIKMWYINDQAKLFRQTMIFTKYISPSANFFLNGKCQNWSGR 513
           IF+HINKIP++QHD+DFSRI+MWYINDQA+LFRQT+IFTKY+SP AN  +NGKC NWSGR
Sbjct: 443 IFQHINKIPQKQHDSDFSRIRMWYINDQARLFRQTLIFTKYVSPFANSLINGKCCNWSGR 502

Query: 514 WKNHKMITPNESSIGQLGLRVKQMFHRFDIIGGSIVDEPDYRFKYFTSVIVQSITKSTSY 573
           +KN + I+P +S+I QLGL+V+Q+FHRFD+  GS VDEPDYRFK+FTSV V  I KST Y
Sbjct: 503 FKNRRYISPEKSAINQLGLKVRQVFHRFDLFTGSSVDEPDYRFKFFTSVTVPIIQKSTGY 562

Query: 574 EDGMLIYITDYTDYVRVRNYLKEKTTILFGDINEYSDQKQVNSNRALFQQRRVKVLLYTE 633
           EDG+L+YI DYTD++RVRNY K++T ILFG+I EYSDQ+QV SNRALFQQ +VKVLLYTE
Sbjct: 563 EDGILLYIPDYTDFLRVRNYFKDQTRILFGEITEYSDQRQVTSNRALFQQGKVKVLLYTE 622

Query: 634 RLHHFRRYEIKGVKNIVFYKAPTNPEFYNEVVRYIGKNAFTGNTDINISNVRTIYSKLDG 693
           RLHHFRRY+IKGVK+++FYK P+NPEFY E++R IGKNAF GN D+NIS VR  Y KLD 
Sbjct: 623 RLHHFRRYQIKGVKSVIFYKPPSNPEFYQELIRCIGKNAFLGNADLNISTVRCTYCKLDS 682

Query: 694 LALERIMGTKRAAVLTHGQNETYEFK 719
           L+LERI+G+KRAAVLT  QNE YEFK
Sbjct: 683 LSLERIVGSKRAAVLTRSQNEIYEFK 708

>ADL209C Chr4 complement(334817..336931) [2115 bp, 704 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL091C
          Length = 704

 Score =  793 bits (2047), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/566 (65%), Positives = 462/566 (81%), Gaps = 4/566 (0%)

Query: 155 KSDPFDSHFNQPTEQFTNKFADAFKNKQIKYRSIKYKINEYESSIYSEPRILEDEQTKVK 214
           + D FD HFN+ +     +   AFKN + +YR  K    E E  +YS+P +   E T+  
Sbjct: 142 EQDHFDVHFNRVSAADVAQLDAAFKNGRAQYRVQKEARGE-EEILYSKP-VASSEGTEGP 199

Query: 215 SPVLKSSIHSYALKKRLKINNDL-LDPAVNNLTTIQKELVDPMFQYKDILYEYGNYGKDE 273
             V   S+  YA+K+RL+++N L  D     LT  QK L+DPMFQY+DILYEY  Y + E
Sbjct: 200 VRVPARSLRGYAIKQRLRMHNGLTADDPEKPLTPQQKVLLDPMFQYQDILYEYEGYDR-E 258

Query: 274 EEYRSLYCLHVLNHIYKTRDRILKNNSKVQDNPDAEFLDQGFTRPKVLIVAPTRDAGYSI 333
            EYR LY LH+LNH+YKTRDRILKNN K+QDNPD E LDQGFTRPK L+V PTR   Y +
Sbjct: 259 REYRELYTLHILNHVYKTRDRILKNNQKLQDNPDQELLDQGFTRPKALVVVPTRATAYDV 318

Query: 334 VNEIIKKSGIDQIDKKSKFRDQFYEESLLPASKPKSFQAVFKGNSNDYFVLGIKFTRKAI 393
           V+ ++++SGI+Q+DKKSKF+DQFY+ SL PASKPKSFQ VFKGN+ND+FVLG+KFTRKAI
Sbjct: 319 VDLLLQQSGIEQVDKKSKFKDQFYDPSLPPASKPKSFQHVFKGNTNDFFVLGMKFTRKAI 378

Query: 394 KLYSNFYQSDIIVCSPLGLHMILENTDKKKRQDDFLSSIELMIIDQLHSMEFQNISHVTS 453
           +LYSNFYQSD+IVCSPLGL +I+ENTDKKKRQDDFLSSIE+M++DQLHS+EFQNI+HV++
Sbjct: 379 RLYSNFYQSDVIVCSPLGLQLIIENTDKKKRQDDFLSSIEVMVLDQLHSIEFQNIAHVSN 438

Query: 454 IFEHINKIPKEQHDTDFSRIKMWYINDQAKLFRQTMIFTKYISPSANFFLNGKCQNWSGR 513
           IF HINKIP++Q D DFSRI+MWYI DQAKLFRQTM+FT+YISP AN  LN KC NW+GR
Sbjct: 439 IFAHINKIPQQQRDADFSRIRMWYIEDQAKLFRQTMVFTRYISPFANALLNRKCANWAGR 498

