Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0B059402.287ON36936919330.0
TDEL0G021802.287ON36936915650.0
NCAS0B062502.287ON37337415640.0
KNAG0A054202.287ON37237215450.0
YIL094C (LYS12)2.287ON37137215320.0
Smik_9.852.287ON37137215310.0
SAKL0E07656g2.287ON36836915310.0
Suva_9.1052.287ON37137215250.0
Skud_9.792.287ON37137215230.0
CAGL0G02585g2.287ON37236615110.0
NDAI0B035502.287ON37237215080.0
KLLA0E08339g2.287ON36936915080.0
Kwal_27.115282.287ON36736914910.0
KAFR0J013602.287ON37337314880.0
KLTH0G10384g2.287ON36736914860.0
TPHA0C034102.287ON37137114860.0
ZYRO0A01914g2.287ON36837014610.0
Kpol_1003.392.287ON37037214530.0
Ecym_33262.287ON36636914030.0
ADL214C2.287ON36736913300.0
NDAI0C014105.473ON3693864943e-58
NCAS0H022505.473ON4223534887e-57
KLLA0E03125g5.473ON3683534847e-57
Ecym_23135.473ON3703534812e-56
Smik_15.3165.473ON3693864743e-55
Suva_8.1885.473ON3693864709e-55
AFR137C5.473ON3673754701e-54
Skud_15.3005.473ON3693854692e-54
SAKL0G03520g5.473ON3693904673e-54
CAGL0I07227g5.473ON3683844664e-54
KLTH0F15048g5.473ON3683534655e-54
KNAG0B040705.473ON3733944656e-54
YOR136W (IDH2)5.473ON3693864631e-53
Kpol_543.85.473ON3683544561e-52
KAFR0B063705.473ON3783534561e-52
Kwal_55.212735.473ON3683534542e-52
TBLA0B022405.473ON3733544509e-52
Kpol_1039.352.278ON3593504454e-51
ADL223W2.278ON3623504455e-51
SAKL0E07876g2.278ON3613834445e-51
TPHA0J027705.473ON3763554422e-50
TPHA0D015602.278ON3603524402e-50
Kpol_440.125.473ON3683534385e-50
KLLA0F04103g2.278ON3613504351e-49
Ecym_33162.278ON3623504324e-49
KLTH0G10186g2.278ON3603504314e-49
TDEL0A033705.473ON3713534316e-49
YNL037C (IDH1)2.278ON3603514291e-48
Smik_14.2902.278ON3603514281e-48
Kwal_23.50122.278ON3613504281e-48
NDAI0B035902.278ON3593514262e-48
TPHA0E014805.473ON3773534273e-48
Skud_14.2932.278ON3613514263e-48
KAFR0J014102.278ON3503764244e-48
TBLA0B069102.278ON3653504238e-48
ZYRO0D11220g5.473ON3683524221e-47
NCAS0B062902.278ON3593514211e-47
TDEL0C038402.278ON3613864211e-47
ZYRO0D02838g2.278ON3613504081e-45
KNAG0A052802.278ON3613503941e-43
CAGL0G02673g2.278ON3583503922e-43
TBLA0C015001.402ON3653693914e-43
AAL012C1.402ON3723683732e-40
Ecym_12961.402ON3633623722e-40
Kpol_1048.631.402ON3643703722e-40
KLTH0H12188g1.402ON3643693671e-39
TDEL0B060001.402ON3623643634e-39
YCL018W (LEU2)1.402ON3643643625e-39
Smik_3.661.402ON3643643625e-39
NDAI0G042301.402ON3633693601e-38
Skud_3.431.402ON3643643582e-38
KLLA0D04906g1.402ON3623643582e-38
KNAG0I012801.402ON4473893614e-38
Kwal_0.2251.402ON3643783556e-38
CAGL0H03795g1.402ON3653683512e-37
Suva_3.31.402ON3643673512e-37
ZYRO0E04796g1.402ON3623653494e-37
KAFR0I022001.402ON3653673495e-37
Suva_14.3022.278ON3002933376e-36
NCAS0C048701.402ON3653723363e-35
SAKL0D08690g1.402ON3643653241e-33
TPHA0B037301.402ON3653682933e-29
KAFR0H031601.396ON4211341577e-11
Ecym_13061.396ON4152141532e-10
AAL022W1.396ON4152141504e-10
TDEL0B061001.396ON4141471496e-10
TBLA0C012901.396ON4181501488e-10
SAKL0D08426g1.396ON4111521452e-09
KLTH0H12012g1.396ON4132071452e-09
CAGL0H03663g1.396ON4181741434e-09
Kpol_1055.784.254ON4271331424e-09
Kwal_23.42104.254ON4222041424e-09
NCAS0A087201.396ON4131331417e-09
ZYRO0E05016g1.396ON4111521401e-08
KLLA0F12342g1.396ON4152291382e-08
KNAG0I013201.396ON4121731372e-08
KNAG0H016701.396ON4241581372e-08
KAFR0I021301.396ON4081341363e-08
CAGL0B04917g1.396ON4111501354e-08
CAGL0D00770g4.254ON4231331344e-08
YDL066W (IDP1)4.254ON4281441345e-08
Kwal_0.1911.396ON4111261345e-08
Skud_4.1894.254ON4291441345e-08
NDAI0G008501.396ON4191551336e-08
KLLA0B03355g4.254ON4292041336e-08
AER061C4.254ON4251331337e-08
Suva_10.2711.396ON4121521328e-08
KLTH0D14476g4.254ON4201821328e-08
SAKL0H02860g4.254ON4212061311e-07
Smik_12.2351.396ON4121261301e-07
Skud_12.2391.396ON4121331292e-07
Smik_4.1694.254ON4281441292e-07
Suva_14.3391.396ON4171331283e-07
KNAG0D044104.254ON4281551283e-07
NCAS0A025104.254ON4261331274e-07
Kpol_1048.701.396ON4191331274e-07
YLR174W (IDP2)1.396ON4121281274e-07
YNL009W (IDP3)1.396ON4201541264e-07
KAFR0G032604.254ON4211741265e-07
ZYRO0B12496g4.254ON4222041256e-07
Skud_14.3181.396ON4201261248e-07
TDEL0E011604.254ON4231331231e-06
Smik_14.3191.396ON4181671231e-06
Suva_4.1844.254ON4291441221e-06
NCAS0G036201.396ON4181161222e-06
TPHA0B022104.254ON4331731212e-06
NDAI0D043604.254ON4241441202e-06
Ecym_32654.254ON4241331194e-06
TPHA0B036601.396ON4221281194e-06
TBLA0A080104.254ON4281681185e-06
NDAI0G051601.396ON4201271132e-05
Suva_14.303singletonON5349840.004
TDEL0H037307.78ON797110870.039
AFR599W4.231ON36134721.7
ZYRO0A08162g2.379ON27257712.0
YPR134W (MSS18)3.470ON26838712.2
CAGL0M01342g5.372ON472112695.3
CAGL0D01034g4.231ON36134669.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0B05940
         (369 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa] ...   749   0.0  
TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {O...   607   0.0  
NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON} Anc_2...   607   0.0  
KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON}              599   0.0  
YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}  ...   594   0.0  
Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}...   594   0.0  
SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly...   594   0.0  
Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON...   592   0.0  
Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}...   591   0.0  
CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly...   586   0.0  
NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.2...   585   0.0  
KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly...   585   0.0  
Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094...   578   0.0  
KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2....   577   0.0  
KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {...   577   0.0  
TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {O...   577   0.0  
ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {...   567   0.0  
Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {O...   564   0.0  
Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}...   545   0.0  
ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON} S...   516   0.0  
NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {O...   194   3e-58
NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473    192   7e-57
KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly...   191   7e-57
Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}...   189   2e-56
Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136...   187   3e-55
Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W ...   185   9e-55
AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON} S...   185   1e-54
Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136...   185   2e-54
SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly...   184   3e-54
CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {...   184   4e-54
KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]...   183   5e-54
KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {O...   183   6e-54
YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subun...   182   1e-53
Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON} (21411..22...   180   1e-52
KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa] ...   180   1e-52
Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {...   179   2e-52
TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {O...   177   9e-52
Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa] ...   176   4e-51
ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic ho...   176   5e-51
SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {...   175   5e-51
TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2....   174   2e-50
TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {O...   174   2e-50
Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON} (32084..3...   173   5e-50
KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON} unipro...   172   1e-49
Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar t...   171   4e-49
KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly...   170   4e-49
TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.4...   170   6e-49
YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON} ...   169   1e-48
Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037...   169   1e-48
Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C...   169   1e-48
NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {O...   168   2e-48
TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {O...   169   3e-48
Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037...   168   3e-48
KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {...   167   4e-48
TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON}            167   8e-48
ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly...   167   1e-47
NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa] ...   166   1e-47
TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {O...   166   1e-47
ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} simila...   161   1e-45
KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON}              156   1e-43
CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {...   155   2e-43
TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {O...   155   4e-43
AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON} S...   148   2e-40
Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar t...   147   2e-40
Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON} (1820...   147   2e-40
KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} high...   145   1e-39
TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON} Anc_1...   144   4e-39
YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}  LEU2Beta-iso...   144   5e-39
Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)   144   5e-39
NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa] ...   143   1e-38
Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)   142   2e-38
KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly...   142   2e-38
KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {O...   143   4e-38
Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W (L...   141   6e-38
CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}             139   2e-37
Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)      139   2e-37
ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON} unipro...   139   4e-37
KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.4...   139   5e-37
Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C...   134   6e-36
NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {O...   134   3e-35
SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {...   129   1e-33
TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {O...   117   3e-29
KAFR0H03160 Chr8 complement(602807..604072) [1266 bp, 421 aa] {O...    65   7e-11
Ecym_1306 Chr1 complement(619565..620812) [1248 bp, 415 aa] {ON}...    64   2e-10
AAL022W Chr1 (302946..304193) [1248 bp, 415 aa] {ON} Syntenic ho...    62   4e-10
TDEL0B06100 Chr2 complement(1076365..1077609) [1245 bp, 414 aa] ...    62   6e-10
TBLA0C01290 Chr3 complement(283624..284880) [1257 bp, 418 aa] {O...    62   8e-10
SAKL0D08426g Chr4 (705189..706424) [1236 bp, 411 aa] {ON} highly...    60   2e-09
KLTH0H12012g Chr8 (1026586..1027827) [1242 bp, 413 aa] {ON} high...    60   2e-09
CAGL0H03663g Chr8 (337533..338789) [1257 bp, 418 aa] {ON} highly...    60   4e-09
Kpol_1055.78 s1055 (207889..209172) [1284 bp, 427 aa] {ON} (2078...    59   4e-09
Kwal_23.4210 s23 (619516..620784) [1269 bp, 422 aa] {ON} YDL066W...    59   4e-09
NCAS0A08720 Chr1 complement(1722511..1723752) [1242 bp, 413 aa] ...    59   7e-09
ZYRO0E05016g Chr5 complement(379654..380889) [1236 bp, 411 aa] {...    59   1e-08
KLLA0F12342g Chr6 (1137608..1138855) [1248 bp, 415 aa] {ON} high...    58   2e-08
KNAG0I01320 Chr9 complement(255478..256716) [1239 bp, 412 aa] {O...    57   2e-08
KNAG0H01670 Chr8 (298481..299755) [1275 bp, 424 aa] {ON} Anc_1.3...    57   2e-08
KAFR0I02130 Chr9 (438428..439654) [1227 bp, 408 aa] {ON} Anc_1.3...    57   3e-08
CAGL0B04917g Chr2 complement(477939..479174) [1236 bp, 411 aa] {...    57   4e-08
CAGL0D00770g Chr4 (95715..96986) [1272 bp, 423 aa] {ON} highly s...    56   4e-08
YDL066W Chr4 (334835..336121) [1287 bp, 428 aa] {ON}  IDP1Mitoch...    56   5e-08
Kwal_0.191 s0 (98033..99268) [1236 bp, 411 aa] {ON} YLR174W (IDP...    56   5e-08
Skud_4.189 Chr4 (330300..331589) [1290 bp, 429 aa] {ON} YDL066W ...    56   5e-08
NDAI0G00850 Chr7 (179074..180333) [1260 bp, 419 aa] {ON} Anc_1.396     56   6e-08
KLLA0B03355g Chr2 (303444..304733) [1290 bp, 429 aa] {ON} highly...    56   6e-08
AER061C Chr5 complement(749709..750986) [1278 bp, 425 aa] {ON} S...    56   7e-08
Suva_10.271 Chr10 (476726..477964) [1239 bp, 412 aa] {ON} YLR174...    55   8e-08
KLTH0D14476g Chr4 complement(1184813..1186075) [1263 bp, 420 aa]...    55   8e-08
SAKL0H02860g Chr8 (280944..282209) [1266 bp, 421 aa] {ON} highly...    55   1e-07
Smik_12.235 Chr12 (451719..452957) [1239 bp, 412 aa] {ON} YLR174...    55   1e-07
Skud_12.239 Chr12 (451342..452580) [1239 bp, 412 aa] {ON} YLR174...    54   2e-07
Smik_4.169 Chr4 (311244..312530) [1287 bp, 428 aa] {ON} YDL066W ...    54   2e-07
Suva_14.339 Chr14 (594794..596047) [1254 bp, 417 aa] {ON} YNL009...    54   3e-07
KNAG0D04410 Chr4 complement(799414..800700) [1287 bp, 428 aa] {O...    54   3e-07
NCAS0A02510 Chr1 complement(476363..477643) [1281 bp, 426 aa] {O...    54   4e-07
Kpol_1048.70 s1048 complement(198298..199557) [1260 bp, 419 aa] ...    54   4e-07
YLR174W Chr12 (504591..505829) [1239 bp, 412 aa] {ON}  IDP2Cytos...    54   4e-07
YNL009W Chr14 (614821..616083) [1263 bp, 420 aa] {ON}  IDP3Perox...    53   4e-07
KAFR0G03260 Chr7 complement(675642..676907) [1266 bp, 421 aa] {O...    53   5e-07
ZYRO0B12496g Chr2 complement(1007086..1008354) [1269 bp, 422 aa]...    53   6e-07
Skud_14.318 Chr14 (581597..582859) [1263 bp, 420 aa] {ON} YNL009...    52   8e-07
TDEL0E01160 Chr5 (234217..235488) [1272 bp, 423 aa] {ON} Anc_4.2...    52   1e-06
Smik_14.319 Chr14 (573167..574423) [1257 bp, 418 aa] {ON} YLR174...    52   1e-06
Suva_4.184 Chr4 (324382..325671) [1290 bp, 429 aa] {ON} YDL066W ...    52   1e-06
NCAS0G03620 Chr7 complement(675224..676480) [1257 bp, 418 aa] {O...    52   2e-06
TPHA0B02210 Chr2 (509945..511246) [1302 bp, 433 aa] {ON} Anc_4.2...    51   2e-06
NDAI0D04360 Chr4 (1024297..1025571) [1275 bp, 424 aa] {ON} Anc_4...    51   2e-06
Ecym_3265 Chr3 (504267..505541) [1275 bp, 424 aa] {ON} similar t...    50   4e-06
TPHA0B03660 Chr2 (863280..864548) [1269 bp, 422 aa] {ON} Anc_1.3...    50   4e-06
TBLA0A08010 Chr1 (1981576..1982862) [1287 bp, 428 aa] {ON} Anc_4...    50   5e-06
NDAI0G05160 Chr7 complement(1250883..1252145) [1263 bp, 420 aa] ...    48   2e-05
Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C ...    37   0.004
TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.7...    38   0.039
AFR599W Chr6 (1516363..1517448) [1086 bp, 361 aa] {ON} Syntenic ...    32   1.7  
ZYRO0A08162g Chr1 (654330..655148) [819 bp, 272 aa] {ON} similar...    32   2.0  
YPR134W Chr16 (798051..798857) [807 bp, 268 aa] {ON}  MSS18Nucle...    32   2.2  
CAGL0M01342g Chr13 (150584..152002) [1419 bp, 472 aa] {ON} simil...    31   5.3  
CAGL0D01034g Chr4 complement(121908..122993) [1086 bp, 361 aa] {...    30   9.6  

