Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0B059502.288ON99599547290.0
NDAI0G006702.288ON96892428540.0
Skud_14.3062.288ON97098127550.0
NCAS0G037802.288ON95793127510.0
Suva_14.3242.288ON96895927460.0
YNL023C (FAP1)2.288ON96594027260.0
Smik_14.3082.288ON96595126900.0
KAFR0H033002.288ON96699226710.0
TDEL0G021902.288ON93694826420.0
KNAG0H019902.288ON97393226400.0
CAGL0M06919g2.288ON95691425220.0
ZYRO0A01936g2.288ON95390225080.0
Kpol_1039.452.288ON96891224660.0
SAKL0E07634g2.288ON97492424480.0
KLTH0G10406g2.288ON96390924300.0
TPHA0D015302.288ON96293223770.0
Kwal_27.115182.288ON95392823010.0
Ecym_33272.288ON92690121670.0
KLLA0E08317g2.288ON92189921430.0
ADL213W2.288ON90890120960.0
KLLA0E00551g4.7ON24284860.10
TPHA0E011805.339ON32383716.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0B05950
         (995 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0B05950 Chr2 (1404509..1407496) [2988 bp, 995 aa] {ON} Anc_2...  1826   0.0  
NDAI0G00670 Chr7 (146574..149480) [2907 bp, 968 aa] {ON} Anc_2.2...  1103   0.0  
Skud_14.306 Chr14 complement(558943..561855) [2913 bp, 970 aa] {...  1065   0.0  
NCAS0G03780 Chr7 complement(696877..699750) [2874 bp, 957 aa] {O...  1064   0.0  
Suva_14.324 Chr14 complement(571146..574052) [2907 bp, 968 aa] {...  1062   0.0  
YNL023C Chr14 complement(588263..591160) [2898 bp, 965 aa] {ON} ...  1054   0.0  
Smik_14.308 Chr14 complement(550650..553547) [2898 bp, 965 aa] {...  1040   0.0  
KAFR0H03300 Chr8 complement(627520..630420) [2901 bp, 966 aa] {O...  1033   0.0  
TDEL0G02190 Chr7 (430157..432967) [2811 bp, 936 aa] {ON} Anc_2.2...  1022   0.0  
KNAG0H01990 Chr8 complement(349855..352776) [2922 bp, 973 aa] {O...  1021   0.0  
CAGL0M06919g Chr13 complement(703702..706572) [2871 bp, 956 aa] ...   976   0.0  
ZYRO0A01936g Chr1 (159749..162610) [2862 bp, 953 aa] {ON} simila...   970   0.0  
Kpol_1039.45 s1039 (135833..138739) [2907 bp, 968 aa] {ON} (1358...   954   0.0  
SAKL0E07634g Chr5 complement(616444..619368) [2925 bp, 974 aa] {...   947   0.0  
KLTH0G10406g Chr7 (880042..882933) [2892 bp, 963 aa] {ON} simila...   940   0.0  
TPHA0D01530 Chr4 complement(313063..315951) [2889 bp, 962 aa] {O...   920   0.0  
Kwal_27.11518 s27 complement(832986..835847) [2862 bp, 953 aa] {...   890   0.0  
Ecym_3327 Chr3 (626396..629176) [2781 bp, 926 aa] {ON} similar t...   839   0.0  
KLLA0E08317g Chr5 complement(747272..750037) [2766 bp, 921 aa] {...   830   0.0  
ADL213W Chr4 (329646..332372) [2727 bp, 908 aa] {ON} Syntenic ho...   811   0.0  
KLLA0E00551g Chr5 complement(45755..46483) [729 bp, 242 aa] {ON}...    38   0.10 
TPHA0E01180 Chr5 (240374..241345) [972 bp, 323 aa] {ON} Anc_5.33...    32   6.9  

>TBLA0B05950 Chr2 (1404509..1407496) [2988 bp, 995 aa] {ON}
           Anc_2.288 YNL023C
          Length = 995

 Score = 1826 bits (4729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 908/995 (91%), Positives = 908/995 (91%)

Query: 1   MVQDKEQEQDQETINKQQSSNGKLFKGHSLVLEFXXXXXXXXXXXXXXXXXXXEDESDVD 60
           MVQDKEQEQDQETINKQQSSNGKLFKGHSLVLEF                   EDESDVD
Sbjct: 1   MVQDKEQEQDQETINKQQSSNGKLFKGHSLVLEFSDDDASDSGSDNNSDLSRDEDESDVD 60

Query: 61  TDNEYEEDLMYYERAVREIAKGDSYQCMICTVEMDHTCKMYACRHCYRVFDYDCIREWAL 120
           TDNEYEEDLMYYERAVREIAKGDSYQCMICTVEMDHTCKMYACRHCYRVFDYDCIREWAL
Sbjct: 61  TDNEYEEDLMYYERAVREIAKGDSYQCMICTVEMDHTCKMYACRHCYRVFDYDCIREWAL 120

Query: 121 KSTQKTVDKTWKCPNCYHSSKKVPLKDRPTCWCGKVVXXXXXXXXXXSCGQTCNANICPH 180
           KSTQKTVDKTWKCPNCYHSSKKVPLKDRPTCWCGKVV          SCGQTCNANICPH
Sbjct: 121 KSTQKTVDKTWKCPNCYHSSKKVPLKDRPTCWCGKVVNPDPNPLDPNSCGQTCNANICPH 180

Query: 181 KCLKQCHLGSHPECTQLLKITCRCGRETKDIYCHESRRQKSIFHCDQECGLTLPCGIHKC 240
           KCLKQCHLGSHPECTQLLKITCRCGRETKDIYCHESRRQKSIFHCDQECGLTLPCGIHKC
Sbjct: 181 KCLKQCHLGSHPECTQLLKITCRCGRETKDIYCHESRRQKSIFHCDQECGLTLPCGIHKC 240

Query: 241 RRKCHSGLCGSCPELLIDENVSGKIKCYCGLHSLKEMNCKDVAFPSSGKISRNQEDKEWV 300
           RRKCHSGLCGSCPELLIDENVSGKIKCYCGLHSLKEMNCKDVAFPSSGKISRNQEDKEWV
Sbjct: 241 RRKCHSGLCGSCPELLIDENVSGKIKCYCGLHSLKEMNCKDVAFPSSGKISRNQEDKEWV 300

Query: 301 GIFDCKEMRSVSYTCNEHVFVEGCIAPPTLPSTVVCPFSPNLLKTCPCGKTALQDMDCER 360
           GIFDCKEMRSVSYTCNEHVFVEGCIAPPTLPSTVVCPFSPNLLKTCPCGKTALQDMDCER
Sbjct: 301 GIFDCKEMRSVSYTCNEHVFVEGCIAPPTLPSTVVCPFSPNLLKTCPCGKTALQDMDCER 360

Query: 361 TKCTDPIPTCDNVCNKILKCGKHRCPFTCHTGKCMDPCIQIDKMDCACERRTFLVPCQFK 420
           TKCTDPIPTCDNVCNKILKCGKHRCPFTCHTGKCMDPCIQIDKMDCACERRTFLVPCQFK
Sbjct: 361 TKCTDPIPTCDNVCNKILKCGKHRCPFTCHTGKCMDPCIQIDKMDCACERRTFLVPCQFK 420

Query: 421 GKPVCKFKCESLMSCRRHRCMEYCCSGRPYAERRKKTILRSSDRNDETLVEAEHVCLKDC 480
           GKPVCKFKCESLMSCRRHRCMEYCCSGRPYAERRKKTILRSSDRNDETLVEAEHVCLKDC
Sbjct: 421 GKPVCKFKCESLMSCRRHRCMEYCCSGRPYAERRKKTILRSSDRNDETLVEAEHVCLKDC 480

Query: 481 NLKLSCGIHTCQRKCHPGPCPPCLESDSNDLVCPCGKTVIPAPVRCGTTLPPCKYPCIKV 540
           NLKLSCGIHTCQRKCHPGPCPPCLESDSNDLVCPCGKTVIPAPVRCGTTLPPCKYPCIKV
Sbjct: 481 NLKLSCGIHTCQRKCHPGPCPPCLESDSNDLVCPCGKTVIPAPVRCGTTLPPCKYPCIKV 540

Query: 541 IRGESDCGHKPMPHSCHSLDQPCPVCTAPVFKPCKCGKKDKVRTMCFQEDVSCGLPCGLP 600
           IRGESDCGHKPMPHSCHSLDQPCPVCTAPVFKPCKCGKKDKVRTMCFQEDVSCGLPCGLP
Sbjct: 541 IRGESDCGHKPMPHSCHSLDQPCPVCTAPVFKPCKCGKKDKVRTMCFQEDVSCGLPCGLP 600

Query: 601 LKDCYHKCQKRCHLPGECQNTCIQICNAKRSNCSHGCTQRCHKNAXXXXXXXXXXXXXXX 660
           LKDCYHKCQKRCHLPGECQNTCIQICNAKRSNCSHGCTQRCHKNA               
Sbjct: 601 LKDCYHKCQKRCHLPGECQNTCIQICNAKRSNCSHGCTQRCHKNAPCPDIPCTVPVTVVC 660

Query: 661 XXGRRKLVKPCXXXXXXXXXXXXXHLECDXXXXXXXXXXXXKAAFGIVNGLGDDKTSVAI 720
             GRRKLVKPC             HLECD            KAAFGIVNGLGDDKTSVAI
Sbjct: 661 DCGRRKLVKPCSSTSTIDSVTITSHLECDEECMLLLRRMELKAAFGIVNGLGDDKTSVAI 720

Query: 721 ERIQNRISVAKAYEELELPFVEAVLTVYAKQPKWCSQIEGILNKFMDEKLKSSLHFKHMK 780
           ERIQNRISVAKAYEELELPFVEAVLTVYAKQPKWCSQIEGILNKFMDEKLKSSLHFKHMK
Sbjct: 721 ERIQNRISVAKAYEELELPFVEAVLTVYAKQPKWCSQIEGILNKFMDEKLKSSLHFKHMK 780

Query: 781 APQRSFVHNLADAYKIYSESQDPEPVRSVFVKKLTNGTSSKPILTLEEALPLYXXXXXXX 840
           APQRSFVHNLADAYKIYSESQDPEPVRSVFVKKLTNGTSSKPILTLEEALPLY       
Sbjct: 781 APQRSFVHNLADAYKIYSESQDPEPVRSVFVKKLTNGTSSKPILTLEEALPLYESFKEVQ 840

Query: 841 XXXXXXXXXARTHKTLINVEAETQTQQSATKYNGFLIKNLVKGTTEEDLERIFGESLKPT 900
                    ARTHKTLINVEAETQTQQSATKYNGFLIKNLVKGTTEEDLERIFGESLKPT
Sbjct: 841 KEKKKQEYEARTHKTLINVEAETQTQQSATKYNGFLIKNLVKGTTEEDLERIFGESLKPT 900

Query: 901 LVKDPQYLVMDESHHGFICPADYAEISINVERDMEQLIGFFDSLCKEHFIGDIVELCNID 960
           LVKDPQYLVMDESHHGFICPADYAEISINVERDMEQLIGFFDSLCKEHFIGDIVELCNID
Sbjct: 901 LVKDPQYLVMDESHHGFICPADYAEISINVERDMEQLIGFFDSLCKEHFIGDIVELCNID 960

Query: 961 EALLQENVDLEDSEEEKLTSPEVENDSDIHDSPKN 995
           EALLQENVDLEDSEEEKLTSPEVENDSDIHDSPKN
Sbjct: 961 EALLQENVDLEDSEEEKLTSPEVENDSDIHDSPKN 995

>NDAI0G00670 Chr7 (146574..149480) [2907 bp, 968 aa] {ON} Anc_2.288
           YNL023C
          Length = 968

 Score = 1103 bits (2854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/924 (58%), Positives = 650/924 (70%), Gaps = 13/924 (1%)

Query: 55  DESDVDTDNEY------EEDLMYYERAVREIAKGDSYQCMICTVEMDHTCKMYACRHCYR 108
           D  + D ++EY      +ED+ YYER ++EIAKGDSY CMICTVEMD+TC+MYAC+ CYR
Sbjct: 38  DNDEYDQEDEYAAATAADEDMKYYERTIQEIAKGDSYVCMICTVEMDYTCQMYACKECYR 97

Query: 109 VFDYDCIREWALKSTQKTVDKTWKCPNCYHSSKKVPLKDRPTCWCGKVVXXXXXXXXXXS 168
           VFDYDCIREWA+KST+KTVD+ WKCPNCYH +KKVP K+R TCWCGKVV          S
Sbjct: 98  VFDYDCIREWAVKSTEKTVDRIWKCPNCYHVNKKVPPKNRSTCWCGKVVNPEANPLNPNS 157

Query: 169 CGQTCNANICPHKCLKQCHLGSHPECTQLLKITCRCGRETKDIYCHESRRQK--SIFHCD 226
           CGQTCNA IC H C   CHLG HPECT++L ITCRCG+ TKDI+C++S+  K  S F C 
Sbjct: 158 CGQTCNAKICVHGCTNICHLGPHPECTRMLSITCRCGKHTKDIFCYQSKTFKGNSKFQCK 217

Query: 227 QECGLTLPCGIHKCRRKCHSGLCGSCPELL-IDENVSGKIKCYCGLHSLKEMNCKDVAFP 285
            ECGL L CGIHKC+RKCHSGLCG CPE L ++E  +  +KCYCG  + K M CKD+  P
Sbjct: 218 DECGLPLSCGIHKCKRKCHSGLCGVCPERLEVNEENAWILKCYCGSETQKSMKCKDIKIP 277

Query: 286 SSGKISRNQEDKEWVGIFDCKEMRSVSYTCNEHVFVEGCIAPPTLPSTVVCPFSPNLLKT 345
            S K S + E  +W+G+F CKE+R+V Y C++H F+E CIAPPTL     CP+SP LLKT
Sbjct: 278 ESAKYSSDAEGNKWIGVFACKEIRTVQYDCDKHSFIERCIAPPTLSMEKPCPYSPKLLKT 337

Query: 346 CPCGKTALQDMDCERTKCTDPIPTCDNVCNKILKCGKHRCPFTCHTGKCMDPCIQIDKMD 405
           CPCGKT LQ +   RT CTDPIPTC++ CNK LKCGKH+CPF CHTG CMDPC+QI+   
Sbjct: 338 CPCGKTPLQKLAKPRTLCTDPIPTCESHCNKPLKCGKHKCPFKCHTGACMDPCLQIETRK 397

Query: 406 CACERRTFLVPCQFKGKPVCKFKCESLMSCRRHRCMEYCCSGRPYAERRKKTILRSSDRN 465
           C+CE+++FLVPCQF G P C  KCESLMSCRRHRC+E CCSGRP AE+RKKT+ RS D  
Sbjct: 398 CSCEQQSFLVPCQFTGSPHCNIKCESLMSCRRHRCLERCCSGRPAAEKRKKTLFRSQDLM 457

Query: 466 DETLVEAEHVCLKDCNLKLSCGIHTCQRKCHPGPCPPCLESDSNDLVCPCGKTVIPAPVR 525
           DETLVEAEH+CLK+CNL LSCGIH CQRKCHPG CPPCLESDSNDLVCPCGKT++ APVR
Sbjct: 458 DETLVEAEHICLKECNLLLSCGIHRCQRKCHPGKCPPCLESDSNDLVCPCGKTIVEAPVR 517

Query: 526 CGTTLPPCKYPCIKVIRGESDCGHKPMPHSCHSLDQPCPVCTAPVFKPCKCGKKDKVRTM 585
           CGT LPPC + CIKV+R E  CGH PMPH+CH LD+PCP CTAPVFKPCKCGK  +VRT+
Sbjct: 518 CGTKLPPCPFQCIKVVRNEYPCGHTPMPHTCHPLDEPCPPCTAPVFKPCKCGKVKEVRTL 577

Query: 586 CFQEDVSCGLPCGLPLKDCYHKCQKRCHLPGECQNTCIQICNAKRSNCSHGCTQRCHKNA 645
           CFQ DVSCG  CGLPLKDC HKC KRCH+PG+CQ  C QIC  +R NC H C++ CH N 
Sbjct: 578 CFQNDVSCGKICGLPLKDCPHKCMKRCHIPGDCQTKCKQICGKRRINCDHTCSRPCHGNT 637

Query: 646 XXXXXXXXXXXXXXXXXGRRKLVKPCXXXXXXXXXXXXXHLECDXXXXXXXXXXXXKAAF 705
                            GRR+    C              LECD            K AF
Sbjct: 638 ECPDVPCTVSAKVTCECGRRETYVTCGAMSNIASAVTTTILECDEECEMLERHRQLKEAF 697

Query: 706 GIVNGLGDDKTSVAIERIQNRISVAKAYEELELPFVEAVLTVYAKQPKWCSQIEGILNKF 765
           GI   +    T +  ER+++ +  A A+EEL+LPF EA L+++++Q +WC QIE I+NKF
Sbjct: 698 GIKEIISSS-TDLEFERLKDIVPTAIAFEELQLPFTEATLSIFSRQERWCQQIEEIINKF 756

Query: 766 MDEKLKSSLHFKHMKAPQRSFVHNLADAYKIYSESQDPEPVRSVFVKKLTNGTSSKPILT 825
           MD+K + SLHFK M+ PQR F+H L+ AY +Y ESQDPEP RSVF+KK  N TSSKP  +
Sbjct: 757 MDDKSRPSLHFKPMRPPQRHFIHELSKAYNLYCESQDPEPKRSVFIKK--NTTSSKPSFS 814

Query: 826 LEEALPLYXXXXXXXXXXXXXXXXARTHKTLINVEA-ETQTQQSATKYNGFLIKNLVKGT 884
           L + LPLY                ART K L+NVE  E  T     + NGFLIK+L  GT
Sbjct: 815 LSKVLPLYQTFKELEKERKLQEFEARTSKRLVNVEVPEGPTDNYIAEANGFLIKDLSPGT 874

Query: 885 TEEDLERIFGESLKPTLVKDPQYLVMDESHHGFICPADYAEISINVERDMEQLIGFFDSL 944
           T EDLERIFG+ LK TL+K+PQYLV+ +   G I P DY  I+ NVERD + L+G FD L
Sbjct: 875 TVEDLERIFGQYLKSTLIKNPQYLVLQDGKSGVIYPEDYPTITANVERDFKSLVGHFDVL 934

