Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0B059602.290ON26626613350.0
Ecym_33292.290ON2582617821e-104
KLTH0G10450g2.290ON2612507541e-100
SAKL0E07590g2.290ON2602377403e-98
Skud_9.802.290ON2642557396e-98
KAFR0J013502.290ON2642507343e-97
Smik_9.862.290ON2642647301e-96
Kwal_27.115092.290ON2612347291e-96
ZYRO0A01958g2.290ON2632487274e-96
Kpol_1003.402.290ON2612597241e-95
KLLA0E08273g2.290ON2612477212e-95
TDEL0G022002.290ON2612597162e-94
YIL093C (RSM25)2.290ON2642627144e-94
Suva_9.1062.290ON2642577134e-94
NDAI0B035402.290ON2612567073e-93
CAGL0D04158g2.290ON2722387051e-92
NCAS0B062402.290ON2602406996e-92
TPHA0C034202.290ON2682636892e-90
KNAG0A054102.290ON2662406641e-86
ADL211C2.290ON2251796053e-78
TPHA0E037501.36ON41372692.6
Smik_2.3228.566ON447108683.5
Skud_2.3088.566ON45277659.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0B05960
         (266 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0B05960 Chr2 complement(1408779..1409579) [801 bp, 266 aa] {...   518   0.0  
Ecym_3329 Chr3 complement(630346..631122) [777 bp, 258 aa] {ON} ...   305   e-104
KLTH0G10450g Chr7 complement(884037..884822) [786 bp, 261 aa] {O...   295   e-100
SAKL0E07590g Chr5 (613875..614657) [783 bp, 260 aa] {ON} similar...   289   3e-98
Skud_9.80 Chr9 complement(164635..165429) [795 bp, 264 aa] {ON} ...   289   6e-98
KAFR0J01350 Chr10 (247931..248725) [795 bp, 264 aa] {ON} Anc_2.2...   287   3e-97
Smik_9.86 Chr9 complement(167101..167895) [795 bp, 264 aa] {ON} ...   285   1e-96
Kwal_27.11509 s27 (831150..831935) [786 bp, 261 aa] {ON} YIL093C...   285   1e-96
ZYRO0A01958g Chr1 complement(162742..163533) [792 bp, 263 aa] {O...   284   4e-96
Kpol_1003.40 s1003 complement(97903..98688) [786 bp, 261 aa] {ON...   283   1e-95
KLLA0E08273g Chr5 (745145..745930) [786 bp, 261 aa] {ON} similar...   282   2e-95
TDEL0G02200 Chr7 complement(433032..433817) [786 bp, 261 aa] {ON...   280   2e-94
YIL093C Chr9 complement(187990..188784) [795 bp, 264 aa] {ON}  R...   279   4e-94
Suva_9.106 Chr9 complement(182086..182880) [795 bp, 264 aa] {ON}...   279   4e-94
NDAI0B03540 Chr2 (890148..890933) [786 bp, 261 aa] {ON} Anc_2.29...   276   3e-93
CAGL0D04158g Chr4 complement(410309..411127) [819 bp, 272 aa] {O...   276   1e-92
NCAS0B06240 Chr2 (1178232..1179014) [783 bp, 260 aa] {ON} Anc_2....   273   6e-92
TPHA0C03420 Chr3 complement(750353..751159) [807 bp, 268 aa] {ON...   270   2e-90
KNAG0A05410 Chr1 (798238..799038) [801 bp, 266 aa] {ON} Anc_2.29...   260   1e-86
ADL211C Chr4 complement(333418..334095) [678 bp, 225 aa] {ON} Sy...   237   3e-78
TPHA0E03750 Chr5 (790322..791563) [1242 bp, 413 aa] {ON} Anc_1.3...    31   2.6  
Smik_2.322 Chr2 complement(579730..581073) [1344 bp, 447 aa] {ON...    31   3.5  
Skud_2.308 Chr2 complement(560833..562191) [1359 bp, 452 aa] {ON...    30   9.0  

>TBLA0B05960 Chr2 complement(1408779..1409579) [801 bp, 266 aa] {ON}
           Anc_2.290 YIL093C
          Length = 266

 Score =  518 bits (1335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/266 (95%), Positives = 253/266 (95%)

Query: 1   MKIQQNAVNVLERTSAYLQAGMIKKPPVWYDVVAATPPSKKFTREPKFINPSTNKRTVEF 60
           MKIQQNAVNVLERTSAYLQAGMIKKPPVWYDVVAATPPSKKFTREPKFINPSTNKRTVEF
Sbjct: 1   MKIQQNAVNVLERTSAYLQAGMIKKPPVWYDVVAATPPSKKFTREPKFINPSTNKRTVEF 60

Query: 61  KPLKDYLNRTTGLYKTRANSIDKKNAVSSLYKIPKLTYIEDKLRKLFYEQHPWELTRPKI 120
           KPLKDYLNRTTGLYKTRANSIDKKNAVSSLYKIPKLTYIEDKLRKLFYEQHPWELTRPKI
Sbjct: 61  KPLKDYLNRTTGLYKTRANSIDKKNAVSSLYKIPKLTYIEDKLRKLFYEQHPWELTRPKI 120

Query: 121 VMENHGEVTYDWSRLLQLGKPLDGESVVQRTLFLLKTKEHRKLIDAYNQARFEFYRLRMA 180
           VMENHGEVTYDWSRLLQLGKPLDGESVVQRTLFLLKTKEHRKLIDAYNQARFEFYRLRMA
Sbjct: 121 VMENHGEVTYDWSRLLQLGKPLDGESVVQRTLFLLKTKEHRKLIDAYNQARFEFYRLRMA 180

Query: 181 XXXXXXXXXXXXXMFGAVFGSTTIEFGIEKEQEMIDSWKVEAIKETEINEAKRSKESVSW 240
                        MFGAVFGSTTIEFGIEKEQEMIDSWKVEAIKETEINEAKRSKESVSW
Sbjct: 181 EEIQEQVAQEESEMFGAVFGSTTIEFGIEKEQEMIDSWKVEAIKETEINEAKRSKESVSW 240

Query: 241 KTDSLEGKEDEFNTGDILEAEPETTN 266
           KTDSLEGKEDEFNTGDILEAEPETTN
Sbjct: 241 KTDSLEGKEDEFNTGDILEAEPETTN 266