>TBLA0B05940 Chr2 complement(1402869..1403978) [1110 bp, 369 aa]
           {ON} Anc_2.287 YIL094C
          Length = 369

 Score =  749 bits (1933), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/369 (100%), Positives = 369/369 (100%)

Query: 1   MLRTSVRQFSVSARNASSLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDL 60
           MLRTSVRQFSVSARNASSLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDL
Sbjct: 1   MLRTSVRQFSVSARNASSLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDL 60

Query: 61  QAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFAN 120
           QAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFAN
Sbjct: 61  QAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFAN 120

Query: 121 VRPVKTVEGTDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIA 180
           VRPVKTVEGTDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIA
Sbjct: 121 VRPVKTVEGTDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIA 180

Query: 181 KTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIV 240
           KTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIV
Sbjct: 181 KTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIV 240

Query: 241 DSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEPCHGSA 300
           DSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEPCHGSA
Sbjct: 241 DSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEPCHGSA 300

Query: 301 PDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQ 360
           PDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQ
Sbjct: 301 PDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQ 360

Query: 361 VIDDILGKL 369
           VIDDILGKL
Sbjct: 361 VIDDILGKL 369

>TDEL0G02180 Chr7 complement(428789..429898) [1110 bp, 369 aa] {ON}
           Anc_2.287 YIL094C
          Length = 369

 Score =  607 bits (1565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/369 (78%), Positives = 330/369 (89%)

Query: 1   MLRTSVRQFSVSARNASSLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDL 60
           MLR+++ + +     AS+ K++ IGLIPGDGIGKEVIPAGKQVL+NL+ KHGL F+FIDL
Sbjct: 1   MLRSAIGRLATRRAYASAPKSMVIGLIPGDGIGKEVIPAGKQVLENLSGKHGLNFDFIDL 60

Query: 61  QAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFAN 120
           QAG+ TF +TG ALP  TV +LKN+CQGALFGAVQSPTTKVEGYSSPIV LRKELGL+AN
Sbjct: 61  QAGWGTFQETGKALPEQTVQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKELGLYAN 120

Query: 121 VRPVKTVEGTDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIA 180
           VRPVK+VEGT  +P+D+VIVRENTEDLYIK+EKTY D   G+R+AEATKRI+E AT+RIA
Sbjct: 121 VRPVKSVEGTKDRPVDMVIVRENTEDLYIKLEKTYVDKATGTRVAEATKRISEVATRRIA 180

Query: 181 KTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIV 240
             ALDIALQRLKT G ATLTVTHKSNVLSQSDGLFRE+CK+VYESNK  Y  VAYNEQIV
Sbjct: 181 TIALDIALQRLKTNGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQVAYNEQIV 240

Query: 241 DSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEPCHGSA 300
           DSMVYR+FREPECFDV+VAPNLYGDILSDGAAALVGSLG+VPSANVGP IVIGEPCHGSA
Sbjct: 241 DSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSA 300

Query: 301 PDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQ 360
           PDIAGKGI+NPIATIRST  MLE+LG++ PAQDIY+AVDAN+R++K+KT DLGG+STTQQ
Sbjct: 301 PDIAGKGISNPIATIRSTGLMLEFLGHNKPAQDIYRAVDANLREDKVKTPDLGGNSTTQQ 360

Query: 361 VIDDILGKL 369
           V++DIL KL
Sbjct: 361 VVEDILSKL 369

>NCAS0B06250 Chr2 (1179360..1180481) [1122 bp, 373 aa] {ON}
           Anc_2.287
          Length = 373

 Score =  607 bits (1564), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/374 (78%), Positives = 331/374 (88%), Gaps = 6/374 (1%)

Query: 1   MLRTSVRQFSVS-----ARNASSLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAF 55
           MLRT+  +F+ S     A NA   K LTIGLIPGDGIGKEVIPAGKQVL+NLN KHGL F
Sbjct: 1   MLRTAASRFATSTCRTYATNALR-KNLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLKF 59

Query: 56  EFIDLQAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKEL 115
           +FIDLQAG+QTFLDTG ALP +TV +LK++CQGALFGAVQSPTTKVEGYSSPIV LRKE+
Sbjct: 60  DFIDLQAGFQTFLDTGKALPDETVQVLKSQCQGALFGAVQSPTTKVEGYSSPIVALRKEM 119

Query: 116 GLFANVRPVKTVEGTDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETA 175
           GLFANVRPVK+V GT  +P+D+VIVRENTEDLYIKIEKTY D   G+R+AEATKRI+E A
Sbjct: 120 GLFANVRPVKSVSGTKDRPVDMVIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIA 179

Query: 176 TKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAY 235
           T+RIA  ALDIALQRLK  G ATLTVTHKSNVLSQSDGLFRE+CK+VYESNK  Y  + Y
Sbjct: 180 TRRIATIALDIALQRLKVNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGSITY 239

Query: 236 NEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEP 295
           NEQIVDSMVYR+FREP+CFDVIVAPNLYGDILSDGAAALVGSLG+VPSANVGP IVIGEP
Sbjct: 240 NEQIVDSMVYRMFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEP 299

Query: 296 CHGSAPDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGD 355
           CHGSAPDIAGKGIANPIATIRSTA MLE+LG+++ AQDI++AV+AN+R+NKIKT DLGG+
Sbjct: 300 CHGSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIHRAVEANMRENKIKTPDLGGN 359

Query: 356 STTQQVIDDILGKL 369
           STTQQV +D+L +L
Sbjct: 360 STTQQVTEDVLARL 373

>KNAG0A05420 Chr1 (799521..800639) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  599 bits (1545), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/372 (77%), Positives = 330/372 (88%), Gaps = 4/372 (1%)

Query: 1   MLRTSVRQFSVS---ARNASSLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEF 57
           MLR++  + +     A NA+  K+LTIGLIPGDGIGKEVIPAGKQVLQ+LN KHGL F+F
Sbjct: 2   MLRSAANKLAGCRGLATNAAR-KSLTIGLIPGDGIGKEVIPAGKQVLQSLNPKHGLNFDF 60

Query: 58  IDLQAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGL 117
           IDLQAG+QTF DTG ALP +TV ILK KCQGALFGAVQSPTTKVEGYSSPIV LRK +GL
Sbjct: 61  IDLQAGFQTFQDTGKALPDETVQILKEKCQGALFGAVQSPTTKVEGYSSPIVALRKAMGL 120

Query: 118 FANVRPVKTVEGTDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATK 177
           +AN+RPVK+VEG++ +P+D++IVRENTEDLYIKIEKTY D   G+R+AEATKRI+E AT+
Sbjct: 121 YANIRPVKSVEGSNERPVDMIIVRENTEDLYIKIEKTYIDKATGTRVAEATKRISEIATQ 180

Query: 178 RIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNE 237
           RIA  ALDIALQRL+  G ATLTVTHKSNVLSQSDGLFREVC+E+YE+NK  Y+G+ YNE
Sbjct: 181 RIATIALDIALQRLQNNGKATLTVTHKSNVLSQSDGLFREVCREMYEANKDKYAGITYNE 240

Query: 238 QIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEPCH 297
           QIVDSMVYR+FREPECFDVIVAPNLYGDILSDGAAALVGSLG+VPSANVGP IVIGEPCH
Sbjct: 241 QIVDSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300

Query: 298 GSAPDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDST 357
           GSAPDIAGKGIANPIATIRSTA MLE+LG++  AQDI+KAVDAN+RD  +KTADLGG++T
Sbjct: 301 GSAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIHKAVDANLRDGLVKTADLGGNAT 360

Query: 358 TQQVIDDILGKL 369
           TQ V+DDIL +L
Sbjct: 361 TQNVVDDILARL 372

>YIL094C Chr9 complement(186517..187632) [1116 bp, 371 aa] {ON}
           LYS12Homo-isocitrate dehydrogenase, an NAD-linked
           mitochondrial enzyme required for the fourth step in the
           biosynthesis of lysine, in which homo-isocitrate is
           oxidatively decarboxylated to alpha-ketoadipate
          Length = 371

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/372 (77%), Positives = 325/372 (87%), Gaps = 4/372 (1%)

Query: 1   MLRTSVRQFSVS---ARNASSLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEF 57
           M R+   + S     A NA+  K+LTIGLIPGDGIGKEVIPAGKQVL+NLN KHGL+F F
Sbjct: 1   MFRSVATRLSACRGLASNAAR-KSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNF 59

Query: 58  IDLQAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGL 117
           IDL AG+QTF +TG ALP +TV +LK +CQGALFGAVQSPTTKVEGYSSPIV LR+E+GL
Sbjct: 60  IDLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGL 119

Query: 118 FANVRPVKTVEGTDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATK 177
           FANVRPVK+VEG   KPID+VIVRENTEDLYIKIEKTY D   G+R+A+ATKRI+E AT+
Sbjct: 120 FANVRPVKSVEGEKGKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATR 179

Query: 178 RIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNE 237
           RIA  ALDIAL+RL+T+G ATLTVTHKSNVLSQSDGLFRE+CKEVYESNK  Y  + YNE
Sbjct: 180 RIATIALDIALKRLQTRGQATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNE 239

Query: 238 QIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEPCH 297
           QIVDSMVYRLFREP+CFDVIVAPNLYGDILSDGAAALVGSLG+VPSANVGP IVIGEPCH
Sbjct: 240 QIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 299

Query: 298 GSAPDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDST 357
           GSAPDIAGKGIANPIATIRSTA MLE+LG++  AQDIYKAVDAN+R+  IKT DLGG ++
Sbjct: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHNEAAQDIYKAVDANLREGSIKTPDLGGKAS 359

Query: 358 TQQVIDDILGKL 369
           TQQV+DD+L +L
Sbjct: 360 TQQVVDDVLSRL 371

>Smik_9.85 Chr9 complement(165648..166763) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  594 bits (1531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/372 (77%), Positives = 327/372 (87%), Gaps = 4/372 (1%)

Query: 1   MLRTSVRQFSVS---ARNASSLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEF 57
           MLR+   + S     A NA+  K+LTIGLIPGDGIGKEVIPAGKQVL+NLN KHGL+F F
Sbjct: 1   MLRSVATRLSTCRGLATNAAR-KSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNF 59

Query: 58  IDLQAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGL 117
           IDL AG+QTF +TG ALP +TV +LK +CQGALFGAVQSPTTKVEGYSSPIV LR+E+GL
Sbjct: 60  IDLYAGFQTFQETGKALPDETVKVLKEQCQGALFGAVQSPTTKVEGYSSPIVALRREMGL 119

Query: 118 FANVRPVKTVEGTDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATK 177
           FANVRPVK+VEG   KPID+VIVRENTEDLYIKIEKTY D   G+R+A+ATKRI+E AT+
Sbjct: 120 FANVRPVKSVEGGKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATR 179

Query: 178 RIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNE 237
           RIA  A+DIAL+RL+T+G ATLTVTHKSNVLSQSDGLFRE+CKEVYESNK  Y  + YNE
Sbjct: 180 RIATIAMDIALKRLQTRGEATLTVTHKSNVLSQSDGLFREICKEVYESNKDKYGQIKYNE 239