Query: 945 CKEHFIGDIVELCNIDEALLQENV 968
            K+ FI + VELC ID+ L  E +
Sbjct: 935 AKDTFISEGVELCKIDDVLSTERL 958

>Skud_14.306 Chr14 complement(558943..561855) [2913 bp, 970 aa] {ON}
           YNL023C (REAL)
          Length = 970

 Score = 1065 bits (2755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 522/981 (53%), Positives = 661/981 (67%), Gaps = 27/981 (2%)

Query: 4   DKEQEQDQETINKQQSSNGKLFKGHSLVLEFXXXXXXXXXXXXXXXXXXXEDESDVDTDN 63
           D EQ+Q+   I+K  S    L  GH L +E                    E  S  + + 
Sbjct: 11  DLEQDQNGGGIHKHHS----LSNGHVLSVE-----------------DSSEQLSSYEFEE 49

Query: 64  EYEEDLMYYERAVREIAKGDSYQCMICTVEMDHTCKMYACRHCYRVFDYDCIREWALKST 123
           E ++DL YYERA++EIAKGDSY CMICTVEMD+TC+M+AC+ CYRVFDY CIREWALKST
Sbjct: 50  ESDDDLQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKST 109

Query: 124 QKTVDKTWKCPNCYHSSKKVPLKDRPTCWCGKVVXXXXXXXXXXSCGQTCNANICPHKCL 183
           +KTVDK WKCPNCYH  KKVP ++RPTCWCG VV          SCGQTCNA  C H C 
Sbjct: 110 EKTVDKIWKCPNCYHVGKKVPTRNRPTCWCGNVVNPDPNQLDPNSCGQTCNAPTCVHGCF 169

Query: 184 KQCHLGSHPECTQLLKITCRCGRETKDIYCHESRRQKSIFHCDQECGLTLPCGIHKCRRK 243
           K CHLG HPECT++++I C CGR +K I+C++S+  +  F+C +ECGL+L CG+HKC++K
Sbjct: 170 KICHLGPHPECTRMVEIKCHCGRHSKTIFCYQSKAMRRRFNCQEECGLSLSCGVHKCKKK 229

Query: 244 CHSGLCGSCPELLIDENVSGK-IKCYCGLHSLKEMNCKDVAFPSSGKISRNQEDKEWVGI 302
           CHSGLCGSCPE +I+++ S K IKCYCG H    + C +  FP SG+ S+++   EW G+
Sbjct: 230 CHSGLCGSCPEFIINDDSSKKQIKCYCGNHIQNSIKCSEARFPKSGRTSKDESGNEWAGV 289

Query: 303 FDCKEMRSVSYTCNEHVFVEGCIAPPTLPSTVVCPFSPNLLKTCPCGKTALQDMDCERTK 362
           F C ++R+V Y C++H F+E C++PPT+     CPF P+LLKTCPCG+TAL+++   R  
Sbjct: 290 FACADIRTVDYACHKHSFIEPCLSPPTISGQKTCPFLPSLLKTCPCGRTALEELTKPRKH 349

Query: 363 CTDPIPTCDNVCNKILKCGKHRCPFTCHTGKCMDPCIQIDKMDCACERRTFLVPCQFKGK 422
           C DPIPTC++ C+K LKCGKH CPFTCH G CMDPC+QID  +C+CE+ TF +PC F+  
Sbjct: 350 CHDPIPTCNSRCSKPLKCGKHLCPFTCHDGACMDPCLQIDSANCSCEQSTFSIPCGFQES 409

Query: 423 PVCKFKCESLMSCRRHRCMEYCCSGRPYAERRKKTILRSSDRNDETLVEAEHVCLKDCNL 482
           P C  KCESLMSCRRHRC++ CCSGRP A RRKK+  RS D  DE+LVEA+H+CLK CNL
Sbjct: 410 PRCNIKCESLMSCRRHRCIDRCCSGRPSAIRRKKSFFRSQDLLDESLVEAKHICLKPCNL 469

Query: 483 KLSCGIHTCQRKCHPGPCPPCLESDSNDLVCPCGKTVIPAPVRCGTTLPPCKYPCIKVIR 542
            LSCG+H CQRKCHPG CPPCLESDSNDL+C CGKTV+PAPVRCGT LP C +PCIKV+R
Sbjct: 470 TLSCGLHKCQRKCHPGKCPPCLESDSNDLICACGKTVVPAPVRCGTKLPTCNHPCIKVVR 529

Query: 543 GESDCGHKPMPHSCHSLDQPCPVCTAPVFKPCKCGKKDKVRTMCFQEDVSCGLPCGLPLK 602
           GES CGHKPMPH+CH  +  CP CT  VFKPC+CGKKDKVRT+CFQ DVSCG  CG+PL 
Sbjct: 530 GESWCGHKPMPHTCHPSNISCPPCTETVFKPCRCGKKDKVRTVCFQADVSCGTSCGIPLS 589

Query: 603 DCYHKCQKRCHLPGECQNTCIQICNAKRSNCSHGCTQRCHKNAXXXXXXXXXXXXXXXXX 662
            CYH CQK CHL G+CQ  C QIC  KR +C H C + CH                    
Sbjct: 590 GCYHTCQKTCHLLGKCQKVCKQICGQKRLDCIHTCPKPCHGKTECPDLPCAALVKITCEC 649

Query: 663 GRRKLVKPCXXXXXXXXXXXXXHLECDXXXXXXXXXXXXKAAFGIVNGLGDDKTSVAIER 722
           GR K    C              L+C+            + AFG+  G  ++     ++ 
Sbjct: 650 GRIKKSITCSAKRDTVSVITSSILDCNEECETLKRLKELREAFGVSEG-PNNVIRNELDA 708

Query: 723 IQNRISVAKAYEELELPFVEAVLTVYAKQPKWCSQIEGILNKFMDEKLKSSLHFKHMKAP 782
           +   +SVAK +EEL+LPF EA L+VY+KQ +WC QIEGILNK MD +++SSLHFK M+ P
Sbjct: 709 LSELVSVAKTFEELQLPFTEATLSVYSKQERWCLQIEGILNKLMDSEIRSSLHFKPMRPP 768

Query: 783 QRSFVHNLADAYKIYSESQDPEPVRSVFVKKLTNGTSSKPILTLEEALPLYXXXXXXXXX 842
           QR F+H +A AY +Y+ESQD EP+RSVF+KK  N TS KP+L+L EA PLY         
Sbjct: 769 QRHFIHEMAKAYNLYAESQDREPMRSVFIKKEDNCTSKKPVLSLAEAYPLYESFKQSQKE 828

Query: 843 XXXXXXXARTHKTLINVEAE-TQTQQSATKYNGFLIKNLVKGTTEEDLERIFGESLKPTL 901
                  ART   LIN E +  +++  A K NGFL++NLV G T EDL+R F   LK TL
Sbjct: 829 RKLQEFQARTTAKLINFEVQDAESKIEAAKNNGFLVQNLVSGNTVEDLKRFFEPHLKHTL 888

Query: 902 VKDPQYLVMDESHHGFICPADYAEISINVERDMEQLIGFFDSLCKEHFIGDIVELCNIDE 961
           V +PQYL++D+S    I P +Y   S+N ERDME L+G FD + KE F+ D + LC++DE
Sbjct: 889 VANPQYLILDDSRSALIYPENYETASVNTERDMELLVGHFDFMAKEAFLADSIHLCSVDE 948

Query: 962 ALLQENVDLEDSEEEKLTSPE 982
            + +    L+    ++++SPE
Sbjct: 949 EIGKR---LDSPAIQEVSSPE 966

>NCAS0G03780 Chr7 complement(696877..699750) [2874 bp, 957 aa] {ON} 
          Length = 957

 Score = 1064 bits (2751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 528/931 (56%), Positives = 645/931 (69%), Gaps = 13/931 (1%)

Query: 56  ESDVDTDNEYEED--------LMYYERAVREIAKGDSYQCMICTVEMDHTCKMYACRHCY 107
           ES     +EYE D        + YYERA++EIAKGDSY CMICTVEMD+TC+MYAC+ CY
Sbjct: 29  ESGNSDSSEYESDFAGMDDDAMHYYERAIQEIAKGDSYVCMICTVEMDYTCQMYACKQCY 88

Query: 108 RVFDYDCIREWALKSTQKTVDKTWKCPNCYHSSKKVPLKDRPTCWCGKVVXXXXXXXXXX 167
           RVFDY+CIREWALKST+KTVD+ WKCPNCYH +KKVP K+RPTCWCGKVV          
Sbjct: 89  RVFDYECIREWALKSTEKTVDRIWKCPNCYHVNKKVPPKNRPTCWCGKVVNPEPNPLNPN 148

Query: 168 SCGQTCNANICPHKCLKQCHLGSHPECTQLLKITCRCGRETKDIYCHESR--RQKSIFHC 225
           SCGQTCNA+ C H C K CHLG HPECT+++ I CRCG+ TKDI C++S   R K  F C
Sbjct: 149 SCGQTCNAHTCVHGCSKICHLGPHPECTRIITIKCRCGKHTKDISCYQSSLLRGKDKFQC 208

Query: 226 DQECGLTLPCGIHKCRRKCHSGLCGSCPELL-IDENVSGKIKCYCGLHSLKEMNCKDVAF 284
           D+ CGL L CG+H+C++KCHSGLCG CPE+L   E +   I+CYCG      + C+DV  
Sbjct: 209 DEPCGLPLACGLHRCQKKCHSGLCGICPEILNTKEYLDAHIRCYCGSQDRDTIKCRDVHV 268

Query: 285 PSSGKISRNQEDKEWVGIFDCKEMRSVSYTCNEHVFVEGCIAPPTLPSTVVCPFSPNLLK 344
           P S  +S+N + ++WVG+F C  +R+V Y C+EH FVE CIAPPT+  T  CPFSP LLK
Sbjct: 269 PLSASLSQNLKGEKWVGVFKCDNIRNVDYKCHEHSFVEQCIAPPTIDGTKPCPFSPKLLK 328

Query: 345 TCPCGKTALQDMDCERTKCTDPIPTCDNVCNKILKCGKHRCPFTCHTGKCMDPCIQIDKM 404
           TCPCGKT L+++   R KCTDPIPTCD+ C K LKCG+H CPF CH G CMDPC+QIDK 
Sbjct: 329 TCPCGKTPLKELVESRKKCTDPIPTCDSRCGKPLKCGRHTCPFICHVGPCMDPCLQIDKK 388

Query: 405 DCACERRTFLVPCQFKGKPVCKFKCESLMSCRRHRCMEYCCSGRPYAERRKKTILRSSDR 464
            C+C +++FLVPCQF   P C  KCESLMSCRRHRC E CC+GRP AE RKK + RS D 
Sbjct: 389 KCSCNQQSFLVPCQFHQDPQCTTKCESLMSCRRHRCTERCCAGRPRAEARKKRLFRSQDL 448

Query: 465 NDETLVEAEHVCLKDCNLKLSCGIHTCQRKCHPGPCPPCLESDSNDLVCPCGKTVIPAPV 524
            DE+LVE +H+CLK+CNL LSCG H CQRKCHPG CPPCLESDSNDLVCPCG+T+I APV
Sbjct: 449 MDESLVEPQHICLKECNLMLSCGKHKCQRKCHPGKCPPCLESDSNDLVCPCGRTIIEAPV 508

Query: 525 RCGTTLPPCKYPCIKVIRGESDCGHKPMPHSCHSLDQPCPVCTAPVFKPCKCGKKDKVRT 584
           RCGT LPPC YPCIKV+RGE  CGH PMPH+CH L++PCP CTA VFKPCKCGK DKVRT
Sbjct: 509 RCGTKLPPCPYPCIKVVRGEYPCGHTPMPHTCHPLNEPCPPCTASVFKPCKCGKVDKVRT 568

Query: 585 MCFQEDVSCGLPCGLPLKDCYHKCQKRCHLPGECQNTCIQICNAKRSNCSHGCTQRCHKN 644
           +CFQ DVSCG  CGLPL++C H CQKRCHL GECQ TC QIC  KR NC H C + CH  
Sbjct: 569 LCFQNDVSCGKICGLPLENCNHTCQKRCHLLGECQKTCKQICKKKRINCEHTCLKPCHGK 628

Query: 645 AXXXXXXXXXXXXXXXXXGRRKLVKPCXXXXXXXXXXXXXHLECDXXXXXXXXXXXXKAA 704
                             GR++    C             H+ECD            K A
Sbjct: 629 TDCPDIPCSVSIKITCECGRKETYVTCGATSTIPSAATKTHIECDEECELLERHRQLKEA 688

Query: 705 FGIVNGLGDDKTSVAIERIQNRISVAKAYEELELPFVEAVLTVYAKQPKWCSQIEGILNK 764
           FGIV+   +  TS+ +E++++   VA  +EEL+LP+ E  L++YAKQ KWC QIE ILNK
Sbjct: 689 FGIVD--SNRSTSLEVEKLKDLAKVATTFEELQLPYNETTLSIYAKQEKWCDQIEEILNK 746

Query: 765 FMDEKLKSSLHFKHMKAPQRSFVHNLADAYKIYSESQDPEPVRSVFVKKLTNGTSSKPIL 824
            MD+K + SLHFK M+ PQR F+   A ++ +Y+E+QD EP RSVFVKK  +G+SSKPI+
Sbjct: 747 LMDDKARPSLHFKPMRPPQRHFIQEFAKSFNLYAEAQDREPKRSVFVKKEEDGSSSKPII 806

Query: 825 TLEEALPLYXXXXXXXXXXXXXXXXARTHKTLINVEAETQTQQSATKYNGFLIKNLVKGT 884
           +L +ALPLY                ART   LINVEA  +      KY+GFLIK +  GT
Sbjct: 807 SLHDALPLYQTFKELEKERKLKEFEARTTTRLINVEAPQEDNVYHAKYSGFLIKKISPGT 866

Query: 885 TEEDLERIFGESLKPTLVKDPQYLVMDESHHGFICPADYAEISINVERDMEQLIGFFDSL 944
           T EDL+RIFG+ L  TL+ +PQYL++ +     I P +Y E+S  VERD+E L+G FD +
Sbjct: 867 TVEDLQRIFGQFLTSTLIVNPQYLIIQDGKDALIYPENYQEMSAGVERDLETLVGHFDFI 926

Query: 945 CKEHFIGDIVELCNIDEALLQENVDLEDSEE 975
            KE+FI D VELC+++ A+L E ++    EE
Sbjct: 927 SKENFIADGVELCDVEVAMLGERLETPILEE 957

>Suva_14.324 Chr14 complement(571146..574052) [2907 bp, 968 aa] {ON}
           YNL023C (REAL)
          Length = 968

 Score = 1062 bits (2746), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/959 (54%), Positives = 645/959 (67%), Gaps = 14/959 (1%)

Query: 7   QEQDQETINKQQSSNGKLFKGHSLVLEFXXXXXXXXXXXXXXXXXXXEDESDVDTDNEYE 66
           Q  ++E+++ +QS NG     H L  E                    E  S  D++ E +
Sbjct: 3   QTNERESLDLEQSQNGSDVHEHCLNDEHVSGVEVSH-----------EQSSTYDSEEESD 51

Query: 67  EDLMYYERAVREIAKGDSYQCMICTVEMDHTCKMYACRHCYRVFDYDCIREWALKSTQKT 126
           +D+ YYERA++EIAKGDSY CMICTVEMD+TC+M+AC+ CYRVFDY CIREWALKST+KT
Sbjct: 52  DDMQYYERAIQEIAKGDSYICMICTVEMDYTCQMFACKKCYRVFDYACIREWALKSTEKT 111

Query: 127 VDKTWKCPNCYHSSKKVPLKDRPTCWCGKVVXXXXXXXXXXSCGQTCNANICPHKCLKQC 186
           VDK WKCPNCYH  KKVP ++RPTCWCGKVV          SCGQTCNA  C H C K C
Sbjct: 112 VDKIWKCPNCYHIGKKVPTRNRPTCWCGKVVNPDHNPLDPNSCGQTCNAPTCVHGCSKIC 171

Query: 187 HLGSHPECTQLLKITCRCGRETKDIYCHESRRQKSIFHCDQECGLTLPCGIHKCRRKCHS 246
           HLG HPECT+ ++I CRCG+ +K I+C++S+  K  F C +ECGL L CGIHKC++KCHS
Sbjct: 172 HLGPHPECTRTVEIKCRCGKHSKSIFCYQSKAMKKHFDCQEECGLPLSCGIHKCKKKCHS 231

Query: 247 GLCGSCPELLIDENVSGK-IKCYCGLHSLKEMNCKDVAFPSSGKISRNQEDKEWVGIFDC 305
           GLCG CPEL++ E+ +   IKCYCG+HS   + C +V FP SG+ S+++   EW+G+F C
Sbjct: 232 GLCGPCPELIMSEDKAMDWIKCYCGIHSKDSIKCCEVNFPKSGRSSKDESGNEWIGVFAC 291

Query: 306 KEMRSVSYTCNEHVFVEGCIAPPTLPSTVVCPFSPNLLKTCPCGKTALQDMDCERTKCTD 365
           K++R+V Y C++H F+E CI+PPT+     CPF P+LLKTCPCG+TAL+++   R  CTD
Sbjct: 292 KDIRTVDYACHKHSFIEPCISPPTVNGKKTCPFLPSLLKTCPCGRTALEELTKPRKHCTD 351

Query: 366 PIPTCDNVCNKILKCGKHRCPFTCHTGKCMDPCIQIDKMDCACERRTFLVPCQFKGKPVC 425
           PIPTC + C+K LKCGKH CPF CH G CMDPC+Q D + CACE+ TFLVPC F+ KP C
Sbjct: 352 PIPTCSSRCSKPLKCGKHSCPFICHDGACMDPCLQTDSVKCACEQSTFLVPCGFQEKPHC 411

Query: 426 KFKCESLMSCRRHRCMEYCCSGRPYAERRKKTILRSSDRNDETLVEAEHVCLKDCNLKLS 485
             KCESLMSCRRHRC++ CCSGRP A  RKK I RS D  DE+LVEA+H+CLK CNL LS
Sbjct: 412 NIKCESLMSCRRHRCIDRCCSGRPSALERKKRIFRSQDLMDESLVEAQHICLKPCNLTLS 471

Query: 486 CGIHTCQRKCHPGPCPPCLESDSNDLVCPCGKTVIPAPVRCGTTLPPCKYPCIKVIRGES 545
           CGIH CQRKCHPG CPPCLESDSNDLVCPCGKTVIPAPVRCGT LP C Y CIKV+RGES
Sbjct: 472 CGIHKCQRKCHPGKCPPCLESDSNDLVCPCGKTVIPAPVRCGTKLPLCNYACIKVVRGES 531