>Ecym_3329 Chr3 complement(630346..631122) [777 bp, 258 aa] {ON}
           similar to Ashbya gossypii ADL211C
          Length = 258

 Score =  305 bits (782), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 142/261 (54%), Positives = 186/261 (71%), Gaps = 7/261 (2%)

Query: 1   MKIQQNAVNVLERTSAYLQAGMIKKPPVWYDVVAATPPSKKFTREPKFINPSTNKRTVEF 60
           MKIQ NA N+LERTS++L+ G++ + PVWYDV+  +PPS KF R+PK +NPST   T + 
Sbjct: 1   MKIQTNATNILERTSSFLRVGLLARTPVWYDVIVKSPPSTKFARQPKLVNPSTGAYTAKL 60

Query: 61  KPLKDYLNRTTGLYKTRANSIDKKNAVSSLYKIPKLTYIEDKLRKLFYEQHPWELTRPKI 120
           +   D  N ++G YKTRAN  +K+ + S++Y+ PKL Y EDKLR LFY+QHPWEL+RPKI
Sbjct: 61  REFSDNRNSSSGTYKTRANKHEKRVSTSAVYRAPKLYYFEDKLRSLFYKQHPWELSRPKI 120

Query: 121 VMENHGEVTYDWSRLLQLGKPLDGESVVQRTLFLLKTKEHRKLIDAYNQARFEFYRLRMA 180
           ++EN G+  +DWSR+ QLGKPLDGESVVQRTL+LL + EH  LIDAY+QARFEFYRLRM 
Sbjct: 121 LVENQGDEKHDWSRIQQLGKPLDGESVVQRTLYLLGSGEHTNLIDAYDQARFEFYRLRMQ 180

Query: 181 XXXXXXXXXXXXXMFGAVFGSTTIEFGIEKEQEMIDSWKVEAIKETEINEAKRSKESVSW 240
                        M G+VFG + +EFG+ KEQE+ID WK +A+K+ E+  AKRS +S +W
Sbjct: 181 QELEEQVAQEEAGMLGSVFGPSAVEFGLRKEQEVIDDWKKKALKQVELMSAKRSDQSANW 240

Query: 241 KTDSLEGKEDEFNTGDILEAE 261
            T     +ED  N  D +E E
Sbjct: 241 GT-----RED--NANDAVEIE 254

>KLTH0G10450g Chr7 complement(884037..884822) [786 bp, 261 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093C RSM25 Mitochondrial ribosomal protein of the
           small subunit
          Length = 261

 Score =  295 bits (754), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 137/250 (54%), Positives = 180/250 (72%)

Query: 1   MKIQQNAVNVLERTSAYLQAGMIKKPPVWYDVVAATPPSKKFTREPKFINPSTNKRTVEF 60
           MK+QQNAVNVLERTS+YL+AG++KK P WYDVVA  PPSK+F REP+ +NPSTNK T + 
Sbjct: 1   MKVQQNAVNVLERTSSYLKAGLLKKTPAWYDVVAFVPPSKRFVREPRLVNPSTNKETAKL 60

Query: 61  KPLKDYLNRTTGLYKTRANSIDKKNAVSSLYKIPKLTYIEDKLRKLFYEQHPWELTRPKI 120
               +  +     YKTRA+  +++ + S L+  PKL Y EDKLR++FYEQHPWEL+RPK+
Sbjct: 61  SEFAEQYSVENRSYKTRASRSERQVSGSKLFAAPKLKYAEDKLREVFYEQHPWELSRPKM 120

Query: 121 VMENHGEVTYDWSRLLQLGKPLDGESVVQRTLFLLKTKEHRKLIDAYNQARFEFYRLRMA 180
           ++EN G   YDWS + QLGKPLDGESVVQRTL+LL+TK H++L+ AY+QARFEFYRLR+ 
Sbjct: 121 LVENSGTHDYDWSTIQQLGKPLDGESVVQRTLYLLRTKAHQELLAAYDQARFEFYRLRIQ 180

Query: 181 XXXXXXXXXXXXXMFGAVFGSTTIEFGIEKEQEMIDSWKVEAIKETEINEAKRSKESVSW 240
                        MFG+VFG + I+FG+EKEQ++ID WK +AI +TE+  A+    S SW
Sbjct: 181 EEVQNQVAQEEAEMFGSVFGPSAIDFGLEKEQKIIDVWKQKAIDQTEVMSARNINPSESW 240

Query: 241 KTDSLEGKED 250
                + + D
Sbjct: 241 SAQESQPQSD 250

>SAKL0E07590g Chr5 (613875..614657) [783 bp, 260 aa] {ON} similar to
           uniprot|P40496 Saccharomyces cerevisiae YIL093C RSM25
           Mitochondrial ribosomal protein of the small subunit
          Length = 260

 Score =  289 bits (740), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 133/237 (56%), Positives = 175/237 (73%)

Query: 1   MKIQQNAVNVLERTSAYLQAGMIKKPPVWYDVVAATPPSKKFTREPKFINPSTNKRTVEF 60
           MK+Q NAVN+LERTSAYL+AG++ K P WY+VVA+ PPSK F REPK  NPS NK     
Sbjct: 1   MKVQTNAVNLLERTSAYLRAGLLTKAPAWYNVVASVPPSKSFAREPKITNPSNNKNIASL 60

Query: 61  KPLKDYLNRTTGLYKTRANSIDKKNAVSSLYKIPKLTYIEDKLRKLFYEQHPWELTRPKI 120
               + +    G YKTR +  D+K + + LYK PKL Y EDKLR+LFY+QHPWEL+RPK+
Sbjct: 61  SEYSETVGIKNGTYKTRQSGSDRKVSFNKLYKAPKLNYAEDKLRELFYQQHPWELSRPKV 120

Query: 121 VMENHGEVTYDWSRLLQLGKPLDGESVVQRTLFLLKTKEHRKLIDAYNQARFEFYRLRMA 180
           ++EN GE +YDWS + QLGKPLDGESVVQRTL+LLK K+   L++AY+QARFEFYR+R+ 
Sbjct: 121 LIENTGEESYDWSTIQQLGKPLDGESVVQRTLYLLKEKKQLTLVNAYDQARFEFYRVRVQ 180