Query: 238 QIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEPCH 297
           QIVDSMVYRLFREP+CFDVIVAPNLYGDILSDGAAALVGSLG+VPSANVGP IVIGEPCH
Sbjct: 240 QIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 299

Query: 298 GSAPDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDST 357
           GSAPDIAGKGIANPIATIRSTA MLE+LG++N AQDIYKAVDAN+R+  IKT DLGG ++
Sbjct: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHNNAAQDIYKAVDANLREGAIKTPDLGGKAS 359

Query: 358 TQQVIDDILGKL 369
           TQQV++D+L +L
Sbjct: 360 TQQVVEDVLSRL 371

>SAKL0E07656g Chr5 (620028..621134) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  594 bits (1531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/369 (77%), Positives = 325/369 (88%), Gaps = 1/369 (0%)

Query: 1   MLRTSVRQFSVSARNASSLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDL 60
           MLR++V QF+  +  AS+ K LTIGLIPGDGIGKEVIPAGK VL+NL+ KH L F FIDL
Sbjct: 1   MLRSTVSQFARRSY-ASAAKPLTIGLIPGDGIGKEVIPAGKLVLENLSSKHNLKFNFIDL 59

Query: 61  QAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFAN 120
           QAG+QTFLDTG ALP +T++ILK+ CQGALFGAVQSPT KVEGYSSPIV LRK+LGL+AN
Sbjct: 60  QAGWQTFLDTGKALPDETIEILKSDCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYAN 119

Query: 121 VRPVKTVEGTDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIA 180
           VRPVK+V+GT+ +P+D++IVRENTEDLYIK EKTY D K G+R+AEA KRI+ETAT  IA
Sbjct: 120 VRPVKSVQGTNDRPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATTDIA 179

Query: 181 KTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIV 240
           K AL+I+LQRLK  G ATLTVTHKSNVLSQSDGLFREVCK VYESNK  Y  + YNEQIV
Sbjct: 180 KIALEISLQRLKANGKATLTVTHKSNVLSQSDGLFREVCKNVYESNKERYGAIGYNEQIV 239

Query: 241 DSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEPCHGSA 300
           DSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLG+VPSANVG + ++GEPCHGSA
Sbjct: 240 DSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGHDFIVGEPCHGSA 299

Query: 301 PDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQ 360
           PDIAGKGI+NPIATIRSTA MLE++GY+  AQDI+KAVD NIR+N+IKT DLGG STTQQ
Sbjct: 300 PDIAGKGISNPIATIRSTALMLEFMGYTEAAQDIHKAVDTNIRENQIKTPDLGGKSTTQQ 359

Query: 361 VIDDILGKL 369
           V+DDIL K+
Sbjct: 360 VVDDILSKM 368

>Suva_9.105 Chr9 complement(180626..181741) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  592 bits (1525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/372 (76%), Positives = 328/372 (88%), Gaps = 4/372 (1%)

Query: 1   MLRTSVRQFSVS---ARNASSLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEF 57
           M R+   + S     A NA+  K+LTIGLIPGDGIGKEVIPAGKQ+L+NLN KHGL+F F
Sbjct: 1   MFRSVATRISACRGLASNAAR-KSLTIGLIPGDGIGKEVIPAGKQILENLNSKHGLSFNF 59

Query: 58  IDLQAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGL 117
           IDL AG+QTF +TG ALP +T+ +LK++CQGALFGAVQSPTTKVEGYSSPIV LR+E+GL
Sbjct: 60  IDLYAGFQTFQETGKALPDETIKVLKDQCQGALFGAVQSPTTKVEGYSSPIVALRREMGL 119

Query: 118 FANVRPVKTVEGTDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATK 177
           +ANVRPVK+VEGT  KPID+VIVRENTEDLYIKIEKTY D   G+R+A+A KRI+E AT+
Sbjct: 120 YANVRPVKSVEGTKDKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADAIKRISEVATR 179

Query: 178 RIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNE 237
           RIAK ALDIALQRL+T+G ATLTVTHKSNVLSQSDGLFRE+CK+VYESNK  Y  + YNE
Sbjct: 180 RIAKIALDIALQRLQTRGEATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQIKYNE 239

Query: 238 QIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEPCH 297
           QIVDSMVYRLFREP+CFDVIVAPNLYGDILSDGAAALVGSLG+VPSANVGP+IVIGEPCH
Sbjct: 240 QIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVIGEPCH 299

Query: 298 GSAPDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDST 357
           GSAPDIAGKGIANPIATIRSTA MLE+LG+++ AQDIYKAVDAN+R+  I T DLGG ++
Sbjct: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHNDAAQDIYKAVDANLREGAITTPDLGGKAS 359

Query: 358 TQQVIDDILGKL 369
           TQQV+DD+L +L
Sbjct: 360 TQQVVDDVLSRL 371

>Skud_9.79 Chr9 complement(163173..164288) [1116 bp, 371 aa] {ON}
           YIL094C (REAL)
          Length = 371

 Score =  591 bits (1523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/372 (76%), Positives = 326/372 (87%), Gaps = 4/372 (1%)

Query: 1   MLRTSVRQFSVS---ARNASSLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEF 57
           M R+   + S     A NA+  K+LTIGLIPGDGIGKEVIPAGKQVL+NLN KHGL+F F
Sbjct: 1   MFRSVATRVSACRGLATNAAR-KSLTIGLIPGDGIGKEVIPAGKQVLENLNSKHGLSFNF 59

Query: 58  IDLQAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGL 117
           IDL AG+QTF +TG ALP +TV++LK +CQGALFGAVQSPTTKVEGYSSPIV LR+E+GL
Sbjct: 60  IDLYAGFQTFQETGKALPDETVNVLKKQCQGALFGAVQSPTTKVEGYSSPIVALRREMGL 119

Query: 118 FANVRPVKTVEGTDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATK 177
           FANVRPVK+VEG+  KPID+VIVRENTEDLYIKIEKTY D   G+R+A+ATKRI+E AT+
Sbjct: 120 FANVRPVKSVEGSRNKPIDMVIVRENTEDLYIKIEKTYIDKATGTRVADATKRISEIATR 179

Query: 178 RIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNE 237
           RIA  ALDIAL+RL+T+G ATLTVTHKSNVLSQ+DGLFRE+CKEVYESNK  Y  + YNE
Sbjct: 180 RIATIALDIALKRLQTRGEATLTVTHKSNVLSQTDGLFREICKEVYESNKDKYGQIKYNE 239

Query: 238 QIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEPCH 297
           QIVDSMVYRLFREP+CFDVIVAPNLYGDILSDGAAALVGSLG+VPSANVGP IVIGEPCH
Sbjct: 240 QIVDSMVYRLFREPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 299