Query: 546 DCGHKPMPHSCHSLDQPCPVCTAPVFKPCKCGKKDKVRTMCFQEDVSCGLPCGLPLKDCY 605
           +CGHKPMPH+CH LD  CP CT  VFKPCKCGKKDKVRT+CFQ DVSCG  CG PL  C+
Sbjct: 532 ECGHKPMPHTCHPLDLACPPCTETVFKPCKCGKKDKVRTVCFQTDVSCGTTCGKPLSGCH 591

Query: 606 HKCQKRCHLPGECQNTCIQICNAKRSNCSHGCTQRCHKNAXXXXXXXXXXXXXXXXXGRR 665
           H CQK CHLP  CQ  C QIC  KR NC H C + CH  +                 GR 
Sbjct: 592 HTCQKTCHLPENCQKVCKQICRQKRPNCDHACPKPCHGRSECPDLPCASLVKITCKCGRI 651

Query: 666 KLVKPCXXXXXXXXXXXXXHLECDXXXXXXXXXXXXKAAFGIVNGLGDDKTSVAIERIQN 725
           +    C              L+C+            + AFGI     ++ T+  ++ ++ 
Sbjct: 652 EKKVACGAKSNVVSVTEAPQLDCNEECEALKRLKELREAFGISEE-SNESTNNELDTLKK 710

Query: 726 RISVAKAYEELELPFVEAVLTVYAKQPKWCSQIEGILNKFMDEKLKSSLHFKHMKAPQRS 785
            +SVA  +EEL+LPF E VL+VYAKQ  WC QIE I+NK M +K +SSLHFK M+ PQR 
Sbjct: 711 LVSVATTFEELQLPFTETVLSVYAKQEGWCLQIENIVNKLMSDKTRSSLHFKPMRPPQRH 770

Query: 786 FVHNLADAYKIYSESQDPEPVRSVFVKKLTNGTSSKPILTLEEALPLYXXXXXXXXXXXX 845
           F+  LA AY +YSESQD EP+RSVF+KK  N  SS+PIL+L EA PLY            
Sbjct: 771 FIRELAKAYNLYSESQDREPMRSVFIKKEDNSKSSRPILSLAEAFPLYESFKELQKERKI 830

Query: 846 XXXXARTHKTLINVEA-ETQTQQSATKYNGFLIKNLVKGTTEEDLERIFGESLKPTLVKD 904
               ART   LIN E  + + +    K NGFL++ LV G   +DL R F   LK TLV  
Sbjct: 831 QEFQARTTAKLINFEVRDAEPKVELAKNNGFLVQKLVNGNDVDDLRRFFEPHLKHTLVVK 890

Query: 905 PQYLVMDESHHGFICPADYAEISINVERDMEQLIGFFDSLCKEHFIGDIVELCNIDEAL 963
           PQYL++D+     + P +Y E+S+N ERDM+ L+G FD + KE F+ D + LC+IDE L
Sbjct: 891 PQYLIIDDGKTALVYPENYQEVSVNTERDMDILVGHFDFMAKEAFLADSISLCSIDEEL 949

>YNL023C Chr14 complement(588263..591160) [2898 bp, 965 aa] {ON}
           FAP1Protein that binds to Fpr1p, conferring rapamycin
           resistance by competing with rapamycin for Fpr1p
           binding; accumulates in the nucleus upon treatment of
           cells with rapamycin; has similarity to D. melanogaster
           shuttle craft and human NFX1
          Length = 965

 Score = 1054 bits (2726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/940 (54%), Positives = 638/940 (67%), Gaps = 14/940 (1%)

Query: 55  DESDVDTDNEYEEDLMYYERAVREIAKGDSYQCMICTVEMDHTCKMYACRHCYRVFDYDC 114
           +E     + E ++D+ YYERA++EI+ GDSY CMICTVEMD+TC+M+AC+ CYRVFDY C
Sbjct: 36  NEQPSSYEEESDDDMQYYERAIQEISSGDSYVCMICTVEMDYTCQMFACKRCYRVFDYGC 95

Query: 115 IREWALKSTQKTVDKTWKCPNCYHSSKKVPLKDRPTCWCGKVVXXXXXXXXXXSCGQTCN 174
           IREWALKST+KTVD+ WKCPNCY+ SK+VP+K+RPTCWCGKVV          SCGQTCN
Sbjct: 96  IREWALKSTEKTVDRIWKCPNCYYVSKRVPVKNRPTCWCGKVVNPDPNPLDPNSCGQTCN 155

Query: 175 ANICPHKCLKQCHLGSHPECTQLLKITCRCGRETKDIYCHESRRQKSIFHCDQECGLTLP 234
           A+ C H C K CHLG HPECT++++I C CG+ +K I+C++S+  K  F+C + CGL L 
Sbjct: 156 ASTCMHGCSKICHLGPHPECTRMVEIMCHCGKHSKSIFCYQSKVMKKNFNCQEVCGLPLS 215

Query: 235 CGIHKCRRKCHSGLCGSCPELLIDENVSGK-IKCYCGLHSLKEMNCKDVAFPSSGKISRN 293
           C IH C++KCH GLCG CPE++I ++   K IKCYCG H+   + C +  FP SGK S++
Sbjct: 216 CSIHTCKKKCHPGLCGPCPEMIISKDSPKKQIKCYCGNHTRANIKCSETKFPKSGKSSKD 275

Query: 294 QEDKEWVGIFDCKEMRSVSYTCNEHVFVEGCIAPPTLPSTVVCPFSPNLLKTCPCGKTAL 353
           +    W+G+F C + R V Y+C +H F+E CI+PPT+     CPF P+ LKTCPCG+TAL
Sbjct: 276 ENGNRWIGVFACADNRVVDYSCRKHSFIESCISPPTINGEKACPFLPSSLKTCPCGRTAL 335

Query: 354 QDMDCERTKCTDPIPTCDNVCNKILKCGKHRCPFTCHTGKCMDPCIQIDKMDCACERRTF 413
           +++   R  C DPIPTCD+ C K LKCGKH CPFTCH   CM+PC+QID + CACE+ TF
Sbjct: 336 EELTKPRKHCDDPIPTCDSRCGKPLKCGKHSCPFTCHDKACMEPCLQIDSVKCACEQSTF 395

Query: 414 LVPCQFKGKPVCKFKCESLMSCRRHRCMEYCCSGRPYAERRKKTILRSSDRNDETLVEAE 473
            VPC F+G+P C  KCESLMSCRRHRC + CCSGRP A RRKK + R+ D  DE+LVEA+
Sbjct: 396 SVPCGFQGRPRCNIKCESLMSCRRHRCTDRCCSGRPSAIRRKKNLFRTQDLLDESLVEAK 455

Query: 474 HVCLKDCNLKLSCGIHTCQRKCHPGPCPPCLESDSNDLVCPCGKTVIPAPVRCGTTLPPC 533
           H+CLK CNL LSCGIH CQRKCHPG CPPCLESDSNDLVCPCG TV+PAPVRCGT LP C
Sbjct: 456 HICLKPCNLTLSCGIHKCQRKCHPGKCPPCLESDSNDLVCPCGNTVVPAPVRCGTKLPTC 515

Query: 534 KYPCIKVIRGESDCGHKPMPHSCHSLDQPCPVCTAPVFKPCKCGKKDKVRTMCFQEDVSC 593
            +PCIKV+RGES CGHKPMPH+CHSLD  CP CT  VFKPCKCGKK KVRT+CFQ DVSC
Sbjct: 516 NHPCIKVVRGESTCGHKPMPHTCHSLDVSCPPCTETVFKPCKCGKKTKVRTVCFQTDVSC 575

Query: 594 GLPCGLPLKDCYHKCQKRCHLPGECQNTCIQICNAKRSNCSHGCTQRCHKNAXXXXXXXX 653
           G+ CG+PL  CYH CQK CHLPG CQ  C Q C  KR NC+H C + CH           
Sbjct: 576 GIKCGIPLSYCYHTCQKTCHLPGNCQKVCKQTCGQKRLNCNHECPKPCHGKTECPDLPCA 635

Query: 654 XXXXXXXXXGRRKLVKPCXXXXXXXXXXXXXHLECDXXXXXXXXXXXXKAAFGIVNGLGD 713
                    GR K    C              L+C+            K AFGI     +
Sbjct: 636 TLVKIYCKCGRIKKSVTCGAKSDRVSVTESSVLDCNEECEALKRLKELKEAFGIKEET-N 694

Query: 714 DKTSVAIERIQNRISVAKAYEELELPFVEAVLTVYAKQPKWCSQIEGILNKFMDEKLKSS 773
           + TS  ++ ++  +SVA  +EEL+LPF EA L+VY+KQ +WCSQIE ILNK MD+K +SS
Sbjct: 695 NFTSNELDALKKLVSVATTFEELQLPFTEAALSVYSKQERWCSQIEAILNKLMDDKTRSS 754

Query: 774 LHFKHMKAPQRSFVHNLADAYKIYSESQDPEPVRSVFVKKLTNGTSSKPILTLEEALPLY 833
           LHFK M+ PQR F+  LA AY +YSESQD EP+RSVF+KK  NG S+KP+L+L EA PLY
Sbjct: 755 LHFKPMRPPQRHFIRELAKAYGLYSESQDREPMRSVFIKKEDNGASNKPVLSLAEAYPLY 814

Query: 834 XXXXXXXXXXXXXXXXARTHKTLINVEAE-TQTQQSATKYNGFLIKNLVKGTTEEDLERI 892
                           ART   LIN E + T+ +    K NGFL++NLV G T EDL R 
Sbjct: 815 ESFKQLQKERKAQEFQARTTAKLINFEVQDTEPKVEVAKKNGFLVQNLVAGNTAEDLRRF 874

Query: 893 FGESLKPTLVKDPQYLVMDESHHGFICPADYAEISINVERDMEQLIGFFDSLCKEHFIGD 952
           F   LK TLV +PQYL++D+     + P +Y   S+N ERDME L+G FD + KE F+ D
Sbjct: 875 FEPHLKHTLVVNPQYLILDDGKTALVYPENYETASVNTERDMELLVGHFDFMAKEAFLAD 934

Query: 953 IVELCNIDEALLQENVDLEDSEEEKLTSPEVENDSDIHDS 992
            + LC+ +E L           E +L +P ++ DS + D+
Sbjct: 935 SISLCSTEEEL-----------ERRLDTPVIQEDSPVMDN 963

>Smik_14.308 Chr14 complement(550650..553547) [2898 bp, 965 aa] {ON}
           YNL023C (REAL)
          Length = 965

 Score = 1040 bits (2690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 511/951 (53%), Positives = 641/951 (67%), Gaps = 22/951 (2%)

Query: 54  EDESDVDTDNE----YEE----DLMYYERAVREIAKGDSYQCMICTVEMDHTCKMYACRH 105
           E +S V+ +NE    YEE    D+ YYER+++EI+KGDSY CMICTVEMD+TC+M+AC+ 
Sbjct: 27  EQDSSVEDNNEQPSSYEEETDDDMQYYERSIQEISKGDSYICMICTVEMDYTCQMFACKR 86

Query: 106 CYRVFDYDCIREWALKSTQKTVDKTWKCPNCYHSSKKVPLKDRPTCWCGKVVXXXXXXXX 165
           CYRVFDY CIREWA+KST+KTVD+ WKCPNCYH  KKVP  +RPTCWCGKVV        
Sbjct: 87  CYRVFDYGCIREWAIKSTEKTVDRIWKCPNCYHVGKKVPANNRPTCWCGKVVNPDPNPLD 146

Query: 166 XXSCGQTCNANICPHKCLKQCHLGSHPECTQLLKITCRCGRETKDIYCHESRRQKSIFHC 225
             SCGQTC+A IC H C K CHLG HPECT++++I C CG+ ++ I+C++S+  K  F C
Sbjct: 147 PNSCGQTCSAPICIHGCSKTCHLGPHPECTRMVEIMCHCGKHSQSIFCYQSKAMKKNFKC 206

Query: 226 DQECGLTLPCGIHKCRRKCHSGLCGSCPELLID-ENVSGKIKCYCGLHSLKEMNCKDVAF 284
            +ECGL L C +H C+RKCH+GLCG CPEL+   ++   +IKCYCG HS   + C +  F
Sbjct: 207 QEECGLPLSCSVHNCKRKCHTGLCGPCPELITSKDSTEEQIKCYCGNHSRASIKCSEARF 266

Query: 285 PSSGKISRNQEDKEWVGIFDCKEMRSVSYTCNEHVFVEGCIAPPTLPSTVVCPFSPNLLK 344
           P SG+ S++    EW+G+F C ++R+V ++C +H F+E C++PP++    VCPF P+LLK
Sbjct: 267 PKSGRSSKDGNGNEWIGVFACTDIRTVDFSCRKHSFIEPCLSPPSVNGRKVCPFLPSLLK 326

Query: 345 TCPCGKTALQDMDCERTKCTDPIPTCDNVCNKILKCGKHRCPFTCHTGKCMDPCIQIDKM 404
           TCPCG+TAL ++   R  C DPIPTC++ C+K LKCGKH CPF CH   CMDPC+QID  
Sbjct: 327 TCPCGRTALDELTKPRKHCDDPIPTCNSRCSKPLKCGKHSCPFICHDLACMDPCLQIDSA 386

Query: 405 DCACERRTFLVPCQFKGKPVCKFKCESLMSCRRHRCMEYCCSGRPYAERRKKTILRSSDR 464
            CACE+ TF VPC F+G+P C  KCESLMSCRRHRC + CCSGRP A +R+K   RS D 
Sbjct: 387 KCACEQSTFSVPCGFQGRPRCNIKCESLMSCRRHRCTDRCCSGRPSAVKRRKNFFRSQDL 446

Query: 465 NDETLVEAEHVCLKDCNLKLSCGIHTCQRKCHPGPCPPCLESDSNDLVCPCGKTVIPAPV 524
            DE+LVEA+H+CLK CNL LSCGIH CQRKCHPG CPPCLESDSNDL+CPCGKTV+PAPV
Sbjct: 447 LDESLVEAKHICLKPCNLTLSCGIHKCQRKCHPGKCPPCLESDSNDLICPCGKTVVPAPV 506

Query: 525 RCGTTLPPCKYPCIKVIRGESDCGHKPMPHSCHSLDQPCPVCTAPVFKPCKCGKKDKVRT 584
           RCGT LP C +PCIKV+RGES CGHKPMPH+CH L  PCP CT  VFKPCKCGKKDKVRT
Sbjct: 507 RCGTELPVCNHPCIKVVRGESSCGHKPMPHTCHPLGVPCPPCTETVFKPCKCGKKDKVRT 566

Query: 585 MCFQEDVSCGLPCGLPLKDCYHKCQKRCHLPGECQNTCIQICNAKRSNCSHGCTQRCHKN 644
           +CFQ+DVSCG  CGL L  C H CQK CHLPG CQ  C QIC  +R +C H C + CH  
Sbjct: 567 VCFQKDVSCGTKCGLLLHFCRHTCQKTCHLPGNCQKVCKQICGHERLSCRHTCPKPCHGK 626

Query: 645 AXXXXXXXXXXXXXXXXXGRRKLVKPCXXXXXXXXXXXXXHLECDXXXXXXXXXXXXKAA 704
                             GR +    C              L+CD            + A
Sbjct: 627 TECPDLPCPTLVKITCKCGRNEKSVTCSAKSGVVPANESSVLDCDEECEALKRLKELREA 686

Query: 705 FGIVNGLGDDKTSVAIERIQNRISVAKAYEELELPFVEAVLTVYAKQPKWCSQIEGILNK 764
           FGI     ++ TS  ++ ++  +SVA  +EEL LPF E  L+VY+KQ +WCSQIE ILNK
Sbjct: 687 FGIKEE-SNNVTSNELDALKKLVSVATTFEELHLPFTETTLSVYSKQERWCSQIEVILNK 745

Query: 765 FMDEKLKSSLHFKHMKAPQRSFVHNLADAYKIYSESQDPEPVRSVFVKKLTNGTSSKPIL 824
            MD+K +SSLHFK M+ PQR F+  LA AY +YSESQD EP+RSVF+KK  NGTS+KP+L
Sbjct: 746 LMDDKTRSSLHFKPMRPPQRHFIRELAKAYGLYSESQDREPMRSVFIKKEDNGTSNKPVL 805

Query: 825 TLEEALPLYXXXXXXXXXXXXXXXXARTHKTLINVEAE-TQTQQSATKYNGFLIKNLVKG 883
           +L EALPLY                +RT   LIN E +  Q +    K NGFL++NLV G
Sbjct: 806 SLGEALPLYESFKQLQKERKVQEFQSRTTAKLINFEVQDAQPKVEVAKNNGFLVRNLVTG 865

Query: 884 TTEEDLERIFGESLKPTLVKDPQYLVMDESHHGFICPADYAEISINVERDMEQLIGFFDS 943
            T EDL+R F   LK TLV +PQYL++D+     + P +Y   S+N ERDME L+G FD 
Sbjct: 866 NTVEDLKRFFEPHLKHTLVVNPQYLILDDGKTALVYPENYETASVNTERDMELLVGHFDF 925

Query: 944 LCKEHFIGDIVELCNIDEALLQENVDLEDSEEEKLTSPEVENDSDIHDSPK 994
           + KE F+ D + LC+ DE +            ++L +P ++ D+ I D  K
Sbjct: 926 MAKEAFLADSILLCSTDEEV-----------GKRLDTPVIQEDTSIEDKNK 965

>KAFR0H03300 Chr8 complement(627520..630420) [2901 bp, 966 aa] {ON}
           Anc_2.288 YNL023C
          Length = 966

 Score = 1033 bits (2671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 527/992 (53%), Positives = 656/992 (66%), Gaps = 31/992 (3%)

Query: 2   VQDKEQEQDQETINKQQSSNGKLFKGHSLVLEFXXXXXXXXXXXXXXXXXXXEDESDVDT 61
           + D   +   ET+N     + K     SLVLEF                   ++E DV +
Sbjct: 1   MDDSSADSVDETLNLHTHPDPK-----SLVLEFSEDDTSSAASSD-------DEEMDVLS 48