Query: 181 XXXXXXXXXXXXXMFGAVFGSTTIEFGIEKEQEMIDSWKVEAIKETEINEAKRSKES 237
                        MFG+VFGS++IE+G+EKEQ++I++WK +AI++TE+  A+ S  S
Sbjct: 181 QEIHEQVAQEEAEMFGSVFGSSSIEYGLEKEQKVIETWKKKAIQQTELMAARSSGPS 237

>Skud_9.80 Chr9 complement(164635..165429) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  289 bits (739), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 141/255 (55%), Positives = 187/255 (73%), Gaps = 5/255 (1%)

Query: 1   MKIQQNAVNVLERTSAYLQAGMIKKPPVWYDVVAATPPSKKFTREPKFINPSTNKRTVEF 60
           MKIQ NAVNVL+RTSAYL++G++K+ P WY+VVA+ PPS KFTREP+F NPS      E 
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFNNPSNGDTIGEL 60

Query: 61  KPL--KDYLNRTTGLYKTRANSIDKKNAVSSLYKIPKLTYIEDKLRKLFYEQHPWELTRP 118
             +  + + N+  GLYKTR N+ DK+ +V  LYK PKLTY+ED+LR LFY+QHPWEL+RP
Sbjct: 61  DDVTQRQHANKN-GLYKTRPNTNDKRVSVKKLYKPPKLTYVEDRLRALFYKQHPWELSRP 119

Query: 119 KIVMENH-GEVTYDWSRLLQLGKPLDGESVVQRTLFLLKTKEHRKLIDAYNQARFEFYRL 177
           KI++EN  G+  YDW R+LQLGKPLDGESVVQRT+ LLKTK++  +++AY+ AR+EFY L
Sbjct: 120 KILVENEIGDEDYDWGRMLQLGKPLDGESVVQRTMHLLKTKQYEDMVEAYDSARYEFYAL 179

Query: 178 RMAXXXXXXXXXXXXXMFGAVFGSTTIEFGIEKEQEMIDSWKVEAIKETEINEAKRSKES 237
           RM              MFG++FG + IE GI+KEQE++D W+ + I+ETE+  AK S  +
Sbjct: 180 RMQEETQQQVALEEAEMFGSIFGVSAIEHGIQKEQEVLDVWEKKVIEETELMAAKSSNPA 239

Query: 238 VSWKTD-SLEGKEDE 251
            SWK D +L+  +DE
Sbjct: 240 GSWKDDTTLDTAQDE 254

>KAFR0J01350 Chr10 (247931..248725) [795 bp, 264 aa] {ON} Anc_2.290
           YIL093C
          Length = 264

 Score =  287 bits (734), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 136/250 (54%), Positives = 178/250 (71%), Gaps = 2/250 (0%)

Query: 1   MKIQQNAVNVLERTSAYLQAGMIKKPPVWYDVVAATPPSKKFTREPKFINPSTNKRTVEF 60
           MKIQ NA N+LERTSAYLQAG+++  P +YDV+A  PPS KFTREPK +NPST +    F
Sbjct: 1   MKIQTNATNILERTSAYLQAGLLRNAPAFYDVIAQVPPSTKFTREPKLVNPSTGQDRTRF 60

Query: 61  KPLKDYLNRTTGLYKTRANSIDKKNAVSSLYKIPKLTYIEDKLRKLFYEQHPWELTRPKI 120
           + L D +N   GLYKTR  + D+  +VS LYK  +L Y+ED LR+LFY+QHPWEL+RPKI
Sbjct: 61  RELTDKVN-WRGLYKTRYAASDRHASVSRLYKASRLKYLEDDLRQLFYDQHPWELSRPKI 119

Query: 121 VMENH-GEVTYDWSRLLQLGKPLDGESVVQRTLFLLKTKEHRKLIDAYNQARFEFYRLRM 179
           V+EN+    + DWS + QLGKP+DGESVVQRTLFL+K K+H  L D Y+QARFEFY++RM
Sbjct: 120 VIENNIDNSSLDWSNIQQLGKPVDGESVVQRTLFLMKNKKHDNLADCYDQARFEFYQVRM 179

Query: 180 AXXXXXXXXXXXXXMFGAVFGSTTIEFGIEKEQEMIDSWKVEAIKETEINEAKRSKESVS 239
                         MFG++FG T +E+GI++EQ++I  WK  AI+ETE+ +AKR+  S S
Sbjct: 180 QRDSEEQIATEEAAMFGSIFGPTALEYGIQREQDVIAKWKQRAIRETELLDAKRANPSDS 239

Query: 240 WKTDSLEGKE 249
           W  +    K+
Sbjct: 240 WAQEESSDKD 249

>Smik_9.86 Chr9 complement(167101..167895) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  285 bits (730), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 141/264 (53%), Positives = 189/264 (71%), Gaps = 8/264 (3%)

Query: 1   MKIQQNAVNVLERTSAYLQAGMIKKPPVWYDVVAATPPSKKFTREPKFINPS---TNKRT 57
           MKIQ NAVNVL+RTSAYL++G++K  P WY+VVA+ PPS KFTREP F NPS   T  R 
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKDTPAWYNVVASIPPSTKFTREPHFENPSNGHTIGRL 60

Query: 58  VEFKPLKDYLNRTTGLYKTRANSIDKKNAVSSLYKIPKLTYIEDKLRKLFYEQHPWELTR 117
           V+   +++    + GLYKTR N+ DK+  V  LYK PKLTY+ED+LR LFY+QHPWEL+R
Sbjct: 61  VDV--IENQHTNSNGLYKTRPNTNDKRIGVKKLYKPPKLTYVEDRLRTLFYKQHPWELSR 118

Query: 118 PKIVMENH-GEVTYDWSRLLQLGKPLDGESVVQRTLFLLKTKEHRKLIDAYNQARFEFYR 176
           PKI++EN  G+  YDWS +LQLGKPLDGESV+QRT++LLKTK++   ++AY+ AR+EFY 
Sbjct: 119 PKILVENEIGDEDYDWSHMLQLGKPLDGESVIQRTMYLLKTKQYENTVEAYDHARYEFYA 178

Query: 177 LRMAXXXXXXXXXXXXXMFGAVFGSTTIEFGIEKEQEMIDSWKVEAIKETEINEAKRSKE 236
           LRM              MFG++FG + IE GI+KEQE+++ W+ + I+ETE+  A+ S  
Sbjct: 179 LRMQEETQQQVALEEAEMFGSIFGKSAIEHGIQKEQEVLNIWEKKVIEETELMAARSSNP 238