Query: 298 GSAPDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDST 357
           GSAPDIAGKGIANPIATIRSTA MLE+LG++  AQDIYKAVDAN+R+  I T DLGG ++
Sbjct: 300 GSAPDIAGKGIANPIATIRSTALMLEFLGHNGAAQDIYKAVDANLREGAITTPDLGGKAS 359

Query: 358 TQQVIDDILGKL 369
           TQQV+DD+L +L
Sbjct: 360 TQQVVDDVLSRL 371

>CAGL0G02585g Chr7 (238931..240049) [1119 bp, 372 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094c LYS12 homo-isocitrate dehydrogenase
          Length = 372

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/366 (77%), Positives = 322/366 (87%), Gaps = 3/366 (0%)

Query: 4   TSVRQFSVSARNASSLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQAG 63
           T++R FS S R A   K LTIGLIPGDGIGKEVIPAGKQ+L+ +  K  L F+FIDL AG
Sbjct: 10  TAMRGFS-STRLAQ--KALTIGLIPGDGIGKEVIPAGKQILEKVGPKFDLDFKFIDLHAG 66

Query: 64  YQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVRP 123
           ++TF +TG ALP +TV++L+  CQGALFGAVQSPTTKVEGYSSPIV LRK +GLFANVRP
Sbjct: 67  WETFQNTGKALPDETVEVLRRDCQGALFGAVQSPTTKVEGYSSPIVALRKAMGLFANVRP 126

Query: 124 VKTVEGTDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTA 183
           VK VEGT+ +P+D+VIVRENTEDLYIKIEKTYTDP  G+R+AEATKRI+E AT+RIA  A
Sbjct: 127 VKAVEGTNDRPVDMVIVRENTEDLYIKIEKTYTDPATGTRVAEATKRISEVATRRIATIA 186

Query: 184 LDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSM 243
           LDIALQRL+++G ATLTVTHKSNVLSQSDGLFRE+CK+VYESNK  Y  + YNEQIVDSM
Sbjct: 187 LDIALQRLQSRGHATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGKIQYNEQIVDSM 246

Query: 244 VYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEPCHGSAPDI 303
           VYR+FREPECFDV+VAPNLYGDILSDGAAALVGSLG+VPSANVGP IVIGEPCHGSAPDI
Sbjct: 247 VYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGSAPDI 306

Query: 304 AGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQVID 363
           AG+GIANPIATIRSTA MLE+LGY   AQ IYKAVD+NIR+N+IKT DLGG STTQQV+D
Sbjct: 307 AGRGIANPIATIRSTALMLEFLGYPEAAQPIYKAVDSNIRENQIKTPDLGGKSTTQQVVD 366

Query: 364 DILGKL 369
           DIL K+
Sbjct: 367 DILSKI 372

>NDAI0B03550 Chr2 (891508..892626) [1119 bp, 372 aa] {ON} Anc_2.287
           YIL094C
          Length = 372

 Score =  585 bits (1508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/372 (75%), Positives = 325/372 (87%), Gaps = 3/372 (0%)

Query: 1   MLRTSVRQFSVSARNASSL--KTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFI 58
           MLRT+  + +     A++   K LTIGLIPGDGIGKEVIPAGKQVLQNLN KHGL F+FI
Sbjct: 1   MLRTTASRLATCRGYATNAIRKNLTIGLIPGDGIGKEVIPAGKQVLQNLNSKHGLNFDFI 60

Query: 59  DLQAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLF 118
           DLQAG+QTFLDTG ALP +T+ +LKN+CQGALFGAVQSPTTKVEGYSSPIV LRKE+GL+
Sbjct: 61  DLQAGFQTFLDTGKALPDETIQVLKNQCQGALFGAVQSPTTKVEGYSSPIVALRKEMGLY 120

Query: 119 ANVRPVKTVEGTDAKPIDLVIVRENTEDLY-IKIEKTYTDPKDGSRIAEATKRITETATK 177
           ANVRPVK+VEGT  KP+D+VIVRENT     IK+E+TY D   G+R+AEATKRI+E AT+
Sbjct: 121 ANVRPVKSVEGTTDKPVDMVIVRENTRRFINIKLERTYIDRATGTRVAEATKRISEIATR 180

Query: 178 RIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNE 237
           RIA  ALDIALQRLKT G ATLTVTHKSNVLSQSDGLFRE+CK+VYESNK  Y  + YNE
Sbjct: 181 RIATIALDIALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYESNKDKYGQINYNE 240

Query: 238 QIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEPCH 297
           QIVDSMVYR+FREP+CFDV+VAPNLYGDILSDGAAALVGSLG+VPSANVGP IVIGEPCH
Sbjct: 241 QIVDSMVYRMFREPQCFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCH 300

Query: 298 GSAPDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDST 357
           GSAPDIAGKGI+NPIATIRSTA MLE+LG++  AQDI++AV+AN+++NK+KT DLGG ST
Sbjct: 301 GSAPDIAGKGISNPIATIRSTALMLEFLGHNEAAQDIHRAVEANLKENKVKTPDLGGKST 360

Query: 358 TQQVIDDILGKL 369
           TQ+V +D+L +L
Sbjct: 361 TQEVTEDVLARL 372

>KLLA0E08339g Chr5 (750670..751779) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P40495 Saccharomyces cerevisiae
           YIL094C LYS12 Homo-isocitrate dehydrogenase an
           NAD-linked mitochondrial enzyme required for the fourth
           step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 369

 Score =  585 bits (1508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/369 (76%), Positives = 324/369 (87%), Gaps = 1/369 (0%)

Query: 1   MLRTSVRQFSVSARNASSLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDL 60
           M+RT   Q S  A  AS+ K LTIGLIPGDGIGKEVIPAGK++L++LN K+GL+F+FIDL
Sbjct: 1   MMRTRFIQLSRRAY-ASNAKNLTIGLIPGDGIGKEVIPAGKKILESLNPKYGLSFKFIDL 59

Query: 61  QAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFAN 120
           QAG++TF +TG ALP +T+DILKN+C+GALFGAVQSPTTKVEGYSSPIV LRK LGLFAN
Sbjct: 60  QAGWETFQNTGKALPDETIDILKNQCEGALFGAVQSPTTKVEGYSSPIVALRKNLGLFAN 119

Query: 121 VRPVKTVEGTDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIA 180
           VRPVK+V+GT  + +DLVIVRENTEDLYIK+EK+Y D   G+R+A+ATKRITE ATK IA
Sbjct: 120 VRPVKSVDGTKDRKVDLVIVRENTEDLYIKLEKSYIDEATGTRVADATKRITEIATKNIA 179

Query: 181 KTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIV 240
             AL IA QRL+  G ATLTVTHKSNVLSQSDGLFREVC+E YE+NK  Y GV YNEQIV
Sbjct: 180 TIALQIAQQRLEQNGHATLTVTHKSNVLSQSDGLFREVCRETYEANKDKYGGVQYNEQIV 239