Query: 62  DNEYEEDLMYYERAVREIAKGDSYQCMICTVEMDHTCKMYACRHCYRVFDYDCIREWALK 121
           DN+   D+MYYERA++EIA GDSY CMICTVEMD+TCKMYAC+ C R+FDYDCIREWALK
Sbjct: 49  DND---DMMYYERAIQEIAAGDSYICMICTVEMDYTCKMYACKKCCRIFDYDCIREWALK 105

Query: 122 STQKTVDKTWKCPNCYHSSKKVPLKDRPTCWCGKVVXXXXXXXXXXSCGQTCNANICPHK 181
           ST+KT ++ WKCPNCYH +KKVP K+R TCWCGKVV          SCGQTCNA +C H 
Sbjct: 106 STEKTKERIWKCPNCYHVNKKVPTKNRATCWCGKVVNPEKNPLNPNSCGQTCNAPVCIHG 165

Query: 182 CLKQCHLGSHPECTQLLKITCRCGRETKDIYCHESRRQ---KSIFHCDQECGLTLPCGIH 238
           C K CHLG HPEC + + + C CG+  + I C +S+ Q   ++ F C++ECGL L CGIH
Sbjct: 166 CSKICHLGPHPECLRTITMKCDCGKHERQISCFQSKSQSGRRNRFSCEEECGLPLSCGIH 225

Query: 239 KCRRKCHSGLCGSCPELL-IDENVSGKIKCYCGLHSLKEMNCKDVAFPSSGKISRNQEDK 297
            C++KCHSGLCGSCPELL ++E     IKCYCGL + K   CKDV  P++  +SR+ E  
Sbjct: 226 TCKKKCHSGLCGSCPELLEVNEEKCATIKCYCGLETKKSFPCKDVKAPTT--LSRDAEGN 283

Query: 298 EWVGIFDCKEMRSVSYTCNEHVFVEGCIAPPTLPSTVVCPFSPNLLKTCPCGKTALQDMD 357
           +WVG+F C ++R+V Y+C +H FVE C+APPT+  T  CPFSPNLLKTCPCG+T L  + 
Sbjct: 284 KWVGVFSCNKIRNVEYSCQKHSFVESCVAPPTVSGTKQCPFSPNLLKTCPCGRTPLNALS 343

Query: 358 CERTKCTDPIPTCDNVCNKILKCGKHRCPFTCHTGKCMDPCIQIDKMDCACERRTFLVPC 417
             R KCTDP+PTC+  CNK LKCGKHRCPFTCH G CMDPCIQIDK  C+C +  FL PC
Sbjct: 344 KPRLKCTDPVPTCEACCNKPLKCGKHRCPFTCHNGPCMDPCIQIDKKPCSCHQSFFLTPC 403

Query: 418 QFKGKPVCKFKCESLMSCRRHRCMEYCCSGRPYAERRKKTILRSSDRNDETLVEAEHVCL 477
           QF+G+P C  KCESLMSCRRHRC E CCSGRP AE+RKKT+ RSSD NDETLVEA+HVCL
Sbjct: 404 QFEGEPHCNIKCESLMSCRRHRCTERCCSGRPLAEKRKKTLFRSSDINDETLVEAQHVCL 463

Query: 478 KDCNLKLSCGIHTCQRKCHPGPCPPCLESDSNDLVCPCGKTVIPAPVRCGTTLPPCKYPC 537
           K+CNL LSCG H CQRKCHPG CPPCLESDSNDLVCPCGKTV+ APVRCGT L PC +PC
Sbjct: 464 KECNLMLSCGKHRCQRKCHPGKCPPCLESDSNDLVCPCGKTVVEAPVRCGTKLSPCLFPC 523

Query: 538 IKVIRGESDCGHKPMPHSCHSLDQPCPVCTAPVFKPCKCGKKDKVRTMCFQEDVSCGLPC 597
           IKVIR ES CGH P+PHSCH LDQPCP CTA VFKPCKCGK+DKVRT+CFQ+DVSCG  C
Sbjct: 524 IKVIRNESVCGHPPVPHSCHPLDQPCPPCTATVFKPCKCGKRDKVRTVCFQKDVSCGKIC 583

Query: 598 GLPLKDCYHKCQKRCHLPGECQNTCIQICNAKRSNCSHGCTQRCHKNAXXXXXXXXXXXX 657
           GLPL  C+HKCQK CH  GECQ  C Q+C  KR NC H C + CH +             
Sbjct: 584 GLPLLTCHHKCQKVCHPNGECQVKCKQVCRKKRVNCVHECLKSCHGSTECSDSPCPVSTK 643

Query: 658 XXXXXGRRKLVKPCXXXXXXXXXXXXXHLECDXXXXXXXXXXXXKAAFGIVNGLGDDKTS 717
                GRR+    C              L+C+            + AFGIV    ++  +
Sbjct: 644 ISCPCGRRESYVTCNATSTIDSAALITRLDCNEECEVVKRHRELREAFGIVE--KEEPEN 701

Query: 718 VAIERIQNRISVAKAYEELELPFVEAVLTVYAKQPKWCSQIEGILNKFMDEKLKSSLHFK 777
           +  ER+Q+    A  Y++L+LP+ E  L  Y KQP WC QIE +L KFMD+  + SLHFK
Sbjct: 702 LGTERLQSFAQSATNYDDLQLPYTEPALVAYTKQPNWCEQIEELLIKFMDDNSRPSLHFK 761

Query: 778 HMKAPQRSFVHNLADAYKIYSESQDPEPVRSVFVKKLTNGTSSKPILTLEEALPLYXXXX 837
            M+ PQR F+H +A A+ +Y+ESQD EP RSVF+KK  +GTS KP L L + LP+Y    
Sbjct: 762 PMRPPQRYFIHEIAKAFNLYAESQDREPKRSVFLKKNDDGTSLKPALRLSDVLPVYQNFK 821

Query: 838 XXXXXXXXXXXXARTHKTLINVEA-ETQTQQSATKYNGFLIKNLVKGTTEEDLERIFGES 896
                       ART   L+N+   +T  ++   + NG +IKNL  G T E L   F + 
Sbjct: 822 KLEKERKAKQFEARTTARLMNITLDDTLEERKKFENNGLIIKNLSNGITLEFLSEFFNKF 881

Query: 897 LKPTLVKDPQYLVMDESHHGFICPADYAEISINVERDMEQLIGFFDSLCKEHFIGDIVEL 956
            K TL+K+PQYL+++  ++G I P  + EI+  V  D++ L+G F+ + KE  IGD VE+
Sbjct: 882 FKSTLIKNPQYLIIE--NNGLIYPESHNEITQGVYNDLDMLVGHFNVIVKEELIGDSVEM 939

Query: 957 CNIDEALLQENVDLEDSEEEKLTSPEVENDSD 988
           CNI+  L +E +     E  +L +P +E+D +
Sbjct: 940 CNIENELPEERL-----ETPRLETPGLESDDE 966

>TDEL0G02190 Chr7 (430157..432967) [2811 bp, 936 aa] {ON} Anc_2.288
           YNL023C
          Length = 936

 Score = 1022 bits (2642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/948 (53%), Positives = 624/948 (65%), Gaps = 29/948 (3%)

Query: 28  HSLVLEFXXXXXXXXXXXXXXXXXXXEDESDVDTDN------EYEEDLMYYERAVREIAK 81
           HSLVLEF                   ED+SD  +++        E D+ YYERAV+EIA 
Sbjct: 9   HSLVLEFS------------------EDDSDFSSESCSVHEVRDEHDMAYYERAVQEIAL 50

Query: 82  GDSYQCMICTVEMDHTCKMYACRHCYRVFDYDCIREWALKSTQKTVDKTWKCPNCYHSSK 141
           GD Y CMICTVEMD+TCKMYAC  CYRVFDY+CIREWALKST+KT+D+ WKCPNCY  +K
Sbjct: 51  GDRYVCMICTVEMDYTCKMYACEGCYRVFDYECIREWALKSTEKTLDRVWKCPNCYKVNK 110

Query: 142 KVPLKDRPTCWCGKVVXXXXXXXXXXSCGQTCNANICPHKCLKQCHLGSHPECTQLLKIT 201
           +VP K+RPTCWCGK V          SCGQTC+A ICPH C KQCHLG HP+C + +   
Sbjct: 111 RVPAKNRPTCWCGKTVNPDPNPLDPNSCGQTCDAPICPHGCSKQCHLGPHPDCVRTITTK 170

Query: 202 CRCGRETKDIYCHE--SRRQKSIFHCDQECGLTLPCGIHKCRRKCHSGLCGSCPELLIDE 259
           C+CG+ T++ +C++  S + KS F C++ CGL L CGIHKC R CHSG+CG CP +L  +
Sbjct: 171 CQCGKHTRETFCYQTISMKGKSQFQCNEVCGLPLACGIHKCERLCHSGICGPCPAVLNAK 230

Query: 260 NVSGKIKCYCGLHSLKEMNCKDVAFPSSGKISRNQEDKEWVGIFDCKEMRSVSYTCNEHV 319
           +   KI+CYCGL       CKDV   S   +S++ +   W+G F C  +R + Y C EH 
Sbjct: 231 SNKLKIRCYCGLEHRDSFKCKDVRVASD--LSKDGKGDSWIGAFGCSGIRKIEYACREHS 288

Query: 320 FVEGCIAPPTLPSTVVCPFSPNLLKTCPCGKTALQDMDCERTKCTDPIPTCDNVCNKILK 379
           FVE C   P++   + CPFSP LLKTCPCG+T+L+ +   R  CT PIP CD+ C K L 
Sbjct: 289 FVEKCQPSPSISGKIACPFSPKLLKTCPCGRTSLKVLAEPRKSCTSPIPNCDSTCGKKLA 348

Query: 380 CGKHRCPFTCHTGKCMDPCIQIDKMDCACERRTFLVPCQFKGKPVCKFKCESLMSCRRHR 439
           CG+H CPFTCH G CMDPCIQI+ + C+C +  + VPCQFK +P C  KCESLMSCRRHR
Sbjct: 349 CGRHTCPFTCHDGPCMDPCIQIETVRCSCHKNLYSVPCQFKEQPRCDTKCESLMSCRRHR 408

Query: 440 CMEYCCSGRPYAERRKKTILRSSDRNDETLVEAEHVCLKDCNLKLSCGIHTCQRKCHPGP 499
           C E CC GRP+AERR+KT L S +  DE+ VE+EH+CLKDCNL LSCG H CQRKCHPG 
Sbjct: 409 CTERCCCGRPFAERRRKTPLSSRELMDESSVESEHICLKDCNLTLSCGCHKCQRKCHPGK 468

Query: 500 CPPCLESDSNDLVCPCGKTVIPAPVRCGTTLPPCKYPCIKVIRGESDCGHKPMPHSCHSL 559
           CPPCLESDSNDLVCPCGKTV+ APVRCGT LPPC YPCI+VI+    CGHKPMPH+CH L
Sbjct: 469 CPPCLESDSNDLVCPCGKTVVEAPVRCGTRLPPCHYPCIRVIQNAYKCGHKPMPHTCHPL 528

Query: 560 DQPCPVCTAPVFKPCKCGKKDKVRTMCFQEDVSCGLPCGLPLKDCYHKCQKRCHLPGECQ 619
           ++PCP CTAPVFKPCKCGKKDKVRT+CFQ DVSCG  CG PL +C H CQK CH+PGECQ
Sbjct: 529 NEPCPSCTAPVFKPCKCGKKDKVRTLCFQNDVSCGTTCGKPLDNCPHMCQKSCHIPGECQ 588

Query: 620 NTCIQICNAKRSNCSHGCTQRCHKNAXXXXXXXXXXXXXXXXXGRRKLVKPCXXXXXXXX 679
             C QICN KR  C H C   CH N                    ++    C        
Sbjct: 589 KKCKQICNRKRIYCDHKCRLICHGNDKCPDIPCPLSVKIKCECEVKESFITCGANSETPS 648

Query: 680 XXXXXHLECDXXXXXXXXXXXXKAAFGIVNGLGDDKTSVAIERIQNRISVAKAYEELELP 739
                 L CD            + AFGI N   D+ +      ++N  +VA ++EELELP
Sbjct: 649 KATTTILPCDEECERHKRHLQLREAFGISN-FSDNPSRSKTASLENLAAVANSFEELELP 707

Query: 740 FVEAVLTVYAKQPKWCSQIEGILNKFMDEKLKSSLHFKHMKAPQRSFVHNLADAYKIYSE 799
           F E  L  +AKQ  WC+QIE +LN FMD + K+SLHFK M+  QR F+H LA +Y +Y E
Sbjct: 708 FSEPALGTFAKQEAWCTQIENVLNSFMDNEEKTSLHFKPMRPAQRHFIHELAKSYNLYVE 767

Query: 800 SQDPEPVRSVFVKKLTNGTSSKPILTLEEALPLYXXXXXXXXXXXXXXXXARTHKTLINV 859
           SQD EP RSVFVKK  NG S KP++ L+++LP+Y                A+T    +N 
Sbjct: 768 SQDREPKRSVFVKKQDNGGSCKPVIQLKDSLPIYQFFKENEKEKKAQRFEAQTTTEFVNF 827

Query: 860 EAETQTQQSATKYNGFLIKNLVKGTTEEDLERIFGESLKPTLVKDPQYLVMDESHHGFIC 919
             + + Q    K N F +KN+  GTT+EDLERIF + LKPTLVK+PQ+ + D + +G I 
Sbjct: 828 IPKEEPQLERAKNNAFKLKNVSTGTTKEDLERIFADHLKPTLVKNPQFKIQDSTKNGLIY 887

Query: 920 PADYAEISINVERDMEQLIGFFDSLCKEHFIGDIVELCNIDEALLQEN 967
           P DYAEIS+NVERD+E L+G FD LCKE FIGD +ELC+ID  +LQE+
Sbjct: 888 PEDYAEISVNVERDLEALVGHFDYLCKESFIGDGIELCHIDLKVLQES 935

>KNAG0H01990 Chr8 complement(349855..352776) [2922 bp, 973 aa] {ON}
           Anc_2.288 YNL023C
          Length = 973

 Score = 1021 bits (2640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/932 (54%), Positives = 624/932 (66%), Gaps = 12/932 (1%)

Query: 61  TDNEYEEDLMYYERAVREIAKGDSYQCMICTVEMDHTCKMYACRHCYRVFDYDCIREWAL 120
           +D E ++DL YYERAVREIAKGD Y CMICTVEMD+TCKM+ACR CYRVFDYDC+REWA+
Sbjct: 43  SDTEEDQDLPYYERAVREIAKGDLYTCMICTVEMDYTCKMFACRKCYRVFDYDCVREWAI 102

Query: 121 KSTQKTVDKTWKCPNCYHSSKKVPLKDRPTCWCGKVVXXXXXXXXXXSCGQTCNANICPH 180
           KST KTVD+ WKCPNCY  +KKVP K+RPTCWCGKVV          SCGQTC+A IC H
Sbjct: 103 KSTDKTVDRIWKCPNCYLVNKKVPTKNRPTCWCGKVVNPEPNPLDPNSCGQTCDAKICIH 162

Query: 181 KCLKQCHLGSHPECTQLLKITCRCGRETKDIYCHES--RRQKSIFHCDQECGLTLPCGIH 238
            C K CHLG HPEC +   + CRCG+ TK+I C E+  RR +++F C++ C   LPCGIH
Sbjct: 163 GCSKICHLGPHPECLRTTSVKCRCGKATKEIPCFETKGRRGRNLFQCNEPCNSLLPCGIH 222

Query: 239 KCRRKCHSGLCGSCPE-LLIDENVSGKIKCYCGLHSLKEMNCKDVAFPSSGKISRNQEDK 297
           +C++ CHSGLCGSCPE L + E     I CYCG H+   + CKDV    +G+ S+N    
Sbjct: 223 RCQKICHSGLCGSCPENLTVKEGDDVSISCYCGQHTRNSIKCKDVNV--TGRKSKNANGD 280

Query: 298 EWVGIFDCKEMRSVSYTCNEHVFVEGCIAPPTLPSTVVCPFSPNLLKTCPCGKTALQDMD 357
           EW+G++ CK++RSV Y+C +H F E CIAPPT+  T  CPFSP  LKTC CGKT LQ + 
Sbjct: 281 EWIGVYACKDIRSVEYSCRQHSFFEECIAPPTVTGTKRCPFSPKYLKTCSCGKTPLQALG 340

Query: 358 CERTKCTDPIPTCDNVCNKILKCGKHRCPFTCHTGKCMDPCIQIDKMDCACERRTFLVPC 417
             R +C DPIP C++ C+K+LKCGKH CPF CH G CMDPCIQIDK+ CACER TFLVPC
Sbjct: 341 KARRRCIDPIPHCESRCDKLLKCGKHTCPFQCHDGPCMDPCIQIDKVKCACERNTFLVPC 400

Query: 418 QFKGKPVCKFKCESLMSCRRHRCMEYCCSGRPYAERRKKTILRSSDRNDETLVEAEHVCL 477
            F+G P C+ KCESL+SCRRH+C E CCSGRP AE R+K   R  D NDETL+EAEHVCL
Sbjct: 401 GFQGAPHCQLKCESLLSCRRHKCAERCCSGRPAAEERRKNSSRFQDVNDETLMEAEHVCL 460

Query: 478 KDCNLKLSCGIHTCQRKCHPGPCPPCLESDSNDLVCPCGKTVIPAPVRCGTTLPPCKYPC 537
           K CNL LSCG H CQRKCHPG CPPCLESDSNDLVCPCGKT++PAPVRCGT LP C++PC
Sbjct: 461 KACNLTLSCGQHQCQRKCHPGKCPPCLESDSNDLVCPCGKTIVPAPVRCGTKLPSCRHPC 520

Query: 538 IKVIRGESDCGHKPMPHSCHSLDQPCPVCTAPVFKPCKCGKKDKVRTMCFQEDVSCGLPC 597
           IKV+ G S+CGHKP+PH+CH LDQPCP CTA VFKPCKCGK  +VRT+CFQ+DVSCG  C
Sbjct: 521 IKVVEGISECGHKPIPHACHPLDQPCPPCTATVFKPCKCGKNSRVRTICFQKDVSCGQTC 580

Query: 598 GLPLKDCYHKCQKRCHLPGECQNTCIQICNAKRSNCSHGCTQRCHKNAXXXXXXXXXXXX 657
           G PL +C+H CQK CHLPG+CQ TC Q+CN    NC+H C + CH               
Sbjct: 581 GKPLPNCHHFCQKTCHLPGQCQATCKQVCNKPPVNCAHKCRKSCHGRLTCPDILCIALVK 640