Query: 237 SVSWKTDSL--EGKEDEFNTGDIL 258
           + SWK D+     +E+E NT + L
Sbjct: 239 AGSWKDDTTLHTAQEEESNTAESL 262

>Kwal_27.11509 s27 (831150..831935) [786 bp, 261 aa] {ON} YIL093C
           (RSM25) - mitochondrial ribosome small subunit component
           [contig 27] FULL
          Length = 261

 Score =  285 bits (729), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 132/234 (56%), Positives = 175/234 (74%)

Query: 1   MKIQQNAVNVLERTSAYLQAGMIKKPPVWYDVVAATPPSKKFTREPKFINPSTNKRTVEF 60
           MK+QQNAVNVLERTS+YL+AG++KK P WY+VVA  PPSK+F REP+ +NPSTN    + 
Sbjct: 1   MKVQQNAVNVLERTSSYLRAGILKKTPAWYEVVAQIPPSKRFVREPRLVNPSTNDEIAKL 60

Query: 61  KPLKDYLNRTTGLYKTRANSIDKKNAVSSLYKIPKLTYIEDKLRKLFYEQHPWELTRPKI 120
              ++  N     YKTRA+  DK+ + + LYK PKL Y EDKLR+LF+EQHPWEL+RPK+
Sbjct: 61  SEFRESYNFENRSYKTRASRGDKQVSGNKLYKAPKLKYAEDKLRELFFEQHPWELSRPKM 120

Query: 121 VMENHGEVTYDWSRLLQLGKPLDGESVVQRTLFLLKTKEHRKLIDAYNQARFEFYRLRMA 180
           ++EN G   YDWS L QLGKPLDGESVVQRTL+LLK+K+H++L+ AY+QARFEFYRLR+ 
Sbjct: 121 LVENSGIQDYDWSTLQQLGKPLDGESVVQRTLYLLKSKKHQELLAAYDQARFEFYRLRIQ 180

Query: 181 XXXXXXXXXXXXXMFGAVFGSTTIEFGIEKEQEMIDSWKVEAIKETEINEAKRS 234
                        M G+VFG + I+FG++KEQ++ID WK +AI ++E+  A+ +
Sbjct: 181 EEVQNQVAQEEAEMLGSVFGPSAIDFGLKKEQKIIDVWKQKAIDQSELLSARNT 234

>ZYRO0A01958g Chr1 complement(162742..163533) [792 bp, 263 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093C RSM25 Mitochondrial ribosomal protein of the
           small subunit
          Length = 263

 Score =  284 bits (727), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 132/248 (53%), Positives = 182/248 (73%), Gaps = 1/248 (0%)

Query: 1   MKIQQNAVNVLERTSAYLQAGMIKKPPVWYDVVAATPPSKKFTREPKFINPSTNKRTVEF 60
           MK+Q NAVNVLERTSAYL++G++++ P WY VVA+ PP+ KFTRE +FINPST K+TV++
Sbjct: 1   MKLQTNAVNVLERTSAYLRSGLLRETPAWYQVVASVPPTTKFTREARFINPSTGKKTVQW 60

Query: 61  KPLKDYLNRTTGLYKTRANSIDKKNAVSSLYKIPKLTYIEDKLRKLFYEQHPWELTRPKI 120
           K   + +NR  G YKTR +S D+K   S LYK PKL ++ED+LR++FY+QHPWE +RPK+
Sbjct: 61  KEFDEGINRK-GFYKTRNSSFDRKPMDSRLYKAPKLQFLEDQLREVFYQQHPWEFSRPKM 119

Query: 121 VMENHGEVTYDWSRLLQLGKPLDGESVVQRTLFLLKTKEHRKLIDAYNQARFEFYRLRMA 180
           ++EN     +DWS + QLGKPLDGESVVQRT++LL+      +IDAY++ RFEFYRLRM 
Sbjct: 120 LVENEINENFDWSYMSQLGKPLDGESVVQRTIYLLQKDPELGIIDAYDRTRFEFYRLRMQ 179

Query: 181 XXXXXXXXXXXXXMFGAVFGSTTIEFGIEKEQEMIDSWKVEAIKETEINEAKRSKESVSW 240
                        MFG+VF S+ I++G+E+EQ +ID WK +AI+ETE+  A+R+  + SW
Sbjct: 180 EEIEQQVAQEEAEMFGSVFSSSAIDYGVEQEQRVIDVWKQKAIEETELLAARRASPAESW 239

Query: 241 KTDSLEGK 248
             +  EG+
Sbjct: 240 GQEKQEGE 247

>Kpol_1003.40 s1003 complement(97903..98688) [786 bp, 261 aa] {ON}
           complement(97903..98688) [786 nt, 262 aa]
          Length = 261

 Score =  283 bits (724), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 139/259 (53%), Positives = 183/259 (70%), Gaps = 1/259 (0%)

Query: 1   MKIQQNAVNVLERTSAYLQAGMIKKPPVWYDVVAATPPSKKFTREPKFINPSTNKRTVEF 60
           MKIQ+NAVNVLERTSAYL+AG++ K P WY+VVA+ PP KKF R PK  NPS ++   + 
Sbjct: 1   MKIQKNAVNVLERTSAYLRAGLLTKQPAWYNVVASVPPLKKFERVPKLTNPSNDRINGQL 60

Query: 61  KPLKDYLNRTTGLYKTRANSIDKKNAVSSLYKIPKLTYIEDKLRKLFYEQHPWELTRPKI 120
             L D      G++KTR  + D+ NA   LY   KLTYIED+LR++FY+QHPWEL+RPKI
Sbjct: 61  HSL-DSSAGNNGMFKTRYTAKDRSNASKQLYSASKLTYIEDQLREIFYKQHPWELSRPKI 119

Query: 121 VMENHGEVTYDWSRLLQLGKPLDGESVVQRTLFLLKTKEHRKLIDAYNQARFEFYRLRMA 180
           ++EN+G+  YDWS + Q+GKPLDGESVVQRTL+L+K KE   L+ AY+ AR+EFYRLRM 
Sbjct: 120 LIENNGDEKYDWSHMQQIGKPLDGESVVQRTLYLMKNKEAPSLVLAYDMARYEFYRLRMQ 179