Query: 241 DSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEPCHGSA 300
           DSMVYR+FREPECFDV+VAPNLYGDILSDGAAALVGSLG+VPSANVGPNIVIGEPCHGSA
Sbjct: 240 DSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPNIVIGEPCHGSA 299

Query: 301 PDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQ 360
           PDIAGKGI+NPIATIRSTA MLE+LGY  PA+DI+KAVDANIR+ K  T DLGG+STTQQ
Sbjct: 300 PDIAGKGISNPIATIRSTALMLEFLGYPEPAKDIHKAVDANIREGKYLTPDLGGNSTTQQ 359

Query: 361 VIDDILGKL 369
           V++D+L KL
Sbjct: 360 VLEDVLSKL 368

>Kwal_27.11528 s27 (836437..837540) [1104 bp, 367 aa] {ON} YIL094C
           (LYS12) - Homo-isocitrate dehydrogenase [contig 27] FULL
          Length = 367

 Score =  578 bits (1491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/369 (75%), Positives = 321/369 (86%), Gaps = 2/369 (0%)

Query: 1   MLRTSVRQFSVSARNASSLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDL 60
           MLRTS  Q +  +   S+ K+LTIGLIPGDGIG+EVIPAGK VL+NL+ KHGL F FIDL
Sbjct: 1   MLRTSFNQLARRSY-TSATKSLTIGLIPGDGIGREVIPAGKLVLENLSSKHGLKFNFIDL 59

Query: 61  QAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFAN 120
           +AG+QTFLDTG ALP +T+DILKN+CQGALFGAVQSPT KVEGYSSPIV LRK+LGL+AN
Sbjct: 60  EAGWQTFLDTGKALPDETIDILKNECQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYAN 119

Query: 121 VRPVKTVEGTDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIA 180
           VRPVK+V   + KPID+VIVRENTEDLYIK EKTY D K G+R+AEA KRI+E AT+ IA
Sbjct: 120 VRPVKSVLSQE-KPIDMVIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISEVATRNIA 178

Query: 181 KTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIV 240
             AL+IALQR K  GSATLTVTHKSNVLSQSDGLFRE+C++VYESN+  +  + YNEQIV
Sbjct: 179 NIALEIALQRQKVNGSATLTVTHKSNVLSQSDGLFREICRQVYESNQDKFGSINYNEQIV 238

Query: 241 DSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEPCHGSA 300
           DSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLG+VPSANVG + V+GEPCHGSA
Sbjct: 239 DSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSA 298

Query: 301 PDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQ 360
           PDIAGKGI+NP+ATIRSTA MLE++G+   AQDI+KAVDAN+RDN +KT DLGG STTQQ
Sbjct: 299 PDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNTVKTPDLGGKSTTQQ 358

Query: 361 VIDDILGKL 369
           V+DD+L ++
Sbjct: 359 VVDDVLSRM 367

>KAFR0J01360 Chr10 (249197..250318) [1122 bp, 373 aa] {ON} Anc_2.287
           YIL094C
          Length = 373

 Score =  577 bits (1488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/373 (75%), Positives = 330/373 (88%), Gaps = 6/373 (1%)

Query: 1   MLRTSVRQFSVSARNASSL---KTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEF 57
           MLR+ V + S + R+ S+    K+LTIGLIPGDGIGKEVIPAGKQVLQNL+ +HGL F F
Sbjct: 1   MLRSVVTK-SATIRHLSTKGINKSLTIGLIPGDGIGKEVIPAGKQVLQNLSSRHGLNFNF 59

Query: 58  IDLQAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGL 117
           IDL+AG+QTFLDTG ALP +TV +LK +CQG LFGAVQSPTT+V+ YSSPIV LRKEL L
Sbjct: 60  IDLEAGFQTFLDTGKALPDETVKVLKEQCQGVLFGAVQSPTTRVDNYSSPIVALRKELQL 119

Query: 118 FANVRPVKTVEGTDA-KPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETAT 176
           +AN+RPVK+V G  + KP+D+VIVRENTEDLYIKIEK+Y D ++G R+AEATKRITE AT
Sbjct: 120 YANIRPVKSVAGAHSGKPVDMVIVRENTEDLYIKIEKSYKD-QNGMRVAEATKRITEVAT 178

Query: 177 KRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYN 236
           ++IAK ALD+ALQRLKT G ATLTVTHKSNVLSQSDGLFRE+CK+VY++NK  Y+G+ YN
Sbjct: 179 RKIAKIALDVALQRLKTNGKATLTVTHKSNVLSQSDGLFREICKDVYQANKDKYAGINYN 238

Query: 237 EQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEPC 296
           EQI+DSMVYR+FREPE FDVIVAPNLYGDILSDGAAALVGSLG+VPSANVGP+IV+GEPC
Sbjct: 239 EQIIDSMVYRMFREPEYFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIVMGEPC 298

Query: 297 HGSAPDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDS 356
           HGSAPDIAGKGIANPIATIRSTA MLE+LG+   AQDI+KAV++N+R+NKIKT DLGG+S
Sbjct: 299 HGSAPDIAGKGIANPIATIRSTALMLEFLGHKEAAQDIHKAVESNMRENKIKTPDLGGNS 358

Query: 357 TTQQVIDDILGKL 369
           +TQ V+DD+L KL
Sbjct: 359 STQNVVDDVLEKL 371

>KLTH0G10384g Chr7 complement(878375..879478) [1104 bp, 367 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 367

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/369 (74%), Positives = 322/369 (87%), Gaps = 2/369 (0%)

Query: 1   MLRTSVRQFSVSARNASSLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDL 60
           MLR S  Q +  +  AS+ K+LTIGLIPGDGIGKEVIPAG+QVL+NL+ KHGL F+FIDL
Sbjct: 1   MLRASFTQLARRSY-ASASKSLTIGLIPGDGIGKEVIPAGRQVLENLSSKHGLKFDFIDL 59

Query: 61  QAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFAN 120
           QAG+QTF +TG ALP +T+DIL+N+CQGALFGAVQSPT KVEGYSSPIV LRK+LGL+AN
Sbjct: 60  QAGWQTFQETGKALPDETIDILRNQCQGALFGAVQSPTNKVEGYSSPIVALRKKLGLYAN 119

Query: 121 VRPVKTVEGTDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIA 180
           VRPVK+V   + +P+D++IVRENTEDLYIK EKTY D K G+R+AEA KRI+ETATK IA
Sbjct: 120 VRPVKSVLPQE-RPVDMIIVRENTEDLYIKTEKTYIDEKTGTRVAEAIKRISETATKNIA 178

Query: 181 KTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIV 240
             AL+IALQR K  G ATLTVTHKSNVLSQSDGLFREVC++VYESNK  +  + YNEQIV
Sbjct: 179 NIALEIALQRQKVNGEATLTVTHKSNVLSQSDGLFREVCRQVYESNKDKFGSIKYNEQIV 238