Query: 658 XXXXXGRRKLVKPCXXXXXXXXXXXXXHLECDXXXXXXXXXXXXKAAFGIVNGLGDDKTS 717
                GR+++   C              LECD            K AFGI + + +    
Sbjct: 641 IRCPCGRKEVEVTCGATSTLSSSLFTERLECDEECEAYTRHRQLKEAFGITDKVANGSAM 700

Query: 718 VAIE--RIQNRISVAKAYEELELPFVEAVLTVYAKQPKWCSQIEGILNKFMDEKLKSSLH 775
              E  R++   S A  +EEL+ PF E+ ++ Y +Q KWC +IE  LN FMD + KSSLH
Sbjct: 701 KEKEGTRLEGLASKATTFEELQFPFTESTISTYIRQNKWCGEIEETLNNFMDNEGKSSLH 760

Query: 776 FKHMKAPQRSFVHNLADAYKIYSESQDPEPVRSVFVKKLTNGTSSKPILTLEEALPLYXX 835
           FK MK PQR F+  LA AY +YSE+QDPEP RSVFVKK  +G+S+KPI +L E  PLY  
Sbjct: 761 FKPMKPPQRLFIRELAKAYNLYSEAQDPEPKRSVFVKKNDDGSSAKPIFSLSEIAPLYQS 820

Query: 836 XXXXXXXXXXXXXXARTHKTLINVEAETQT---QQSATKYNGFLIKNLVKGTTEEDLERI 892
                         A+T   LINV+         Q + + N FLIKN+  GTT +DL+ +
Sbjct: 821 FKLLEKERKMQDFLAKTTTHLINVKLNDDVATGAQHSGQNNAFLIKNISAGTTLQDLKNL 880

Query: 893 FGESLKPTLVKDPQYLVMDESHHGFICPADYAEISINVERDMEQLIGFFDSLCKEHFIGD 952
           FG+ ++ TL+++PQY  + E +   + P DY  IS N   DME L+G  + +  + F+ D
Sbjct: 881 FGKYMEKTLIRNPQYQELPEENSAIVYPEDYRTISANAVNDMENLVGHINFIVNDAFLAD 940

Query: 953 IVELCNIDEALLQENVDLEDSEEEKLTSPEVE 984
             ELC+    L +E    E+   E+L +PEV+
Sbjct: 941 SAELCDASSKLPEEIS--ENDISERLETPEVQ 970

>CAGL0M06919g Chr13 complement(703702..706572) [2871 bp, 956 aa]
           {ON} similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023c FAP1
          Length = 956

 Score =  976 bits (2522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/914 (52%), Positives = 599/914 (65%), Gaps = 5/914 (0%)

Query: 54  EDESDVDTDNEYEEDLMYYERAVREIAKGDSYQCMICTVEMDHTCKMYACRHCYRVFDYD 113
           E+ SD+D  +E  +D+ YYE+AV+EI KGDSY C+ICTVE+D+TCK+YAC  CYRV+DY+
Sbjct: 46  EELSDLDEGDE--KDMAYYEKAVQEIVKGDSYSCLICTVELDYTCKLYACEKCYRVYDYE 103

Query: 114 CIREWALKSTQKTVDKTWKCPNCYHSSKKVPLKDRPTCWCGKVVXXXXXXXXXXSCGQTC 173
           CIREWA KST K  DK W CPNC+++ K +P K+RPTCWCG+ V          SCGQTC
Sbjct: 104 CIREWAEKSTSKRTDKLWACPNCFYTKKAIPKKNRPTCWCGEQVNPEPNPLNPNSCGQTC 163

Query: 174 NANICPHKCLKQCHLGSHPECTQLLKITCRCGRETKDIYCHESRRQKSIFHCDQECGLTL 233
           NA IC H C + CHLG H ECT+++ I C CG+ TKDI C + R     F+C+  C   L
Sbjct: 164 NAKICSHGCSQICHLGPHQECTRMMSIKCSCGKVTKDIVCFQRRLYSKGFNCETVCDKLL 223

Query: 234 PCGIHKCRRKCHSGLCGSCPELLIDENVSGKIKCYCGLHSLKEMNCKDVAFPSSGKISRN 293
           PCGIHKC RKCH+GLCGSCPE +I +N + KI+CYCG  S  ++ CKDV FP++   S++
Sbjct: 224 PCGIHKCNRKCHTGLCGSCPETIISKNTNMKIRCYCGQTSKDKIKCKDVRFPANAAYSKD 283

Query: 294 QEDKEWVGIFDCKEMRSVSYTCNEHVFVEGCIAPPTLPSTVVCPFSPNLLKTCPCGKTAL 353
            + + W+G+F C ++R V Y C EH F E C APP++   ++C FSP  LKTCPCGK  L
Sbjct: 284 DKGQRWIGVFMCDKIRKVPYECGEHSFYEKCKAPPSISGRLICEFSPKKLKTCPCGKNEL 343

Query: 354 QDMDCERTKCTDPIPTCDNVCNKILKCGKHRCPFTCHTGKCMDPCIQIDKMDCACERRTF 413
            D+   R+KCTD IPTC  VC K+LKCGKH+CPF CH G CMDPC QI+K+ CACE++ F
Sbjct: 344 TDLSKPRSKCTDAIPTCGQVCGKMLKCGKHKCPFACHLGDCMDPCTQIEKVRCACEQKQF 403

Query: 414 LVPCQFKGKPVCKFKCESLMSCRRHRCMEYCCSGRPYAERRKKTI-LRSSDRNDETLVEA 472
            +PC F     C  KCESLMSCRRHRC E CC+GRP AERR+KT+ +   D  DE+ +E 
Sbjct: 404 TIPCGFNDHARCNLKCESLMSCRRHRCTERCCAGRPLAERRRKTMKINVRDLADESTIEP 463

Query: 473 EHVCLKDCNLKLSCGIHTCQRKCHPGPCPPCLESDSNDLVCPCGKTVIPAPVRCGTTLPP 532
            H+CLKDCNL LSCGIH C RKCH G CPPCLESDSNDLVCPCGKT++ APVRCGT LP 
Sbjct: 464 IHICLKDCNLTLSCGIHKCNRKCHAGKCPPCLESDSNDLVCPCGKTIVEAPVRCGTKLPN 523

Query: 533 CKYPCIKVIRGESDCGHKPMPHSCHSLDQPCPVCTAPVFKPCKCGKKDKVRTMCFQEDVS 592
           C YPCI+V+RGE+DCGH PMPH CH  D PCP CTA VFKPCKCGK+ +VRT+CF +DVS
Sbjct: 524 CPYPCIRVVRGETDCGHSPMPHECHPPDIPCPDCTATVFKPCKCGKEQRVRTVCFMKDVS 583

Query: 593 CGLPCGLPLKDCYHKCQKRCHLPGECQNTCIQICNAKRSNCSHGCTQRCHKNAXXXXXXX 652
           CG  CG  L+ CYHKCQK+CH PG CQ  C Q CN  R  C+H C + CHK         
Sbjct: 584 CGKVCGERLQTCYHKCQKKCHEPGACQTVCKQTCNMPRLYCNHRCPKPCHKFEECPDIPC 643

Query: 653 XXXXXXXXXXGRRKLVKPCXXXXXXXXXXXXXHLECDXXXXXXXXXXXXKAAFGIVNGLG 712
                     GR +    C              + CD            K AFGIV+   
Sbjct: 644 TALVKITCPCGRIEKEVTCGVYSKNKEAQDSTRIVCDEECAVLQRHMQLKEAFGIVDKPQ 703

Query: 713 DDKTSVAIERIQNRISVAKAYEELELPFVEAVLTVYAKQPKWCSQIEGILNKFMDEKLKS 772
           +      + R++  IS A  + +L+LPF E V+T Y +   WC+ IE  LNK +D+  ++
Sbjct: 704 NTHNE-EMARLEQVISTASTFADLDLPFTEPVITTYIRHENWCTDIENTLNKLIDDNNRT 762

Query: 773 SLHFKHMKAPQRSFVHNLADAYKIYSESQDPEPVRSVFVKKLTNGTSSKPILTLEEALPL 832
           SLHFK M+ PQR F+  LA AY +YSESQDPEP RSVFVKK  +G+S+KPIL++ EA PL
Sbjct: 763 SLHFKPMRPPQRYFIRELAKAYNLYSESQDPEPNRSVFVKKNLDGSSTKPILSISEAAPL 822

Query: 833 YXXXXXXXXXXXXXXXXARTHKTLINVEAETQTQ-QSATKYNGFLIKNLVKGTTEEDLER 891
           Y                + T   LIN   E   + +SA ++NGFL+ N+ + T+ +DL+ 
Sbjct: 823 YQSYKKLEKEKKQANFESMTTTRLINFTPEMSPELESAARFNGFLVTNVGEFTSTDDLQN 882

Query: 892 IFGESLKPTLVKDPQYLVMDESHHGFICPADYAEISINVERDMEQLIGFFDSLCKEHFIG 951
           +F   LK TLV +PQ+ ++ E     I P  Y EISINVERDME L+  FD L KE  + 
Sbjct: 883 LFAPYLKSTLVVEPQFQILPERKQAVIYPNKYKEISINVERDMETLVQHFDFLIKESLLA 942

Query: 952 DIVELCNIDEALLQ 965
             VELCNI+  L +
Sbjct: 943 GGVELCNIENVLAE 956

>ZYRO0A01936g Chr1 (159749..162610) [2862 bp, 953 aa] {ON} similar
           to uniprot|P53971 Saccharomyces cerevisiae YNL023C
          Length = 953

 Score =  970 bits (2508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/902 (54%), Positives = 593/902 (65%), Gaps = 14/902 (1%)

Query: 69  LMYYERAVREIAKGDSYQCMICTVEMDHTCKMYACRHCYRVFDYDCIREWALKSTQKTVD 128
           +MYYERAV+EIA+GD+Y CMICTVEMD+TCKM+AC  CYRVFDYDCIREWALKST +T+D
Sbjct: 56  MMYYERAVKEIARGDTYVCMICTVEMDYTCKMFACSKCYRVFDYDCIREWALKSTGRTMD 115

Query: 129 KTWKCPNCYHSSKKVPLKDRPTCWCGKVVXXXXXXXXXXSCGQTCNANICPHKCLKQCHL 188
           KTWKCPNC   S KVP K RPTCWCGKVV          SCGQTC+A IC H C K CHL
Sbjct: 116 KTWKCPNCLDESNKVPRKSRPTCWCGKVVNPDPNPLDPNSCGQTCDAPICEHGCSKVCHL 175

Query: 189 GSHPECTQLLKITCRCGRETKDIYCHE---SRRQKSIFHCDQECGLTLPCGIHKCRRKCH 245
           G HPECT+++ I C+CGR T+D+ C E    R Q+  F C++ CGL LPCG+HKC +KCH
Sbjct: 176 GPHPECTRIISIKCKCGRHTRDVRCSEVGSGRNQQ--FTCEESCGLLLPCGVHKCSKKCH 233

Query: 246 SGLCGSCPELLIDENVSGK-IKCYCGLHSLKEMNCKDVAFPSSGKISRNQEDKEWVGIFD 304
           SGLCG C E L  +   G  IKCYCGLH    + C DV    + + S + +   W+G+F 
Sbjct: 234 SGLCGGCNETLHSKPDKGAVIKCYCGLHESPSIRCGDVRV--ADRDSVDDQGNGWIGVFR 291

Query: 305 CKEMRSVSYTCNEHVFVEGCIAPPTLPSTVVCPFSPNLLKTCPCGKTALQDMDCERTKCT 364
           CK++R V Y C +H FVE C   P+LP  + CPFSPN+L++CPCG+T L  +   R KCT
Sbjct: 292 CKDVRVVEYACGQHSFVESCKPAPSLPKQIGCPFSPNVLRSCPCGRTPLNKLGQARVKCT 351

Query: 365 DPIPTCDNVCNKILKCGKHRCPFTCHTGKCMDPCIQIDKMDCACERRTFLVPCQFKGKPV 424
           D IPTC++ C K L CGKH CP+ CH G CMDPC+Q +K +C CE R+FLVPCQF+  P 
Sbjct: 352 DHIPTCESKCGKKLACGKHTCPYKCHEGDCMDPCVQFEKTNCLCEARSFLVPCQFREDPR 411

Query: 425 CKFKCESLMSCRRHRCMEYCCSGRPYAERRKKTILRSSDRNDETLVEAEHVCLKDCNLKL 484
           C  KCESLMSCRRHRC E CCSG+P AERRKKT   S +  DE+LVEAEHVCLK CNL L
Sbjct: 412 CNTKCESLMSCRRHRCTEKCCSGKPGAERRKKTPFTSRELLDESLVEAEHVCLKSCNLTL 471

Query: 485 SCGIHTCQRKCHPGPCPPCLESDSNDLVCPCGKTVIPAPVRCGTTLPPCKYPCIKVIRGE 544
           +CG H CQRKCHPG CPPCLESD NDLVCPCGKTV+ APVRCGT LPPC Y CI V+R  
Sbjct: 472 TCGRHKCQRKCHPGRCPPCLESDPNDLVCPCGKTVVEAPVRCGTKLPPCPYSCISVVRDG 531

Query: 545 SDCGHKPMPHSCHSLDQPCPVCTAPVFKPCKCGKKDKVRTMCFQEDVSCGLPCGLPLKDC 604
             CGH PMPH CH  ++ CP CTA V KPCKCGKK  VRT+CFQ+DVSCG  C  PL  C
Sbjct: 532 YPCGHTPMPHLCHPPEEKCPPCTANVKKPCKCGKKSDVRTLCFQQDVSCGQICNKPLGSC 591

Query: 605 YHKCQKRCHLPGECQNTCIQICNAKRSNCSHGCTQRCHKNAXXXXXXXXXXXXXXXXXGR 664
            H CQK+CH  G CQ  C QIC  KR NC H C + CH                    GR
Sbjct: 592 RHTCQKKCH-DGGCQVKCRQICGKKRVNCDHKCPKPCHGGEPCPDFPCPFSVVIKCACGR 650

Query: 665 RKLVKPCXXXXXXXXXXXXXHLECDXXXXXXXXXXXXKAAFGIVNGLGDDKTSVAIERIQ 724
           ++  +PC              L CD            K A G+    GD     ++E   
Sbjct: 651 KESTEPCGTNSQTLSASVTRELSCDEECERVKRCAQLKDALGLKEN-GDS----SVENTV 705

Query: 725 NRISVAKAYEELELPFVEAVLTVYAKQPKWCSQIEGILNKFMDEKLKSSLHFKHMKAPQR 784
           +   VA  +EEL LPF E VL +Y++Q ++C  IE +LN F+D++ KSSLHFK MK  QR
Sbjct: 706 SNALVASNFEELGLPFRETVLAIYSRQQRYCDNIESVLNNFIDDEKKSSLHFKPMKPAQR 765

Query: 785 SFVHNLADAYKIYSESQDPEPVRSVFVKKLTNGTSSKPILTLEEALPLYXXXXXXXXXXX 844
            FVH LA AYK+YSESQDPEP RSV+VKK  NG S+KP +TL+EALP+Y           
Sbjct: 766 HFVHELAKAYKLYSESQDPEPKRSVYVKKELNGESNKPSITLQEALPIYQAFKQREKETK 825

Query: 845 XXXXXARTHKTLINVEAETQTQQSATKYNGFLIKNLVKGTTEEDLERIFGESLKPTLVKD 904
                 +    L+N   + +      KYNGFLI+NL  GT  EDL+RI+GE LKPTLV++
Sbjct: 826 IRRYEMQNVTNLVNFVPKFEPTVELAKYNGFLIRNLTDGTNGEDLQRIYGEHLKPTLVRN 885

Query: 905 PQYLVMDESHHGFICPADYAEISINVERDMEQLIGFFDSLCKEHFIGDIVELCNIDEALL 964
           P Y  + + +   I P  Y+++++N E DME+L+G FD +CKE FIGD VELC + E L 
Sbjct: 886 PVYKALPDRNIALIFPESYSDVTVNTECDMERLVGHFDFICKEMFIGDGVELCQVGEYLQ 945

Query: 965 QE 966
            E
Sbjct: 946 PE 947

>Kpol_1039.45 s1039 (135833..138739) [2907 bp, 968 aa] {ON}
           (135833..138739) [2907 nt, 969 aa]
          Length = 968

 Score =  954 bits (2466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/912 (52%), Positives = 605/912 (66%), Gaps = 14/912 (1%)

Query: 67  EDLMYYERAVREIAKGDSYQCMICTVEMDHTCKMYACRHCYRVFDYDCIREWALKSTQKT 126
           EDLM+YERA+++IAKGD Y CMICT+E+D T KMYAC HCYRVFDYDCIREWA+KS+QK+
Sbjct: 64  EDLMHYERAIKDIAKGDFYTCMICTIELDSTSKMYACSHCYRVFDYDCIREWAVKSSQKS 123

Query: 127 VDKTWKCPNCYHSSKKVPLKDRPTCWCGKVVXXXXXXXXXXSCGQTCNANICPHKCLKQC 186
           +DK WKCPNC H+S K+PL++RPTCWCGK V          SCGQTCNA  C H+C   C
Sbjct: 124 LDKVWKCPNCNHTSNKIPLQNRPTCWCGKTVNPDPNPFYPNSCGQTCNAKSCIHRCSHFC 183

Query: 187 HLGSHPECTQLLKITCRCGRETKDIYCH---ESRRQKSIFHCDQECGLTLPCGIHKCRRK 243
           HLG HP+C +   I C CG+ TKD++C+     + +   F+C ++C +TL CGIHKC R 
Sbjct: 184 HLGPHPQCHRTTTIHCECGKHTKDVFCYLLDHGKNRNKKFNCGEKCNMTLSCGIHKCSRV 243

Query: 244 CHSGLCGSCPELLIDENVSGKIKCYCGLHSLKEMNCKDVAFPSSGKISRNQEDKEWVGIF 303
           CHSG CG CPEL     ++ K+ CYCG  ++ ++ C +V    SGK S++QE   W+G+F
Sbjct: 244 CHSGSCGPCPEL-----ITKKVNCYCGSTTMDKIRCSNVKIHDSGKKSKDQEGNTWIGVF 298