Query: 181 XXXXXXXXXXXXXMFGAVFGSTTIEFGIEKEQEMIDSWKVEAIKETEINEAKRSKESVSW 240
                        MFG+VFG + IE+GI+KEQ++ID+WK +AI +TEI  A+R   S SW
Sbjct: 180 QHIEEQVAQEEAEMFGSVFGPSAIEYGIQKEQKVIDTWKRKAIIQTEIMAARRINPSESW 239

Query: 241 KTDSLEGKEDEFNTGDILE 259
            TD  + K+++    D+ E
Sbjct: 240 ATDEKDPKKNDDIEEDVEE 258

>KLLA0E08273g Chr5 (745145..745930) [786 bp, 261 aa] {ON} similar to
           uniprot|P40496 Saccharomyces cerevisiae YIL093C RSM25
           Mitochondrial ribosomal protein of the small subunit
          Length = 261

 Score =  282 bits (721), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 137/247 (55%), Positives = 181/247 (73%), Gaps = 1/247 (0%)

Query: 1   MKIQQNAVNVLERTSAYLQAGMIKKPPVWYDVVAATPPSKKFTREPKFINPSTNKRTVEF 60
           MK+QQ AVNVLERTSAYL++G++KK P WY+V+A  PP+KKF R P+  +P   K     
Sbjct: 1   MKVQQEAVNVLERTSAYLKSGILKKTPAWYNVIAKVPPTKKFARTPQLTHPMNGKSRTAL 60

Query: 61  KPLKDYLNRTTGLYKTRANSIDKKNAVSSLYKIPKLTYIEDKLRKLFYEQHPWELTRPKI 120
               ++   ++GLYKTR NS++KK+  S LY+ PKL YIEDKLRKLF++QHPWEL+RPKI
Sbjct: 61  PDYSNWKANSSGLYKTRPNSLEKKDGASKLYQSPKLVYIEDKLRKLFFQQHPWELSRPKI 120

Query: 121 VMENHGEVT-YDWSRLLQLGKPLDGESVVQRTLFLLKTKEHRKLIDAYNQARFEFYRLRM 179
           ++EN  E   YDWS + QLGKPLDGESVVQRTLFLLK+ E ++LIDAY+QARFEFYRLR+
Sbjct: 121 LVENTLETQEYDWSHIQQLGKPLDGESVVQRTLFLLKSGEKKELIDAYDQARFEFYRLRI 180

Query: 180 AXXXXXXXXXXXXXMFGAVFGSTTIEFGIEKEQEMIDSWKVEAIKETEINEAKRSKESVS 239
                         MFG+VF +T+IE+GI KEQ++ID+WK +A+++ E+  A+ S  S S
Sbjct: 181 QQEIQDQVAQEEAEMFGSVFHTTSIEYGIAKEQKVIDTWKRKALQQAELMAARASSPSAS 240

Query: 240 WKTDSLE 246
           W  ++ E
Sbjct: 241 WTNETEE 247

>TDEL0G02200 Chr7 complement(433032..433817) [786 bp, 261 aa] {ON}
           Anc_2.290 YIL093C
          Length = 261

 Score =  280 bits (716), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 132/259 (50%), Positives = 181/259 (69%), Gaps = 1/259 (0%)

Query: 1   MKIQQNAVNVLERTSAYLQAGMIKKPPVWYDVVAATPPSKKFTREPKFINPSTNKRTVEF 60
           MKIQ NAVNVLERTSAYL++G+++  P WYDVVA+ PP  KFTREP+ INPS  K+    
Sbjct: 1   MKIQTNAVNVLERTSAYLRSGLLRNTPAWYDVVASIPPKTKFTREPRLINPSNMKKLAHL 60

Query: 61  KPLKDYLNRTTGLYKTRANSIDKKNAVSSLYKIPKLTYIEDKLRKLFYEQHPWELTRPKI 120
           K   D  N   G +KTRA+++DKK   + LY+ PKL ++ED+LR++FY+QHPWEL+RPK+
Sbjct: 61  KDHADEPN-AKGFFKTRASTLDKKINNAKLYRAPKLKFVEDQLREVFYKQHPWELSRPKV 119

Query: 121 VMENHGEVTYDWSRLLQLGKPLDGESVVQRTLFLLKTKEHRKLIDAYNQARFEFYRLRMA 180
           ++EN  E  +DWS + QL KPLDGESV+QRTLFLLK  E + L +AY+QARFEFYRLRM 
Sbjct: 120 LVENDAEEEFDWSHIQQLEKPLDGESVIQRTLFLLKNNEGKSLTEAYDQARFEFYRLRMQ 179

Query: 181 XXXXXXXXXXXXXMFGAVFGSTTIEFGIEKEQEMIDSWKVEAIKETEINEAKRSKESVSW 240
                        MFG+++G + I+FG+++EQ+ ID WK +AI+ET++  A+R+  S +W
Sbjct: 180 QEVEQQVAQEESEMFGSIYGPSAIDFGVQQEQKFIDIWKQKAIEETDLLAARRANPSEAW 239

Query: 241 KTDSLEGKEDEFNTGDILE 259
                +  + +    DI E
Sbjct: 240 AAGEEQPDKKDLEDQDIEE 258

>YIL093C Chr9 complement(187990..188784) [795 bp, 264 aa] {ON}
           RSM25Mitochondrial ribosomal protein of the small
           subunit
          Length = 264

 Score =  279 bits (714), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 134/262 (51%), Positives = 187/262 (71%), Gaps = 4/262 (1%)

Query: 1   MKIQQNAVNVLERTSAYLQAGMIKKPPVWYDVVAATPPSKKFTREPKFINPSTNKRTVEF 60
           MKIQ NAVNVL+RTSAYL++G++K+ P WY+VVA+ PPS KFTREP+F NPS      + 
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKETPAWYNVVASIPPSTKFTREPRFKNPSNGHIIGKL 60

Query: 61  KPLKDYLNRTT-GLYKTRANSIDKKNAVSSLYKIPKLTYIEDKLRKLFYEQHPWELTRPK 119
             + +  +    GLYKTR NS DK+  V  LY+ PKLTY+ED+LR LFY+QHPWEL+RPK
Sbjct: 61  VDVTEQPHANNKGLYKTRPNSSDKRVGVKRLYRPPKLTYVEDRLRSLFYKQHPWELSRPK 120