Query: 514 WKNHKMITPNESSIGQLGLRVKQMFHRFDIIGGSIVDEPDYRFKYFTSVIVQSITKSTSY 573
            K+H++++  +S IGQLGL+++Q+F RF+++GGS VDEPD+RFK+FTSV+V  I K+T Y
Sbjct: 499 VKSHRVVSAEKSVIGQLGLKLRQIFQRFEVLGGSTVDEPDFRFKFFTSVVVPGIEKTTGY 558

Query: 574 EDGMLIYITDYTDYVRVRNYLKEKTTILFGDINEYSDQKQVNSNRALFQQRRVKVLLYTE 633
           + G+L+YI +YTD++RVRNYLK+KT ILFGDINEYSDQ+Q+ SNRALFQ  R+KVLLYTE
Sbjct: 559 DSGILLYIPEYTDFIRVRNYLKDKTRILFGDINEYSDQRQLTSNRALFQLGRIKVLLYTE 618

Query: 634 RLHHFRRYEIKGVKNIVFYKAPTNPEFYNEVVRYIGKNAFTGNTDINISNVRTIYSKLDG 693
           RLHHFRR+E+KGVK+++ YK P+NPEFY E++RYIGK+AF G  D+NI+ VR +YSK+D 
Sbjct: 619 RLHHFRRFELKGVKSVILYKPPSNPEFYQELLRYIGKSAFLGVADLNIATVRCLYSKMDS 678

Query: 694 LALERIMGTKRAAVLTHGQNETYEFK 719
           LALERI+GTKRAAVLTHGQNE YEFK
Sbjct: 679 LALERIVGTKRAAVLTHGQNEVYEFK 704

 Score = 38.1 bits (87), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query: 15 GKRGRSQKRSIKKSSGAKRFKTEDTRIVKE-TIEDESSDEDVSNTSIDKEAEVTEDLEKK 73
          GKRGR Q R+I +   A   + ++ +  +E T+E+  + E  SN          +   ++
Sbjct: 12 GKRGRKQLRNITRIGRAIHVQEDEAKSREEHTVEEAQAGEQTSNRKRGNHPAEDDGGARE 71

Query: 74 KQVYDALVTILKSEH 88
           Q Y AL+T+L +EH
Sbjct: 72 SQSYGALLTLLSAEH 86

>KAFR0B03200 Chr2 (661966..663300) [1335 bp, 444 aa] {ON}  YMR210W
          Length = 444

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 73/169 (43%), Gaps = 29/169 (17%)

Query: 211 TKVKSPVLKSSI------HSYALKKRLKINNDLLDPAVNNLTTIQK---ELVDPMFQYKD 261
           +K+ SP + +++      HSYALK    +  D     +  + TI++       PMF YKD
Sbjct: 267 SKIYSPTMANNLCKLAVRHSYALKD-CPLWEDKFQQKIKAVRTIKQFDDTFTGPMFGYKD 325

Query: 262 ILYEYGNYG--KDEEEYRSLYCLHVLNHIYKTRDRILKNNSKVQDNPDAEFLDQGFTRPK 319
               YGN    K  E  R+ +    +N I    D ++      Q+ PDAEF +  +T   
Sbjct: 326 AFEYYGNASSFKRIEGIRTPFL--AINAI---DDPVVGG----QELPDAEFRENPYT--- 373

Query: 320 VLIVAPTRDAGYSIVNEIIKKSGIDQ-IDKKSKFRDQFYEESLLPASKP 367
             ++  T   G+  +  +  K+G+    D   KF   F+ E  L   KP
Sbjct: 374 --LMLKTNIGGH--IAWLKNKNGMRWYADPICKFLRAFHTEITLKKMKP 418

>TDEL0F05050 Chr6 (947571..951983) [4413 bp, 1470 aa] {ON} Anc_8.381
           YDR180W
          Length = 1470

 Score = 32.7 bits (73), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 59/144 (40%), Gaps = 27/144 (18%)

Query: 174 FADAFKNKQIKYRSIKYK----------INEYESSIYSEPRILEDEQTKVKSPVLKSSIH 223
           F+ +    +IKY  IKY           +N YE  +     +LE E+ K+KS  +K    
Sbjct: 650 FSSSENVPKIKYLDIKYDYYSFLHAFDLMNLYEPYLKVLLTLLESEKIKMKSTAIKCLSM 709

Query: 224 SYALKKRLKINNDLLDPAVNNLTTIQKELVDPMFQYKDILYEYGNYGKDEEEYRSLYCLH 283
             +  K +     L  P V +  TI K L +     KD + +  N G   EEY       
Sbjct: 710 LASHDKAI-----LFSPMVKH--TIGKTLENSPASVKDAILDLINRGSSAEEYY-----Q 757

Query: 284 VLNHIYK-----TRDRILKNNSKV 302
            +NH Y       R R+LK N K+
Sbjct: 758 QINHNYDDESTLIRKRVLKMNEKI 781

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 78,500,012
Number of extensions: 3725870
Number of successful extensions: 17858
Number of sequences better than 10.0: 109
Number of HSP's gapped: 18657
Number of HSP's successfully gapped: 129
Length of query: 719
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 602
Effective length of database: 40,065,477
Effective search space: 24119417154
Effective search space used: 24119417154
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)