Query: 304 DCKEMRSVSYTCNEHVFVEGCIAPPTLPSTVVCPFSPNLLKTCPCGKTALQDMDCERTKC 363
            C ++R+V Y C  H F E C +PPT+  T +CP+SP LLKTCPCGKT L D + +R KC
Sbjct: 299 KCNKIRTVEYACKNHSFFETCTSPPTISGTKICPYSPKLLKTCPCGKTNLDDFENKRQKC 358

Query: 364 TDPIPTCDNVCNKILKCGKHRCPFTCHTGKCMDPCIQIDKMDCACERRTFLVPCQFKGKP 423
           TDPI TC+N C+K LKCGKH+CPFTCH G CMDPC QI+   C+C  + F VPCQF  KP
Sbjct: 359 TDPISTCENRCDKPLKCGKHKCPFTCHNGPCMDPCTQIELRKCSCNYKEFSVPCQFHEKP 418

Query: 424 VCKFKCESLMSCRRHRCMEYCCSGRPYAERRKKTILRSSDRNDETLVEAEHVCLKDCNLK 483
            C  KCESLMSCRRHRC   CCSG+P A++RKK +   +D  DE+LVEAEH+CLKDCNLK
Sbjct: 419 RCNMKCESLMSCRRHRCTRRCCSGKPMADKRKKMLFSQADLLDESLVEAEHICLKDCNLK 478

Query: 484 LSCGIHTCQRKCHPGPCPPCLESDSNDLVCPCGKTVIPAPVRCGTTLPPCKYPCIKVIRG 543
           LSCGIH C RKCH G CPPCLESDS+DLVCPCGKTV+ APVRCGT LP C +PCIK I G
Sbjct: 479 LSCGIHNCTRKCHAGKCPPCLESDSSDLVCPCGKTVVEAPVRCGTKLPECIFPCIKYIEG 538

Query: 544 ESDCGHKPMPHSCHSLDQPCPVCTAPVFKPCKCGKKDKVRTMCFQEDVSCGLPCGLPLKD 603
              CGHKP  H CH  D PCP CT  VFKPCKCGK+ K + +CFQE  SCG  C   L  
Sbjct: 539 SYPCGHKPGNHYCHPADIPCPPCTEVVFKPCKCGKEQKAKALCFQETASCGKLCEKKLDG 598

Query: 604 CYHKCQKRCHLPGECQNTCIQICNAKRSNCSHGCTQRCHKNAXXXXXXXXXXXXXXXXXG 663
           C+H CQ +CHLPGECQ  C QICN +R NCSH C Q+CH ++                 G
Sbjct: 599 CHHYCQLKCHLPGECQKKCTQICNKRRVNCSHTCDQKCHGDSNCPDIPCKVKCEVYCGCG 658

Query: 664 RRKLVKPCXXXXXXXXXXXXXHLECDXXXXXXXXXXXXKAAFGIVNGLGDDKTSVAIERI 723
           RRK +  C              L CD            + AFG+ +   D ++   +ER+
Sbjct: 659 RRKELLLCGATSTTQSVELTKVLPCDDACLKYQRLEELRNAFGMKSSSEDPESE--LERL 716

Query: 724 QNRISVAKAYEELELPFVEAVLTVYAKQPKWCSQIEGILNKFMDEKLKSSLHFKHMKAPQ 783
           +  +    +YEELELPF E VL+VY+KQ  WC+QIE ++NKF+++K K SLHFK M APQ
Sbjct: 717 KKIVEKVTSYEELELPFSETVLSVYSKQTNWCNQIEELINKFVNDKNKPSLHFKPMPAPQ 776

Query: 784 RSFVHNLADAYKIYSESQDPEPVRSVFVKKLTNGTSSKPILTLEEALPLYXXXXXXXXXX 843
           R+F+H L +AY++YSESQD EP RSV++KK  N  +  P ++LEEALPLY          
Sbjct: 777 RNFIHALVEAYEMYSESQDREPKRSVYLKK--NKYTRIPNISLEEALPLYQSYKKIEKER 834

Query: 844 XXXXXXARTHKTLINVEAETQTQQSATKYNGFLIKNLVKGTTEEDLERIFGESLKPTLVK 903
                 ++ + T +N +   ++     KYNGFLIK +  GTT +DL  +FG  LKPTL+K
Sbjct: 835 KVQSFESKKNVTYLNYQPPERSLTPDVKYNGFLIKGITFGTTTDDLNTLFGVHLKPTLIK 894

Query: 904 DPQYLVMDESHHGFICPADYAEISINVERDMEQLIGFFDSLCKEHFIGDIVELCNIDEAL 963
           D QY ++ +     + P DY  IS NVERD+E L G FD + KE  +G+ VE+CNI + L
Sbjct: 895 DAQYSILPDGKSAIVYPKDYLTISENVERDIESLAGHFDYMTKEAMLGESVEMCNITDIL 954

Query: 964 LQENVDLEDSEE 975
             E+   E SEE
Sbjct: 955 QTESA--EPSEE 964

>SAKL0E07634g Chr5 complement(616444..619368) [2925 bp, 974 aa] {ON}
           similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023C
          Length = 974

 Score =  947 bits (2448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/924 (51%), Positives = 606/924 (65%), Gaps = 18/924 (1%)

Query: 69  LMYYERAVREIAKGDSYQCMICTVEMDHTCKMYACRHCYRVFDYDCIREWALKSTQKTVD 128
           L YYE+ + EI KGDSY CMICT+EMD+TC MYAC  CYRV+D++CIREWALKS+QK++D
Sbjct: 48  LPYYEKTIHEIQKGDSYACMICTMEMDYTCHMYACPECYRVYDHECIREWALKSSQKSLD 107

Query: 129 KTWKCPNCYHSSKKVPLKDRPTCWCGKVVXXXXXXXXXXSCGQTCNANICPHKCLKQCHL 188
           KTWKCPNCY+ + ++P+K+R TCWCGKVV          SCGQTCNA IC H C K CHL
Sbjct: 108 KTWKCPNCYYVNSEIPVKNRHTCWCGKVVHPESNPIDPNSCGQTCNAPICSHGCSKPCHL 167

Query: 189 GSHPECTQLLKITCRCGRETKDIYCHESRRQKSIFHCDQECGLTLPCGIHKCRRKCHSGL 248
           G HPEC +  K+ C CG+ TKD++C++S  +K+ + C + C L LPCG+HKC+RKCHSG 
Sbjct: 168 GPHPECMRTTKVKCLCGKHTKDMFCYQSEEEKASYQCGEPCNLLLPCGVHKCQRKCHSGP 227

Query: 249 CGSCPELLIDENVSGKIKCYCGLHSLKEMNCKDVAFPSSGKISRNQEDKEWVGIFDCKEM 308
           CG+C     +E +SGKI CYCG+ + +++ CKDV    S   S+N+  + W+G+F C  +
Sbjct: 228 CGNC-----EETISGKIMCYCGMETREQIICKDV---KSVAKSKNKSGEIWIGVFSCAHL 279

Query: 309 RSVSYTCNEHVFVEGCIAPPTLPSTVVCPFSPNLLKTCPCGKTALQDMDCERTKCTDPIP 368
           RSV Y+C  H F E C APPT    + CPFSP LLKTCPCG T L+ ++  R KCTDPIP
Sbjct: 280 RSVEYSCGHHSFQESCTAPPTNSGELACPFSPRLLKTCPCGSTPLKLLEAPRKKCTDPIP 339

Query: 369 TCDNVCNKILKCGKHRCPFTCHTGKCMDPCIQIDKMDCACERRTFLVPCQFKGKPVCKFK 428
           TC+N CNK LKCGKH CPF CH G CMDPC+ +DK+ C+C  ++FLVPCQF  +  C  K
Sbjct: 340 TCENRCNKPLKCGKHSCPFVCHDGPCMDPCVSVDKVSCSCHSKSFLVPCQFHDEAHCNTK 399

Query: 429 CESLMSCRRHRCMEYCCSGRPYAERRKKTILRSSDRNDETLVEAEHVCLKDCNLKLSCGI 488
           CESLMSCRRHRC E CCSGR  A +R+KTI  + DR DE+LVEA+H+CLK CNLKLSCGI
Sbjct: 400 CESLMSCRRHRCTERCCSGRSLAIKREKTIFLARDRLDESLVEAQHICLKPCNLKLSCGI 459

Query: 489 HTCQRKCHPGPCPPCLESDSNDLVCPCGKTVIPAPVRCGTTLPPCKYPCIKVIRGESDCG 548
           H C+RKCHPG C PCLESDSNDL CPCGKTV+PAPVRCGT LPPC++PCIK ++ ++ CG
Sbjct: 460 HYCRRKCHPGKCSPCLESDSNDLSCPCGKTVVPAPVRCGTKLPPCRHPCIKTLQADTVCG 519

Query: 549 HKPMPHSCHSLDQPCPVCTAPVFKPCKCGKKDKVRTMCFQEDVSCGLPCGLPLKDCYHKC 608
           H PMPH CHSL+QPCP CTAP++K CKC K +KVRT+CFQ DVSCG  CGLPLK+C H C
Sbjct: 520 HPPMPHECHSLEQPCPQCTAPIYKKCKCNKVEKVRTLCFQNDVSCGKICGLPLKNCSHTC 579

Query: 609 QKRCHLPGECQNTCIQICNAKRSNCSHGCTQRCHKNAXXXXXXXXXXXXXXXXXGRRKLV 668
           ++ CH PG+CQ  C QIC   R  C H C  RCH                    GR++ +
Sbjct: 580 KRTCHEPGQCQTICKQICGLPRKFCEHKCFARCHPGKDCPDEACQVKVKVTCSCGRKESI 639

Query: 669 KPCXXXXXXXXXXXXXHLECDXXXXXXXXXXXXKAAFGIVNGLGDDKTSVAIERIQNRIS 728
            PC              L CD              AFGI      +K +  +E +++ + 
Sbjct: 640 LPCDAHADQPSSKLLITLPCDDKCEESKRHRMLMEAFGI-----KEKLTAPVEELRDLVE 694

Query: 729 VAKAYEELELPFVEAVLTVYAKQPKWCSQIEGILNKFMDEKLKSSLHFKHMKAPQRSFVH 788
            AK+++EL LPF E+ L+VY+KQ  WC+QIE  L+K M +  ++SLHFK MK PQR F+H
Sbjct: 695 SAKSFDELHLPFTESTLSVYSKQRAWCNQIESFLSKLMRDVTRTSLHFKPMKLPQRRFIH 754

Query: 789 NLADAYKIYSESQDPEPVRSVFVKKLTNGTSSKPILTLEEALPLYXXXXXXXXXXXXXXX 848
            LA+AY +YSESQD EP RSVFVKK+ N  S  P+L L EALPLY               
Sbjct: 755 ELANAYALYSESQDREPKRSVFVKKVEN-KSHIPLLCLGEALPLYHSFKQLQKERKVKEL 813

Query: 849 XARTHKTLINVEAETQTQ-QSATKYNGFLIKNLVKGTTEEDLERIFGESLKPTLVKDPQY 907
              T + L N   +         ++N FL+K +  G T+++L     E L+ TL+++P Y
Sbjct: 814 EKSTTRRLFNYTVDDANDVPHNAEFNCFLVKGVAPGVTKDELSDCLAEYLQFTLIQNPSY 873

Query: 908 LVMDESHHGFICPADYAEISINVERDMEQLIGFFDSLCKEHFIGDIVELCNIDEAL--LQ 965
             + E+    I P D+  IS NVE D+++L  +  S+CKE  I + V+L  IDE L    
Sbjct: 874 QTL-ENGDFLIYPEDHMSISENVENDIKRLAPYISSICKEKQISEGVKLYKIDENLKTFT 932

Query: 966 ENVDLEDSEEEKLTSPEVENDSDI 989
               L++ + EK  S E+  D ++
Sbjct: 933 SEEYLQEEQPEKQASFEINTDGEV 956

>KLTH0G10406g Chr7 (880042..882933) [2892 bp, 963 aa] {ON} similar
           to uniprot|P53971 Saccharomyces cerevisiae YNL023C
          Length = 963

 Score =  940 bits (2430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 467/909 (51%), Positives = 592/909 (65%), Gaps = 20/909 (2%)

Query: 68  DLMYYERAVREIAKGDSYQCMICTVEMDHTCKMYACRHCYRVFDYDCIREWALKSTQKTV 127
           D  YYE+ ++EIAKGD Y CMICTVEMD TC MYAC  CYRVFDY+CIREWA+KSTQK+V
Sbjct: 60  DQPYYEKTIKEIAKGDRYPCMICTVEMDFTCHMYACPECYRVFDYECIREWAVKSTQKSV 119

Query: 128 DKTWKCPNCYHSSKKVPLKDRPTCWCGKVVXXXXXXXXXXSCGQTCNANICPHKCLKQCH 187
            KTWKCPNCY   K VPLK+RPTCWCGK +          SCGQTC+A IC H C   CH
Sbjct: 120 TKTWKCPNCYFEKKDVPLKNRPTCWCGKNIHPEPNPLNPNSCGQTCDAPICVHGCSSTCH 179

Query: 188 LGSHPECTQLLKITCRCGRETKDIYCHESRRQKSIFHCDQECGLTLPCGIHKCRRKCHSG 247
           LG HP C ++++  CRCG+++KD++C E+R+ + +F C   CGLTLPCG+HKC+R+CH+G
Sbjct: 180 LGPHPTCMRMVQTKCRCGKKSKDVFCSEARKHQELFRCGNPCGLTLPCGVHKCQRECHNG 239

Query: 248 LCGSCPELLIDENVSGKIKCYCGLHSLKEMNCKDVAFPSSGKISRNQEDKEWVGIFDCKE 307
           +CG CPE +  E     I CYCGL SL  + C+DV   S    S++   K+W+G F C  
Sbjct: 240 VCGECPETIAKE-----INCYCGLESLPSIKCQDVKIQSK---SQDGSGKKWIGAFACSR 291

Query: 308 MRSVSYTCNEHVFVEGCIAPPTLPSTVVCPFSPNLLKTCPCGKTALQDMDCERTKCTDPI 367
           +R+V Y+C EH F E C APP++   + CP+SP  LKTCPCG+T L++M+  RTKCTDPI
Sbjct: 292 IRTVEYSCREHSFAEPCKAPPSIAGRIPCPYSPKALKTCPCGETPLENMETPRTKCTDPI 351

Query: 368 PTCDNVCNKILKCGKHRCPFTCHTGKCMDPCIQIDKMDCACERRTFLVPCQFKGKPVCKF 427
           PTCD  C K+L CG+HRCPF CHTG CM+ C   DK+ C+C  R F+VPC+F+G P C  
Sbjct: 352 PTCDATCGKLLSCGRHRCPFKCHTGTCMEICTCSDKIKCSCNSRPFIVPCKFQGPPRCNT 411

Query: 428 KCESLMSCRRHRCMEYCCSGRPYAERRKKTILRSSDRNDETLVEAEHVCLKDCNLKLSCG 487
           KCESLMSCRRHRC E CC GR  A+ R+K +  + D+ DE+LVEA+H+CLK CNLKLSCG
Sbjct: 412 KCESLMSCRRHRCAERCCDGRSLAQVREKKVFLTRDKLDESLVEAQHICLKKCNLKLSCG 471

Query: 488 IHTCQRKCHPGPCPPCLESDSNDLVCPCGKTVIPAPVRCGTTLPPCKYPCIKVIRGESDC 547
            H CQRKCHPG CPPCLESDSNDLVCPCGKTV PAPVRCGT LPPC+ PCIK ++G  DC
Sbjct: 472 RHFCQRKCHPGNCPPCLESDSNDLVCPCGKTVAPAPVRCGTVLPPCRNPCIKTLQGPLDC 531

Query: 548 GHKPMPHSCHSLDQPCPVCTAPVFKPCKCGKKDKVRTMCFQEDVSCGLPCGLPLKDCYHK 607
           GH PMPH+CHSLD+PCP CTAPVFK CKCGK  KVRT+CFQ +VSCG  CG  L  C+H 
Sbjct: 532 GHPPMPHACHSLDEPCPSCTAPVFKQCKCGKNKKVRTLCFQNNVSCGRVCGKQLVSCHHS 591

Query: 608 CQKRCHLPGECQNTCIQICNAKRSNCSHGCTQRCHKNAXXXXXXXXXXXXXXXXXGRRKL 667
           C K CH  GECQ+ C Q+C   RSNCSH C  +CH  +                 G R  
Sbjct: 592 CTKTCHREGECQSICKQVCGISRSNCSHICRFKCHTGSPCPDVPCNVTVEVKCGCGHRSS 651

Query: 668 VKPCXXXXXXXXXXXXXHLECDXXXXXXXXXXXXKAAFGIVNGLGDDKTSVAIERIQNRI 727
              C              LEC               AFG+     + +T    E I +  
Sbjct: 652 FATCAAHEGQDPADQRP-LECTEDCAAARRRLELMEAFGM-----NTETVQPTEGIVDLA 705

Query: 728 SVAK---AYEELELPFVEAVLTVYAKQPKWCSQIEGILNKFMDEKLKSSLHFKHMKAPQR 784
           ++A+    ++EL LPF EA L+++AKQ  WCSQIE  LN+ M +  K SLHFK MK PQR
Sbjct: 706 ALAEKVTTFQELMLPFTEASLSIFAKQSNWCSQIEEHLNRLMSDISKPSLHFKPMKPPQR 765

Query: 785 SFVHNLADAYKIYSESQDPEPVRSVFVKKLTNGTSSKPILTLEEALPLYXXXXXXXXXXX 844
            F+H LA AYK+Y ESQD EP RSV+VKK  +  S KP L+L+EALPLY           
Sbjct: 766 HFIHELAQAYKLYCESQDKEPKRSVYVKKTVD--SRKPSLSLKEALPLYQSFKNAQKERK 823

Query: 845 XXXXXARTHKTLINVEAETQTQQSATKYNGFLIKNLVKGTTEEDLERIFGESLKPTLVKD 904
                  T   ++N  +  ++     + NG LI+ + +GT E+ +E  F + LK TL+KD
Sbjct: 824 LKELERSTTTRILNYTSTGESSPPVAQINGLLIQKVFEGTDEKTIEACFADYLKHTLIKD 883

Query: 905 PQYLVMDESHHGFICPADYAEISINVERDMEQLIGFFDSLCKEHFIGDIVELCNIDEALL 964
           P YL +D S    +   +YA  SINVERD+ +++G  D + K+ F+ + V +C +++ + 
Sbjct: 884 PNYLKLD-SGDVMVFAENYATASINVERDINRVVGHLDLIAKDSFLAEGVTVCRVEQVMA 942