Query: 120 IVMENH-GEVTYDWSRLLQLGKPLDGESVVQRTLFLLKTKEHRKLIDAYNQARFEFYRLR 178
           I++EN  G+  YDWS +LQ+G+PLDGESV+QRT++L+KTK++  +++AY+ AR+EFY LR
Sbjct: 121 ILVENEIGDENYDWSHMLQIGRPLDGESVIQRTMYLIKTKQYGDMVEAYDHARYEFYALR 180

Query: 179 MAXXXXXXXXXXXXXMFGAVFGSTTIEFGIEKEQEMIDSWKVEAIKETEINEAKRSKESV 238
           M              MFG++FG + IE GI+KEQE++D W+ + ++ETE+  A+ S  + 
Sbjct: 181 MQEETEQQVALEEAEMFGSLFGVSAIEHGIQKEQEVLDVWEKKVVEETELMAARTSNPAG 240

Query: 239 SWKTDSL--EGKEDEFNTGDIL 258
           SWK D+     +E+E  T + L
Sbjct: 241 SWKDDTTLNTAQEEESTTSENL 262

>Suva_9.106 Chr9 complement(182086..182880) [795 bp, 264 aa] {ON}
           YIL093C (REAL)
          Length = 264

 Score =  279 bits (713), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 139/257 (54%), Positives = 185/257 (71%), Gaps = 9/257 (3%)

Query: 1   MKIQQNAVNVLERTSAYLQAGMIKKPPVWYDVVAATPPSKKFTREPKFINPSTNKRTVEF 60
           MKIQ NAVNVL+RTSAYL++G++K  P WY+VVA+ PPS KFTREP+F NPS N R +  
Sbjct: 1   MKIQTNAVNVLQRTSAYLKSGLLKDTPAWYNVVASIPPSTKFTREPRFKNPS-NGRII-- 57

Query: 61  KPLKDYLNR----TTGLYKTRANSIDKKNAVSSLYKIPKLTYIEDKLRKLFYEQHPWELT 116
             L D   R      GLYKTR N  D++  V  LYK PKLTY+ED+LR LFY+QHPWEL+
Sbjct: 58  GKLVDVTERQQANANGLYKTRPNPNDRRVGVKKLYKPPKLTYVEDRLRVLFYKQHPWELS 117

Query: 117 RPKIVMENH-GEVTYDWSRLLQLGKPLDGESVVQRTLFLLKTKEHRKLIDAYNQARFEFY 175
           RPKI++EN  G+  YDWS +LQLGK LDGESV+QRT+ LLKT++++ +++AY+ AR+EFY
Sbjct: 118 RPKILVENEVGDENYDWSHMLQLGKVLDGESVIQRTMHLLKTQQYKDMVEAYDHARYEFY 177

Query: 176 RLRMAXXXXXXXXXXXXXMFGAVFGSTTIEFGIEKEQEMIDSWKVEAIKETEINEAKRSK 235
            LRM              MFG++FG ++IE GI+KEQE++D W+ + I+ETE+  A+ S 
Sbjct: 178 ALRMEEETQQQVALEEAEMFGSIFGVSSIEHGIQKEQEVLDVWEKKVIEETELMAARSSN 237

Query: 236 ESVSWKTDS-LEGKEDE 251
            + SWK D+ L+  +DE
Sbjct: 238 PAGSWKDDATLDTAQDE 254

>NDAI0B03540 Chr2 (890148..890933) [786 bp, 261 aa] {ON} Anc_2.290
           YIL093C
          Length = 261

 Score =  276 bits (707), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 133/256 (51%), Positives = 180/256 (70%), Gaps = 1/256 (0%)

Query: 1   MKIQQNAVNVLERTSAYLQAGMIKKPPVWYDVVAATPPSKKFTREPKFINPSTNKRTVEF 60
           MKIQ NAVN++ERTSAYL +G+++  P WYDVVA+ PP+KKFTREPK  NP+T +    F
Sbjct: 1   MKIQTNAVNLVERTSAYLSSGLLQNTPAWYDVVASIPPTKKFTREPKITNPTTGRNKTFF 60

Query: 61  KPLKDYLNRTTGLYKTRANSIDKKNAVSSLYKIPKLTYIEDKLRKLFYEQHPWELTRPKI 120
           K  +  +N   GLYKTR N +D+K++ ++LYK PKL Y+ED+LR LF+EQHPWEL+RPKI
Sbjct: 61  KDDRIRVN-NKGLYKTRMNQMDRKDSANNLYKPPKLIYLEDRLRSLFFEQHPWELSRPKI 119

Query: 121 VMENHGEVTYDWSRLLQLGKPLDGESVVQRTLFLLKTKEHRKLIDAYNQARFEFYRLRMA 180
           ++EN  E  +DWS + Q  K LDGESVVQRTL+LLK +    ++ AYN+ARFEFYRLR+ 
Sbjct: 120 LIENSLEENFDWSHIQQWEKQLDGESVVQRTLYLLKNEPGINMLQAYNKARFEFYRLRIQ 179

Query: 181 XXXXXXXXXXXXXMFGAVFGSTTIEFGIEKEQEMIDSWKVEAIKETEINEAKRSKESVSW 240
                        MFG++F  T+ E GIEKEQ++I+ WK +AI+ET++ E + S  S SW
Sbjct: 180 QDISQQVAQEEAEMFGSIFRQTSFEHGIEKEQKVIEQWKKKAIQETQLMEVRSSNPSDSW 239

Query: 241 KTDSLEGKEDEFNTGD 256
                +  E++F  G+
Sbjct: 240 AAPEEQDLEEDFTEGE 255

>CAGL0D04158g Chr4 complement(410309..411127) [819 bp, 272 aa] {ON}
           similar to uniprot|P40496 Saccharomyces cerevisiae
           YIL093c RSM25
          Length = 272

 Score =  276 bits (705), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 137/238 (57%), Positives = 171/238 (71%), Gaps = 2/238 (0%)

Query: 1   MKIQQNAVNVLERTSAYLQAGMIKKPPVWYDVVAATPPSKKFTREPKFINPSTNKRTVEF 60
           MKIQ NAVNVLERTSAYL+ G+IK+ P WY+VVA+ PP  KFTREP  INPST+K+  E 
Sbjct: 1   MKIQTNAVNVLERTSAYLRTGVIKETPAWYNVVASIPPVTKFTREPHKINPSTDKKVSEL 60

Query: 61  K-PLKDYLNRTTGLYKTRANSIDKKNAVSSLYKIPKLTYIEDKLRKLFYEQHPWELTRPK 119
           K P  + +NR  GLYKTR N++++K A   +YK PKL Y+EDK+R LFY+QHPWEL RPK
Sbjct: 61  KDPDLESVNRN-GLYKTRFNALERKVANKQIYKPPKLVYLEDKIRTLFYKQHPWELARPK 119

Query: 120 IVMENHGEVTYDWSRLLQLGKPLDGESVVQRTLFLLKTKEHRKLIDAYNQARFEFYRLRM 179
           IV EN      DW  +LQLG+PLDGE+VVQRTL+LLKTKE   + DAY+QAR EFYRLRM
Sbjct: 120 IVSENEINTNPDWKNMLQLGQPLDGENVVQRTLYLLKTKEQSNITDAYDQARLEFYRLRM 179

Query: 180 AXXXXXXXXXXXXXMFGAVFGSTTIEFGIEKEQEMIDSWKVEAIKETEINEAKRSKES 237
                         MFG+VFG +TIE G+ KEQ++I+ WK +A  ++E+  AK+   S
Sbjct: 180 QQELEEQVAAEEAEMFGSVFGPSTIEHGVTKEQQVIEKWKRDAELQSELLSAKKENAS 237

>NCAS0B06240 Chr2 (1178232..1179014) [783 bp, 260 aa] {ON} Anc_2.290
           YIL093C
          Length = 260

 Score =  273 bits (699), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 130/240 (54%), Positives = 175/240 (72%), Gaps = 2/240 (0%)

Query: 1   MKIQQNAVNVLERTSAYLQAGMIKKPPVWYDVVAATPPSKKFTREPKFINPSTNKRTVEF 60
           M++Q NA+N++ERTSAYL++G++K  P WY+VVA  PP+KKFTREP+ INPSTN+     
Sbjct: 1   MRVQTNAINIVERTSAYLKSGLLKNTPAWYEVVAKIPPTKKFTREPRLINPSTNEDLAVL 60

Query: 61  KPLKDYLNRTTGLYKTRANSIDKKNAVSSLYKIPKLTYIEDKLRKLFYEQHPWELTRPKI 120
           +  ++ +N+  G YKTR N +D+K   + LYK PKL Y+ED+LR LF++QHPWEL+RPKI
Sbjct: 61  RDNREAVNKK-GFYKTRPNKLDRKVNSNKLYKPPKLQYVEDQLRTLFFDQHPWELSRPKI 119

Query: 121 VMENHGEVTYDWSRLLQLGKPLDGESVVQRTLFLLKTKEHRKLIDAYNQARFEFYRLRMA 180
           ++EN  E  +DWS + QLGKPLDGESVVQRT++LLKT +   +I AYNQARFEFYR R+ 
Sbjct: 120 LVENSLEERFDWSHIQQLGKPLDGESVVQRTMYLLKT-DKMDMITAYNQARFEFYRFRIQ 178

Query: 181 XXXXXXXXXXXXXMFGAVFGSTTIEFGIEKEQEMIDSWKVEAIKETEINEAKRSKESVSW 240
                        MFG+VF  + I+FGIEKEQ++I  WK +A +ETE+  A+R+  S SW
Sbjct: 179 QEVEEQVAQEEAEMFGSVFNQSMIDFGIEKEQKVIQQWKKKAEQETELVAARRANPSDSW 238

>TPHA0C03420 Chr3 complement(750353..751159) [807 bp, 268 aa] {ON}
           Anc_2.290 YIL093C
          Length = 268

 Score =  270 bits (689), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 138/263 (52%), Positives = 187/263 (71%), Gaps = 15/263 (5%)

Query: 1   MKIQQNAVNVLERTSAYLQAGMIKKPPVWYDVVAATPPSKKFTREPKFINPSTNKRTVEF 60
           MKIQQNAVNVLERTS+YL++G++ K P WY+VVA  PPSKKF R PKF NPS NK+  E 
Sbjct: 1   MKIQQNAVNVLERTSSYLRSGLLTKQPAWYNVVAEIPPSKKFERTPKFTNPSNNKKLNEL 60

Query: 61  KPLKDYL---NRTTGLYKTRANSIDKKNAVSSLYKIPKLTYIEDKLRKLFYEQHPWELTR 117
           + + + L      T L+K+R N +DKK++  ++YK  KL+YIED+LR++FY QHPWEL+R
Sbjct: 61  RIIDERLVSDRNGTFLFKSRYNKLDKKSSSKNVYKPAKLSYIEDQLREVFYIQHPWELSR 120

Query: 118 PKIVMENHGEVTYDWSRLLQLGKPLDGESVVQRTLFLLKTKEHRKLIDAYN----QARFE 173
           PKIV+EN+G+ TYDWS + QLGK LDGE+VVQR ++L+K    +KLI  +     +AR+E
Sbjct: 121 PKIVVENNGDETYDWSHIQQLGKALDGENVVQRAMYLMK----KKLIMIFQKHTIKARYE 176

Query: 174 FYRLRMAXXXXXXXXXXXXXMFGAVFGSTTIEFGIEKEQEMIDSWKVEAIKETEINEAKR 233
           FYR+RM              MFG+VFG +TIEFG+++EQ++ID WK +AI ETE+ EAKR
Sbjct: 177 FYRVRMQSEIEEQVAQEEAEMFGSVFGPSTIEFGMDQEQKVIDVWKRKAIAETELMEAKR 236

Query: 234 SKESVSWKTDSLEGKEDEFNTGD 256
           +  S +W  +    KE++ N  D
Sbjct: 237 TNPSETWAQE----KEEDVNYPD 255

>KNAG0A05410 Chr1 (798238..799038) [801 bp, 266 aa] {ON} Anc_2.290
           YIL093C
          Length = 266

 Score =  260 bits (664), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 126/240 (52%), Positives = 167/240 (69%)