Query: 965 QENVDLEDS 973
           +E    ++S
Sbjct: 943 EETNRSDES 951

>TPHA0D01530 Chr4 complement(313063..315951) [2889 bp, 962 aa] {ON}
           Anc_2.288 YNL023C
          Length = 962

 Score =  920 bits (2377), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/932 (48%), Positives = 610/932 (65%), Gaps = 17/932 (1%)

Query: 55  DESDVDTDNEYEEDLMYYERAVREIAKGDSYQCMICTVEMDHTCKMYACRHCYRVFDYDC 114
           +ES+ D+  + ++ L+YYE+ +R+I+KGD Y CMICT+EMD+TCKMYAC+ CYRVFDY+C
Sbjct: 31  NESNFDSSEDEDDGLVYYEQTIRDISKGDRYTCMICTIEMDYTCKMYACQSCYRVFDYEC 90

Query: 115 IREWALKSTQKTVDKTWKCPNCYHSSKKVPLKDRPTCWCGKVVXXXXXXXXXXSCGQTCN 174
           I+EWA KS  KT+DK WKCPNC HSSK++PL++RPTCWCGKV+          SCGQTCN
Sbjct: 91  IQEWAEKSASKTIDKVWKCPNCSHSSKQIPLRNRPTCWCGKVINPDPNELSPNSCGQTCN 150

Query: 175 ANICPHKCLKQCHLGSHPECTQLLKITCRCGRETKDIYCHESRR--QKSIFHCDQECGLT 232
              C H C   CHLG H EC+ +  + C+CGR  KDI+CH+ ++  + +++ C++ C L 
Sbjct: 151 KKTCVHGCKNFCHLGPHGECSVITTLKCKCGRNEKDIFCHQLKKSNKNNVYQCNEVCQLP 210

Query: 233 LPCGIHKCRRKCHSGLCGSCPELL-------IDENVSGKIKCYCGLHSLKEMNCKDVAFP 285
           L CG+HKC+R CHSGLCG+CPE+L       ++ N + K KCYCG +S  E+ CK +A  
Sbjct: 211 LACGVHKCKRVCHSGLCGACPEILSSEQIQSVESNENRKFKCYCGENSKNEIMCKKLAI- 269

Query: 286 SSGKISRNQEDKEWVGIFDCKEMRSVSYTCNEHVFVEGCIAPPTLPSTVVCPFSPNLLKT 345
            +G  S+N E  +W+G F CK  R V Y CNEH F+E C A  ++    +CP++P LL +
Sbjct: 270 -TGTFSKNSEGDKWIGTFACKTRRIVFYACNEHSFIEPCQAQLSISGKKICPYTPKLLNS 328

Query: 346 CPCGKTALQDMDCERTKCTDPIPTCDNVCNKILKCGKHRCPFTCHTGKCMDPCIQIDKMD 405
           CPCGKT+L+ +  +R KCTDPIPTC+N C K LKCGKH CP+ CH G CMDPCIQ++  +
Sbjct: 329 CPCGKTSLKQLAQKRKKCTDPIPTCENRCGKALKCGKHTCPYICHNGSCMDPCIQLEVTN 388

Query: 406 CACERRTFLVPCQFKGKPVCKFKCESLMSCRRHRCMEYCCSGRPYAERRKKTILRSSDRN 465
           C+C ++ FLVPC F+  P C FKCESLMSCRRHRC + CC+G+P A++RKK +L   + N
Sbjct: 389 CSCLQKHFLVPCNFEQTPKCTFKCESLMSCRRHRCPKKCCTGKPEADKRKKMLLTREELN 448

Query: 466 DETLVEAEHVCLKDCNLKLSCGIHTCQRKCHPGPCPPCLESDSNDLVCPCGKTVIPAPVR 525
           DE+LVEA H+CLK+CNLKLSCGIH C RKCHPG CP CL SDSNDLVCPCGKTVI APVR
Sbjct: 449 DESLVEAVHICLKECNLKLSCGIHDCTRKCHPGRCPSCLISDSNDLVCPCGKTVIEAPVR 508

Query: 526 CGTTLPPCKYPCIKVIRGESDCGHKPMPHSCHSLDQPCPVCTAPVFKPCKCGKKDKVRTM 585
           CG+ LPPC + CIKVI     CGHKP PH CH   +PCP CTA V +PCKCGK   V+ +
Sbjct: 509 CGSKLPPCPFECIKVIERSYPCGHKPPPHQCHPSTEPCPPCTAVVERPCKCGKHHAVKAV 568

Query: 586 CFQEDVSCGLPCGLPLKDCYHKCQKRCHLPGECQNTCIQICNAKRSNCSHGCTQRCHKNA 645
           CFQE  SCG  C   L++C+HKCQ +CH  G+CQ +C Q+CN  R+NC+H C  +CH ++
Sbjct: 569 CFQEFGSCGEICNKELENCHHKCQYKCHEIGQCQKSCKQVCNKDRANCNHQCKSKCHGSS 628

Query: 646 XXXXXXXXXXXXXXXXXGRRKLVKPCXXXXXXXXXXXXXHLECDXXXXXXXXXXXXKAAF 705
                            GR++  + C              L CD            + AF
Sbjct: 629 PCPDVPCNEVTKVSCKCGRKQEYRKCYATLDNSSASIEL-LPCDEDCEAHARHLQLRDAF 687

Query: 706 GIVNGLGDDKTSVAIERIQNRISVAKAYEELELPFVEAVLTVYAKQPKWCSQIEGILNKF 765
           G  + L  D ++  I+ IQ+ +     YEEL LP+ ++V++ Y+KQ KWCSQIE IL KF
Sbjct: 688 GYDSSL--DTSNKNIQDIQSLMEKVSTYEELRLPYPQSVISTYSKQIKWCSQIEDILRKF 745

Query: 766 MDEKLKSSLHFKHMKAPQRSFVHNLADAYKIYSESQDPEPVRSVFVKKLTNGTSSKPILT 825
           + +K K++LHFK MK  QR FV  L+ ++ +YSESQDPEP RSVFVK+  +  +  P ++
Sbjct: 746 VLDKAKNNLHFKPMKPAQRHFVRELSTSFNLYSESQDPEPKRSVFVKRKVD--TRIPNIS 803

Query: 826 LEEALPLYXXXXXXXXXXXXXXXXARTHKTLINVEAETQTQQSATKYNGFLIKNLVKGTT 885
           LEE LPL+                + + +  IN E +    +S+   NGF IK +  G T
Sbjct: 804 LEEVLPLWTGFKKLEKERKIQHFESTSQRKYINYEPKEVIVKSSNDTNGFFIKKISPGIT 863

Query: 886 EEDLERIFGESLKPTLVKDPQYLVMDESHHGFICPADYAEISINVERDMEQLIGFFDSLC 945
           EEDL  +FG++LK TL+K+  Y ++ ES    I P  Y  I+ +V +D+E L+G FD + 
Sbjct: 864 EEDLSEVFGKALKSTLIKNVCYKILPESSDAIIYPEQYNSITESVHQDLEVLVGHFDFIG 923

Query: 946 KEHFIGDIVELCNIDEALLQENVDLEDSEEEK 977
           KE  I D + LCN+ E  + +  D  D+++EK
Sbjct: 924 KEALIFDSIMLCNV-EGYINQISDCTDTDKEK 954

>Kwal_27.11518 s27 complement(832986..835847) [2862 bp, 953 aa] {ON}
           YNL023C (FAP1) - Transcription factor homolog;
           similarity to Drosophila melanogaster shuttle craft
           protein; similarity to human NFX1 protein; similarity to
           human DNA-binding protein tenascin [contig 27] FULL
          Length = 953

 Score =  890 bits (2301), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/928 (49%), Positives = 584/928 (62%), Gaps = 19/928 (2%)

Query: 54  EDESDVDTDNEYEEDLMYYERAVREIAKGDSYQCMICTVEMDHTCKMYACRHCYRVFDYD 113
           ED   V+ + +  ED  YYE+ V+EI KGD Y CMICTVEMD TC MYAC  CYRVFD++
Sbjct: 28  EDFEHVEDEIDELEDQPYYEKTVKEIEKGDRYPCMICTVEMDFTCHMYACPDCYRVFDFE 87

Query: 114 CIREWALKSTQKTVDKTWKCPNCYHSSKKVPLKDRPTCWCGKVVXXXXXXXXXXSCGQTC 173
           CIREWALKSTQK+V KTWKCPNCY   K+VP+K+RPTCWCGK V          SCGQTC
Sbjct: 88  CIREWALKSTQKSVSKTWKCPNCYFERKEVPMKNRPTCWCGKSVQPEPNPLNPNSCGQTC 147

Query: 174 NANICPHKCLKQCHLGSHPECTQLLKITCRCGRETKDIYCHESRRQKSIFHCDQECGLTL 233
           +A IC H C   CHLG HP C +++++ C CG++ K ++CHE+ +    F CD  CGLTL
Sbjct: 148 DAQICEHGCSSICHLGPHPTCMRMVQVKCNCGKKNKSVFCHEAGKFVDSFICDSPCGLTL 207

Query: 234 PCGIHKCRRKCHSGLCGSCPELLIDENVSGKIKCYCGLHSLKEMNCKDVAFPSSGKISRN 293
           PCGIHKC+RKCHSG+CG CPE     ++ G I CYC L S   + C +V        SR+
Sbjct: 208 PCGIHKCQRKCHSGICGECPE-----SIYGTINCYCKLESKPSLKCTEVRIEGR---SRD 259

Query: 294 QEDKEWVGIFDCKEMRSVSYTCNEHVFVEGCIAPPTLPSTVVCPFSPNLLKTCPCGKTAL 353
               +WVG F C+ +R+V ++C +H F E C APP++   V CPFSP  LKTCPCG++ L
Sbjct: 260 SSGNKWVGAFSCENIRTVEHSCKKHSFAEPCKAPPSISGQVPCPFSPRTLKTCPCGRSPL 319

Query: 354 QDMDCERTKCTDPIPTCDNVCNKILKCGKHRCPFTCHTGKCMDPCIQIDKMDCACERRTF 413
           ++MD  R++CTDPIPTCD+VC K+L+CGKH+CPF CHTG CM+ C+  DK+ C+C  R F
Sbjct: 320 REMDVSRSQCTDPIPTCDSVCGKMLRCGKHKCPFKCHTGSCMEECLCTDKVKCSCHARQF 379

Query: 414 LVPCQFKGKPVCKFKCESLMSCRRHRCMEYCCSGRPYAERRKKTILRSSDRNDETLVEAE 473
           +VPC+F+ K  C  KCE+LMSCRRHRC+E CC GR  A+ R+K +  + D+ DE+LVEA+
Sbjct: 380 IVPCKFQEKARCNTKCEALMSCRRHRCIERCCDGRSLAQSREKKVFLTRDKLDESLVEAQ 439

Query: 474 HVCLKDCNLKLSCGIHTCQRKCHPGPCPPCLESDSNDLVCPCGKTVIPAPVRCGTTLPPC 533
           H+CLK CNLKLSCG H C+RKCHPG C PCLESDSNDLVCPCGKTV+PAPVRCGT LP C
Sbjct: 440 HICLKQCNLKLSCGKHFCKRKCHPGNCAPCLESDSNDLVCPCGKTVVPAPVRCGTVLPRC 499

Query: 534 KYPCIKVIRGESDCGHKPMPHSCHSLDQPCPVCTAPVFKPCKCGKKDKVRTMCFQEDVSC 593
            +PCIK ++G + CGH PMPH CH L++PCP CTAPVFK CKC K DKVRT+CFQ DVSC
Sbjct: 500 LHPCIKTLQGPAPCGHPPMPHPCHPLEEPCPSCTAPVFKSCKCRKNDKVRTLCFQNDVSC 559

Query: 594 GLPCGLPLKDCYHKCQKRCHLPGECQNTCIQICNAKRSNCSHGCTQRCHKNAXXXXXXXX 653
           G  CG  L  C H CQK CH  GECQ +C Q C   R NC H C   CH           
Sbjct: 560 GRVCGKQLAGCQHICQKACHKEGECQTSCKQPCGKTRENCEHRCRALCHSGTPCPDKPCL 619

Query: 654 XXXXXXXXXGRRKLVKPCXXXXXXXXXXXXXHLECDXXXXXXXXXXXXKAAFGIVNGLGD 713
                    G R     C              LEC+              AFGI N    
Sbjct: 620 NLVDIKCNCGHRSTTVTCGANENRAPAEETA-LECNNDCDVARRHHELMEAFGIKNDA-- 676

Query: 714 DKTSVAIERIQNRISVAKAYEELELPFVEAVLTVYAKQPKWCSQIEGILNKFMDEKLKSS 773
           ++ S ++E ++        ++EL LPF EA L++++KQ  WC+QIE  L + M++K K S
Sbjct: 677 NQGSKSLEDLEALAEKVSTFQELLLPFSEATLSIFSKQTTWCTQIEECLERLMNDKNKPS 736

Query: 774 LHFKHMKAPQRSFVHNLADAYKIYSESQDPEPVRSVFVKKLTNGTSSKPILTLEEALPLY 833
           LHFK M+ PQR F+H L  AY +Y ESQD EP RSVFVKK  +  S +P ++L+ ALPLY
Sbjct: 737 LHFKPMRPPQRHFIHELGQAYHLYCESQDQEPKRSVFVKKTAD--SQRPSISLKVALPLY 794

Query: 834 XXXXXXXXXXXXXXXXARTHKTLINVEAETQTQQ-SATKYNGFLIKNLVKGTTEEDLERI 892
                             T   +IN     Q Q   A ++NG L++N++ G  E+ ++  
Sbjct: 795 YSFKSAQREKKLKETERHTTTRIINYAVTDQAQTPPAARFNGLLVQNVLNGINEKAIQES 854

Query: 893 FGESLKPTLVKDPQYLVMDESHHGFICPADYAEISINVERDMEQLIGFFDSLCKEHFIGD 952
           F E LK TL+KDP YL++        C  DY+  S+NVE D+E+++G  D + KE  + +
Sbjct: 855 FSEYLKHTLLKDPHYLLLASGDVLVYC-DDYSTASVNVENDIERIVGHLDHIVKEQLLAE 913

Query: 953 IVELCNIDEALLQENVDLEDSEEEKLTS 980
            V    +   L     DLE S  +  TS
Sbjct: 914 GVYATRVQSFL----DDLESSTSDAATS 937

>Ecym_3327 Chr3 (626396..629176) [2781 bp, 926 aa] {ON} similar to
           Ashbya gossypii ADL213W
          Length = 926

 Score =  839 bits (2167), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/901 (47%), Positives = 559/901 (62%), Gaps = 20/901 (2%)

Query: 54  EDESDVDTDNEYEED-LMYYERAVREIAKGDSYQCMICTVEMDHTCKMYACRHCYRVFDY 112
           E+ S  D  +E ++D L YYE+A+++I  G  YQC+ICTVE+D TC+MYAC +CYRV+DY
Sbjct: 12  EEVSYSDYLSEADDDGLPYYEKAIKDIQNGYLYQCLICTVEIDSTCRMYACSNCYRVYDY 71

Query: 113 DCIREWALKSTQKTVDKTWKCPNCYHSSKKVPLKDRPTCWCGKVVXXXXXXXXXXSCGQT 172
           +CI EWA KS++++ D TWKCPNCYHS  KV  K R TCWCGK +          SCGQT
Sbjct: 72  ECIMEWAKKSSKRSADSTWKCPNCYHSYNKVLPKKRSTCWCGKQINPEKNATYPNSCGQT 131

Query: 173 CNANICPHKCLKQCHLGSHPECTQLLKITCRCGRETKDIYCHESRRQKSIFHCDQECGLT 232
           C A+IC H C   CHLG HP+C   + + C+CG+ T+ I C++++  K    C   CGL 
Sbjct: 132 CGASICKHGCASTCHLGPHPKCMVPVGLKCKCGKITEQISCYQTKAVKPKLSCKLPCGLP 191

Query: 233 LPCGIHKCRRKCHSGLCGSCPELLIDENVSGKIKCYCGLHSLKEMNCKDVAFPSSGKISR 292
           LPCG+H C++ CHSG CG C  ++     SGK KCYCG + L  + CKDVA     K+SR
Sbjct: 192 LPCGVHTCQKICHSGPCGRCNTVM-----SGKFKCYCGSNHLDSIICKDVAV---TKMSR 243

Query: 293 NQEDKEWVGIFDCKEMRSVSYTCNEHVFVEGCIAPPTLPSTVVCPFSPNLLKTCPCGKTA 352
           + + K+W+G+F CK +R V Y C EH F E C   P+  + + CP+SPN+ KTC CG T 
Sbjct: 244 SGKHKKWIGVFSCKNIREVRYRCKEHSFNESCKPSPSPDARIQCPYSPNICKTCCCGNTT 303

Query: 353 LQDMDCERTKCTDPIPTCDNVCNKILKCGKHRCPFTCHTGKCMDPCIQIDKMDCACERRT 412
           L DM  +R KCTDPIPTCD  C K L CGKH CP TCH GKCMDPC+QI++  C+C+ RT
Sbjct: 304 LIDMQQKREKCTDPIPTCDQRCGKPLSCGKHTCPMTCHPGKCMDPCLQIEERKCSCQERT 363

Query: 413 FLVPCQFKGKPVCKFKCESLMSCRRHRCMEYCCSGRPYAERRKKTILRSSDRNDETLVEA 472
           FL PCQF GKP C  KCE+LMSCRRHRC++ CCSG+P A  R  TI    D+NDE+L+EA
Sbjct: 364 FLTPCQFDGKPSCNIKCENLMSCRRHRCIKRCCSGKPLALARSSTITPWLDKNDESLIEA 423

Query: 473 EHVCLKDCNLKLSCGIHTCQRKCHPGPCPPCLESDSNDLVCPCGKTVIPAPVRCGTTLPP 532
           EH+C K+CN KLSCG+H C  KCHPG CPPCLESDSNDLVCPCGK+VI APVRCGT  P 
Sbjct: 424 EHICFKNCNRKLSCGLHHCTNKCHPGKCPPCLESDSNDLVCPCGKSVILAPVRCGTVRPN 483

Query: 533 CKYPCIKVIRGESDCGHKPMPHSCHSLDQPCPVCTAPVFKPCKCGKKDKVRTMCFQEDVS 592
           C YPCI  +RG   CGH+   H CH   + CP CTA V+KPCKCGK    RT+CFQ D+S
Sbjct: 484 CNYPCINTLRGSMPCGHRAPFHKCHPSTEDCPPCTAFVYKPCKCGKLTAARTICFQNDIS 543

Query: 593 CGLPCGLPLKDCYHKCQKRCHLPGECQNTCIQICNAKRSNCSHGCTQRCHKNAXXXXXXX 652
           CG  C   L +C+H CQK+CH PGEC NTC ++C  KRS C H CT  CH +        
Sbjct: 544 CGRKCAAKLTNCHHLCQKQCHPPGECPNTCTEVCGLKRSACEHLCTANCHGDEICPDVPC 603

Query: 653 XXXXXXXXXXGRRKLVKPCXXXXXXXXXXXXXHLECDXXXXXXXXXXXXKAAFGIVNGLG 712
                     GRR L  PC              L CD            K    +     
Sbjct: 604 LEEVVVSCGCGRRSLKVPCGAYKDKESATATQSLLCD-----DDCAKVQKHQMLLQTLRS 658

Query: 713 DDKTSVAIERIQNRISVAKAYEELELPFVEAVLTVYAKQPKWCSQIEGILNKFMDEKLKS 772
            + T+ A     + I+   +YE+L LP+ E ++ V++KQ  WC  I+  L + +++K + 
Sbjct: 659 SESTNKAEHGSSSVINKPTSYEDLGLPYSEQMMCVFSKQATWCKNIQDSLIRLLEDKSRK 718

Query: 773 SLHFKHMKAPQRSFVHNLADAYKIYSESQDPEPVRSVFVKKLTNGTSSKPILTLEEALPL 832
           SLHFK MKAPQR FVH L+ A+ +YSESQD EP RSVFVK L   TS  P + L EAL L
Sbjct: 719 SLHFKPMKAPQRQFVHELSKAFGLYSESQDREPKRSVFVKILK--TSKIPAIGLSEALLL 776

Query: 833 YXXXXXXXXXXXXXXXXARTHKTLINVEAE--TQTQQSATKYNGFLIKNLVKGTTEEDLE 890
           Y                  T K LI++  +  + ++      N  LI  + +  T E+++
Sbjct: 777 YQRMKTFQKERRDLELQHNTTKILISIPIDDGSDSKTLEASCNAILITGVPRTVTVENIK 836

Query: 891 RIFGESLKPTLVKDPQYLVMDESHHGFICPADYAEISINVERDMEQLIGFFDSLCKEHFI 950
             F E LK TL+KDPQ+ +++   + +I P+++ EIS NVE D+++L+ +F  +C+   I
Sbjct: 837 ACFDECLKQTLLKDPQFRLINS--NAYIYPSNFLEISANVETDIQRLVPYFSHVCERKQI 894

Query: 951 G 951
           G
Sbjct: 895 G 895

>KLLA0E08317g Chr5 complement(747272..750037) [2766 bp, 921 aa] {ON}
           similar to uniprot|P53971 Saccharomyces cerevisiae
           YNL023C
          Length = 921

 Score =  830 bits (2143), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/899 (47%), Positives = 548/899 (60%), Gaps = 17/899 (1%)

Query: 68  DLMYYERAVREIAKGDSYQCMICTVEMDHTCKMYACRHCYRVFDYDCIREWALKSTQKTV 127
           ++ YYE+ V+EI  GD Y CMICTVE+D TC+MYAC  CYRVFDY+C+REWALKST KT+
Sbjct: 31  NIPYYEQTVKEIKDGDQYVCMICTVELDSTCRMYACDSCYRVFDYECVREWALKSTNKTL 90

Query: 128 DKTWKCPNCYHSSKKVPLKDRPTCWCGKVVXXXXXXXXXXSCGQTCNANICPHKCLKQCH 187
           DK+WKCPNCY  + K+P + R TCWCGKVV          SCGQTCNA  C H C K CH
Sbjct: 91  DKSWKCPNCYKINHKIPKQKRSTCWCGKVVNPDVNELDPNSCGQTCNAYSCVHGCSKVCH 150

Query: 188 LGSHPECTQLLKITCRCGRETKDIYCHESRRQKSIFHCDQECGLTLPCGIHKCRRKCHSG 247
           LG HPEC   ++I C+CG+  K I C  S+   + ++C   CGL LPCG H C++ CH+G
Sbjct: 151 LGPHPECLIPVQIKCKCGKHCKQIPCSRSKVLGNSYNCGDVCGLLLPCGKHTCQKTCHTG 210

Query: 248 LCGSCPELLIDENVSGKIKCYCGLHSLKEMNCKDVAFPSSGKISRNQEDKEWVGIFDCKE 307
            CG C  ++  E     + CYCG      + C D+        S++   K+W+G++ C E
Sbjct: 211 FCGPCESIIKTE-----LPCYCGSDVKSGIQCSDLRVLD---YSKDVSGKKWIGVYSCGE 262

Query: 308 MRSVSYTCNEHVFVEGCIAPPTLPSTVVCPFSPNLLKTCPCGKTALQDMDCERTKCTDPI 367
           +R++ Y+C+ H +VE C+AP  +  +  CPFSP  LKTCPCGKT L+++D  R KCTD I
Sbjct: 263 VRTLHYSCDHHTYVEQCLAPAGIDRSRPCPFSPKTLKTCPCGKTMLKELDKPRRKCTDTI 322

Query: 368 PTCDNVCNKILKCGKHRCPFTCHTGKCMDPCIQIDKMDCACERRTFLVPCQFKGKPVCKF 427
           PTC NVC K L CGKH CPF+CHTG CMDPC+ I K  C C  +TFL PCQ    P C  
Sbjct: 323 PTCSNVCGKQLSCGKHTCPFSCHTGDCMDPCLIITKTPCTCHSKTFLTPCQLHDTPRCNI 382

Query: 428 KCESLMSCRRHRCMEYCCSGRPYAERRKKTILRSSDRNDETLVEAEHVCLKDCNLKLSCG 487
           KCES MSCRRH+CME CCSG+P A++R+KT+    D N+ETLVE EHVCLK CNLKLSCG
Sbjct: 383 KCESNMSCRRHKCMEICCSGKPAAKKREKTLFLKRDLNNETLVEPEHVCLKQCNLKLSCG 442

Query: 488 IHTCQRKCHPGPCPPCLESDSNDLVCPCGKTVIPAPVRCGTTLPPCKYPCIKVIRGESDC 547
           IH C  KCHPG CPPCLESD NDLVCPCGKTV+PAPVRCGT LPPC  PCIK+  G + C
Sbjct: 443 IHDCTWKCHPGKCPPCLESDPNDLVCPCGKTVVPAPVRCGTKLPPCPNPCIKISEGPAPC 502

Query: 548 GHKPMPHSCHSLDQPCPVCTAPVFKPCKCGKKDKVRTMCFQED--VSCGLPCGLPLKDCY 605
           GH+  PH CH     CP CTA V K C+C KK  +RT+C   D  V+CG  CGLPL  C+
Sbjct: 503 GHRVGPHKCHPAGTDCPPCTANVIKKCRCYKKHDMRTLCLVPDSQVACGTECGLPLATCH 562

Query: 606 HKCQKRCHLPGECQNTCIQICNAKRSNCSHGCTQRCHKNAXXXXXXXXXXXXXXXXXGRR 665
           HKCQK+CH+ GEC+  C + C  KRS C H C ++CH N+                  RR
Sbjct: 563 HKCQKKCHVEGECEIKCAKPCGLKRSLCGHLCKEKCHGNSPCPEKVCHEKVVITCDCNRR 622

Query: 666 KLVKPCXXXXXXXXXXXXXHLECDXXXXXXXXXXXXKAAFGIVNGLGDDKTSVAIERIQN 725
                C              L CD              AFG+     ++K     E++++
Sbjct: 623 TKQVECGATHDTQSRSETEKLPCDEECAKLQRHMELMEAFGM-----NEKPKNTKEQLES 677

Query: 726 RISVAKAYEELELPFVEAVLTVYAKQPKWCSQIEGILNKFMDEKLKSSLHFKHMKAPQRS 785
            + VAK +++L +P+ E VL VY KQ  WC QI  + +KF+++  K SLH K M+ PQR 
Sbjct: 678 IVLVAKKFDDLNMPYSELVLNVYKKQVNWCDQICAVFDKFIEDTQKLSLHLKPMRVPQRQ 737

Query: 786 FVHNLADAYKIYSESQDPEPVRSVFVKKLTNGTSSKPILTLEEALPLYXXXXXXXXXXXX 845
           F+  LA AY +YSESQD EP RSV++KK+    S KP LTL++A  LY            
Sbjct: 738 FIKELASAYALYSESQDREPNRSVYLKKI-QSQSKKPELTLKDASELYQLFKTLEKERMQ 796

Query: 846 XXXXARTHKTLINVEA-ETQTQQSATKYNGFLIKNLVKGTTEEDLERIFGESLKPTLVKD 904
                +  KTLIN+ A ET         N  +I  +   +  +++E +  + LK TLVK 
Sbjct: 797 EHYSTKVTKTLINIPASETPLPAPYEGPNAIVISGVFDSSQIDNIEPLVHDFLKYTLVKT 856

Query: 905 PQYLVMDESHHGFICPADYAEISINVERDMEQLIGFFDSLCKEHFIGDIVELCNIDEAL 963
           PQY  + + +   I P +Y+ I+ N   DME++I F  +  ++  +   VE+C +DE L
Sbjct: 857 PQYRFLKDLNSVLIFPENYSGITKNTASDMEKVIPFIKTALQDQMLATGVEMCQVDENL 915

>ADL213W Chr4 (329646..332372) [2727 bp, 908 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL023C (FAP1)
          Length = 908

 Score =  811 bits (2096), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/901 (47%), Positives = 535/901 (59%), Gaps = 26/901 (2%)

Query: 67  EDLMYYERAVREIAKGDSYQCMICTVEMDHTCKMYACRHCYRVFDYDCIREWALKSTQKT 126
           E + YYE+ V E+  G++YQC+ICTVEMD +C MYAC  CYRV+DY+CIR WALK+T  T
Sbjct: 14  EGIPYYEQTVLELRDGETYQCLICTVEMDASCPMYACHQCYRVYDYECIRRWALKATSTT 73

Query: 127 VDKTWKCPNCYHSSKKVPLKDRPTCWCGKVVXXXXXXXXXXSCGQTCNANICPHKCLKQC 186
           VD+TWKCPNCYH ++KVP K+R TCWCGK V          SCGQTC A IC H C K C
Sbjct: 74  VDRTWKCPNCYHVNRKVPPKNRHTCWCGKQVNLDPNYINPNSCGQTCGAPICQHGCSKLC 133

Query: 187 HLGSHPECTQLLKITCRCGRETKDIYCHESRRQKSIFHCDQECGLTLPCGIHKCRRKCHS 246
           HLG H EC   +   CRCG+ T++I C+E++  K  F CDQ CGL +PCGIHKC R CH+
Sbjct: 134 HLGPHEECMVRIDFKCRCGKLTEEIPCYEAKAAKRNFSCDQPCGLPMPCGIHKCERVCHN 193

Query: 247 GLCGSCPELLIDENVSGKIKCYCGLHSLKEMNCKDVAFPSSGKISRNQEDKEWVGIFDCK 306
           G CG C      E ++G IKCYCGL +  +M C +V+  +  K+S+    K W+G F C 
Sbjct: 194 GPCGPC-----KEEIAGDIKCYCGLTTRNKMVCSEVSVVARSKVSKY---KSWIGAFACD 245

Query: 307 EMRSVSYTCNEHVFVEGCIAPPTLPSTVVCPFSPNLLKTCPCGKTALQDMDCERTKCTDP 366
            MR V Y+C +H F E CIAPP+LP    CP+SP    TCPCGKT L ++   RT CTD 
Sbjct: 246 RMREVPYSCGKHSFHEKCIAPPSLPKRTPCPYSPENCTTCPCGKTQLAELGSTRTACTDH 305

Query: 367 IPTCDNVCNKILKCGKHRCPFTCHTGKCMDPCIQIDKMDCACERRTFLVPCQFKGKPVCK 426
           I +C  VC K L CG H CP TCH G CMDPC+ I +  CACE+R FLVPCQF   P C 
Sbjct: 306 ISSCGKVCGKQLSCGNHTCPMTCHDGNCMDPCLVITEQKCACEQRRFLVPCQFPHSPSCT 365

Query: 427 FKCESLMSCRRHRCMEYCCSGRPYAERRKKTILRSSDRNDETLVEAEHVCLKDCNLKLSC 486
            KCESLMSCRRHRC E CCSGRP++ +R     R S  +DE+ VEA+HVCLKDCN  L C
Sbjct: 366 AKCESLMSCRRHRCAERCCSGRPHSVKRNSRRRRESP-DDESEVEAQHVCLKDCNRVLLC 424

Query: 487 GIHTCQRKCHPGPCPPCLESDSNDLVCPCGKTVIPAPVRCGTTLPPCKYPCIKVIRGESD 546
           GIH C  KCH G CPPCLESDSNDL+CPCGKT++PAPVRCGT LP C +PC   +     
Sbjct: 425 GIHMCNYKCHAGKCPPCLESDSNDLICPCGKTIVPAPVRCGTKLPRCTHPCRNSLLDTWP 484

Query: 547 CGHKPMPHSCHSLDQPCPVCTAPVFKPCKCGKKDKVRTMCFQEDVSCGLPCGLPLKDCYH 606
           CGH P  H+CH LD+PCP CT  V K C+CG K+++RT C+ +DVSC  PC  PL  C H
Sbjct: 485 CGHSPPSHNCHPLDEPCPPCTITVKKTCRCG-KNEIRTFCYNDDVSCSRPCKKPLSYCNH 543

Query: 607 KCQKRCHLPGECQNTCIQICNAKRSNCSHGCTQRCHKNAXXXXXXXXXXXXXXXXXGRRK 666
            CQ  CH  G+CQ TC Q C   R  C H C  +CH +                  G + 
Sbjct: 544 FCQVPCHSDGQCQQTCKQACGLPRKACEHVCKAKCHGHTACPESPCTEKKTITCSCGHKS 603

Query: 667 LVKPCXXXXXX-XXXXXXXHLECDXXXXXXXXXXXXKAAFGIVNGLG--DDKTSVAIERI 723
             K C              HL CD              AFG+V      +D+  +  +R 
Sbjct: 604 STKICSEYAGKDDGIGASQHLSCDEDCAKFQRHQQLMRAFGVVEKATSEEDEALLLAQRS 663

Query: 724 QNRISVAKAYEELELPFVEAVLTVYAKQPKWCSQIEGILNKFMDEKLKSSLHFKHMKAPQ 783
           Q       ++++L LPF E VL+V+ KQ +WC+QIE  L K MD+    +LHFK M+A Q
Sbjct: 664 Q-------SFDDLHLPFTEYVLSVFTKQSQWCTQIEQYLIKLMDDSSPKALHFKPMRAAQ 716

Query: 784 RSFVHNLADAYKIYSESQDPEPVRSVFVKKLTNGTSSKPILTLEEALPLYXXXXXXXXXX 843
           R FVH L+ ++ +YSESQDPEP RSV+VKK   G S  P + L +A PLY          
Sbjct: 717 RRFVHELSSSFGLYSESQDPEPKRSVYVKK--TGISRVPAIGLSKAAPLYTSFKKLEREF 774

Query: 844 XXXXXXARTHKTL-INVEAETQTQQSATKYNGFLIKNLVKGTTEEDLERIFGESLKPTLV 902
                 A T K + ++++   ++Q  A   N  L+  L    +E  L   F +    TL+
Sbjct: 775 KANSESAVTKKLVSVHIDDSPESQHDAA-INAILLSGLTSFASESALRDCFADYFSQTLL 833

Query: 903 KDPQYLVMDESHHGFICPADYAEISINVERDMEQLIGFFDSLCKEHFIGDIVELCNIDEA 962
             PQY+V      G+I P DY  +S N E+D+ +L G+F  L +E  +   +  C +D  
Sbjct: 834 NCPQYVV--RGTEGYIFPTDYLSLSANAEKDLTKLAGYFRLLFQEQNLWTDISTCKLDSN 891

Query: 963 L 963
           L
Sbjct: 892 L 892

>KLLA0E00551g Chr5 complement(45755..46483) [729 bp, 242 aa] {ON}
           similar to uniprot|P10080 Saccharomyces cerevisiae
           YHL034C SBP1 Single-strand nucleic acid binding protein
          Length = 242

 Score = 37.7 bits (86), Expect = 0.10,   Method: Composition-based stats.
 Identities = 26/84 (30%), Positives = 39/84 (46%), Gaps = 15/84 (17%)

Query: 862 ETQTQQSATKYNGFLIKNLVKGTTEEDLERIFGESLK---PTLVKDPQYLVMDESHHGFI 918
           ET T+          + NL   T+ EDL+++FGES+K   PTL  D  Y           
Sbjct: 6   ETSTKIVVDPETSIFVGNLSPETSPEDLQKVFGESVKVEIPTLQSDRTY----------- 54

Query: 919 CPADYAEISINVERDMEQLIGFFD 942
            P  +A ++ + + D+E L   FD
Sbjct: 55  -PRIFAFVTFDDKVDVEDLRSKFD 77

>TPHA0E01180 Chr5 (240374..241345) [972 bp, 323 aa] {ON} Anc_5.339
           YDR313C
          Length = 323

 Score = 32.0 bits (71), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 38/83 (45%), Gaps = 3/83 (3%)

Query: 54  EDESDVDTDNEYEEDLMYYERAVREIAKG--DSYQCMICTVEMDHTCKMYACRHCYRVFD 111
           ED + +   N+Y+  ++ +     +  K   D  +C IC   M+   K+ A   C  VF 
Sbjct: 229 EDGNPLSFRNKYKNRMLVFRVRDNKTKKSSEDEDECPICFETMEPGEKI-ARLECLCVFH 287

Query: 112 YDCIREWALKSTQKTVDKTWKCP 134
           Y CI+ W  K  QKT +   K P
Sbjct: 288 YTCIKSWMKKKIQKTKESQGKIP 310

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.136    0.451 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 98,954,950
Number of extensions: 4167149
Number of successful extensions: 13238
Number of sequences better than 10.0: 64
Number of HSP's gapped: 12391
Number of HSP's successfully gapped: 68
Length of query: 995
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 876
Effective length of database: 39,836,145
Effective search space: 34896463020
Effective search space used: 34896463020
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 71 (32.0 bits)