Query: 1   MKIQQNAVNVLERTSAYLQAGMIKKPPVWYDVVAATPPSKKFTREPKFINPSTNKRTVEF 60
           MKIQ NAVN+LERTSA+L++G+I+K P WY+VVAA PP KKF R+P F+NPST K  V  
Sbjct: 1   MKIQTNAVNILERTSAFLESGVIQKVPAWYNVVAANPPKKKFERKPIFVNPSTGKARVNL 60

Query: 61  KPLKDYLNRTTGLYKTRANSIDKKNAVSSLYKIPKLTYIEDKLRKLFYEQHPWELTRPKI 120
           K   D       +YKTR +  DK+ + ++LY+ PKL Y+ED+LR+LFY+QHPWE +RP I
Sbjct: 61  KSFLDSKRNAHEIYKTRYSMADKQVSHNALYRPPKLVYLEDQLRQLFYDQHPWERSRPMI 120

Query: 121 VMENHGEVTYDWSRLLQLGKPLDGESVVQRTLFLLKTKEHRKLIDAYNQARFEFYRLRMA 180
           ++EN+    +DWSR+ QLGK LDGESVVQR LFLL+      L  AY++ARFEFYR+RM 
Sbjct: 121 LIENNVTPKFDWSRIQQLGKRLDGESVVQRALFLLEGGHCDSLSTAYDKARFEFYRIRMQ 180

Query: 181 XXXXXXXXXXXXXMFGAVFGSTTIEFGIEKEQEMIDSWKVEAIKETEINEAKRSKESVSW 240
                        M+G+V+  + IEFG+EKE ++I++WK   IKETE   A+R+  S SW
Sbjct: 181 QELEEQISQEEAAMYGSVYTQSAIEFGLEKEGKVIETWKRRVIKETEAMLARRASPSESW 240

>ADL211C Chr4 complement(333418..334095) [678 bp, 225 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL093C
           (RSM25)
          Length = 225

 Score =  237 bits (605), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 139/179 (77%), Gaps = 2/179 (1%)

Query: 1   MKIQQNAVNVLERTSAYLQAGMIKKPPVWYDVVAATPPSKKFTREPKFINPSTNKRTVEF 60
           MKIQ NAVNVL+RTS YLQAG++KK P WY+VVA  PP  KF REPK  +P + K   E 
Sbjct: 1   MKIQTNAVNVLDRTSFYLQAGLLKKTPAWYNVVARIPPVTKFAREPKLHDPVSGKYKGEL 60

Query: 61  KPLKDYLNRTTGLYKTRANSIDKKNAVSSLYKIPKLTYIEDKLRKLFYEQHPWELTRPKI 120
             + D LNR T  YKTRA S D++ A  +++K  KL +IEDKLR LF++QHPWEL+RPK+
Sbjct: 61  DIMTDRLNRNTETYKTRAGSSDRQTA--AVHKPSKLRFIEDKLRSLFFQQHPWELSRPKV 118

Query: 121 VMENHGEVTYDWSRLLQLGKPLDGESVVQRTLFLLKTKEHRKLIDAYNQARFEFYRLRM 179
           ++EN G   YDWSR+LQLGKPLDGESVVQRTL+LLK+  HR+++ AY+QARFEFYRLRM
Sbjct: 119 LVENMGNEQYDWSRMLQLGKPLDGESVVQRTLYLLKSGAHREMLAAYDQARFEFYRLRM 177

>TPHA0E03750 Chr5 (790322..791563) [1242 bp, 413 aa] {ON} Anc_1.36
           YCL037C
          Length = 413

 Score = 31.2 bits (69), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 7/72 (9%)

Query: 100 EDKLRKLFYEQHPWELTRPKIVMENHGEVTYDWSRLLQLGKPLDGESVVQRTLFLLKTKE 159
           E+ LR+ F     WE  +  IV  N  E +Y       + K L G  + Q  +F +K   
Sbjct: 324 ENILRQFFLRGKDWESYKGDIV-NNKEESSY------IIEKELSGNDLDQYMIFNVKGSN 376

Query: 160 HRKLIDAYNQAR 171
           HR+ +DA ++ +
Sbjct: 377 HRRSVDANHEGK 388

>Smik_2.322 Chr2 complement(579730..581073) [1344 bp, 447 aa] {ON}
           YBR182C (REAL)
          Length = 447

 Score = 30.8 bits (68), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 25/108 (23%), Positives = 51/108 (47%), Gaps = 7/108 (6%)

Query: 55  KRTVEFKPLKDYLNRTTGLYKTRANSIDKKNAVSSLYKIPKLTYIEDKLRKLFYEQHPWE 114
           +R +E +P+KD  NRT    K +A    K + +S L ++  +  I       FYE    +
Sbjct: 3   RRKIEIEPIKDDRNRTVTFIKRKAGLFKKAHELSVLCQV-DIAVIILGSNNTFYEYSSVD 61

Query: 115 LTRPKIVMENHGEVTYDWSRLLQLGKPLDGESVVQRTLFLLKTKEHRK 162
           ++    V +N+ E+ ++      + +P D    V++   +L  ++ R+
Sbjct: 62  MSNLITVHQNNSELPHN------IIEPSDYGDYVKKPRIVLNERKRRR 103

>Skud_2.308 Chr2 complement(560833..562191) [1359 bp, 452 aa] {ON}
           YBR182C (REAL)
          Length = 452

 Score = 29.6 bits (65), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 19/77 (24%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 55  KRTVEFKPLKDYLNRTTGLYKTRANSIDKKNAVSSLYKIPKLTYIEDKLRKLFYEQHPWE 114
           +R +E +P+KD  NRT    K +A    K + +S L ++  +  I       FYE    +
Sbjct: 3   RRKIEIEPIKDDRNRTVTFIKRKAGLFKKAHELSVLCQV-DIAVIILGSNNTFYEYSSVD 61

Query: 115 LTRPKIVMENHGEVTYD 131
           ++    V +N+ ++ ++
Sbjct: 62  MSNLITVHQNNADLPHN 78

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 27,520,254
Number of extensions: 1136097
Number of successful extensions: 3341
Number of sequences better than 10.0: 35
Number of HSP's gapped: 3397
Number of HSP's successfully gapped: 35
Length of query: 266
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 158
Effective length of database: 41,097,471
Effective search space: 6493400418
Effective search space used: 6493400418
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 65 (29.6 bits)