Query: 241 DSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEPCHGSA 300
           DSMVYR+FREPECFDVIVAPNLYGDILSDGAAALVGSLG+VPSANVG + V+GEPCHGSA
Sbjct: 239 DSMVYRMFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGFDFVVGEPCHGSA 298

Query: 301 PDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQ 360
           PDIAGKGI+NP+ATIRSTA MLE++G+   AQDI+KAVDAN+RDN IKT DLGG STTQQ
Sbjct: 299 PDIAGKGISNPVATIRSTALMLEFMGHPEAAQDIHKAVDANLRDNSIKTPDLGGKSTTQQ 358

Query: 361 VIDDILGKL 369
           V++D+L ++
Sbjct: 359 VVEDVLSRM 367

>TPHA0C03410 Chr3 complement(748639..749754) [1116 bp, 371 aa] {ON}
           Anc_2.287 YIL094C
          Length = 371

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/371 (75%), Positives = 319/371 (85%), Gaps = 2/371 (0%)

Query: 1   MLRTSV--RQFSVSARNASSLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFI 58
           MLR SV  RQF  +  N S    LTIGLIPGDGIGKEVIP+G+QVL+ +  KHGL F FI
Sbjct: 1   MLRRSVYNRQFQRTIGNISKKSNLTIGLIPGDGIGKEVIPSGRQVLETIGPKHGLTFNFI 60

Query: 59  DLQAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLF 118
           DLQAG+QTFLDTG ALP +TV  L+  C GALFGAVQSPTTKVEGYSSPIV LRKELGL+
Sbjct: 61  DLQAGWQTFLDTGKALPVETVKTLRENCDGALFGAVQSPTTKVEGYSSPIVALRKELGLY 120

Query: 119 ANVRPVKTVEGTDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKR 178
           AN+RPVK+V+    K +D+VIVRENTEDLYIK+EKTY D K G+R+A+ATKRI+E AT+R
Sbjct: 121 ANIRPVKSVDTPGNKKVDMVIVRENTEDLYIKLEKTYIDEKTGTRVADATKRISEVATRR 180

Query: 179 IAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQ 238
           IAK ALDIALQRLK  G+  LTVTHKSNVLSQSDGLFREVCKEV+ESNK+LYS + YNEQ
Sbjct: 181 IAKIALDIALQRLKNNGNVQLTVTHKSNVLSQSDGLFREVCKEVFESNKTLYSDIQYNEQ 240

Query: 239 IVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEPCHG 298
           I+DSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLG+VPSANVGP IVIGEPCHG
Sbjct: 241 IIDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGVVPSANVGPGIVIGEPCHG 300

Query: 299 SAPDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTT 358
           SAPDIAGKGI+NPIATIRSTA MLE+LG+S  AQDI  AVD+N+R++KIKT DLGG ++T
Sbjct: 301 SAPDIAGKGISNPIATIRSTALMLEFLGHSQAAQDIQTAVDSNLREDKIKTPDLGGKNST 360

Query: 359 QQVIDDILGKL 369
             V++D++ +L
Sbjct: 361 SDVVNDVIRRL 371

>ZYRO0A01914g Chr1 complement(158403..159509) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P40495 Saccharomyces
           cerevisiae YIL094C LYS12 Homo-isocitrate dehydrogenase
           an NAD-linked mitochondrial enzyme required for the
           fourth step in the biosynthesis of lysine in which homo-
           isocitrate is oxidatively decarboxylated to alpha-
           ketoadipate
          Length = 368

 Score =  567 bits (1461), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/370 (74%), Positives = 316/370 (85%), Gaps = 3/370 (0%)

Query: 1   MLRTSVRQFSVSARNA-SSLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFID 59
           M R+SV +  V+AR A S+ K++ IGLIPGDGIGKEVIPAGKQVL+ L  KHGL F+FID
Sbjct: 1   MFRSSVAK--VAARRAYSAPKSMKIGLIPGDGIGKEVIPAGKQVLEALGSKHGLQFDFID 58

Query: 60  LQAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFA 119
           L+AG++ F   G ALP DTV +LK +CQGALFGAVQSPTTKV GYSSPIV LRKELGL+A
Sbjct: 59  LKAGWEAFQQQGKALPDDTVKVLKEQCQGALFGAVQSPTTKVAGYSSPIVALRKELGLYA 118

Query: 120 NVRPVKTVEGTDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRI 179
           NVRPVK+VE  + + +D++IVRENTEDLYIK EKTY D   G+R+AEA KRI+E AT++I
Sbjct: 119 NVRPVKSVEKGNDRNVDMIIVRENTEDLYIKTEKTYVDEATGTRVAEAIKRISEVATRKI 178

Query: 180 AKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQI 239
           A  ALDI+LQRLK++G ATLTVTHKSNVLSQSDGLFRE+CK+VYE NK  Y  V YNEQI
Sbjct: 179 ATIALDISLQRLKSRGHATLTVTHKSNVLSQSDGLFREICKDVYEKNKDKYGEVKYNEQI 238

Query: 240 VDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEPCHGS 299
           VDSMVYR+FREPECFDV+VAPNLYGDILSDGAAALVGSLG+VPSANVGP IVIGEPCHGS
Sbjct: 239 VDSMVYRMFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPEIVIGEPCHGS 298

Query: 300 APDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQ 359
           APDIAGKGI+NPIATIRSTA MLE+LG+  PAQDIYKAVDAN+    + T DLGG +TTQ
Sbjct: 299 APDIAGKGISNPIATIRSTALMLEFLGHPEPAQDIYKAVDANLIKGDVNTPDLGGKATTQ 358

Query: 360 QVIDDILGKL 369
           QV+DDIL K+
Sbjct: 359 QVVDDILSKI 368

>Kpol_1003.39 s1003 complement(96083..97195) [1113 bp, 370 aa] {ON}
           complement(96083..97195) [1113 nt, 371 aa]
          Length = 370

 Score =  564 bits (1453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/372 (73%), Positives = 316/372 (84%), Gaps = 5/372 (1%)

Query: 1   MLRTSVRQFSVSARNA---SSLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEF 57
           MLR  V  +   AR      +   LTIGLIPGDGIGKEVIPAGK+VL+ +  K+ + F+F
Sbjct: 1   MLRNGV--YRACARRTVVNGARSNLTIGLIPGDGIGKEVIPAGKKVLETIGDKYSIDFKF 58

Query: 58  IDLQAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGL 117
           IDL AG+QTFLDTG ALP +TV ILK +CQGALFGAVQSPTTKVEGYSSPIV LRK+LGL
Sbjct: 59  IDLHAGWQTFLDTGKALPDETVSILKQQCQGALFGAVQSPTTKVEGYSSPIVALRKQLGL 118

Query: 118 FANVRPVKTVEGTDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATK 177
           +AN+RPVK+V GT+ +P+D+VIVRENTEDLYIK E+TY D   G+++AEATKRI+E AT+
Sbjct: 119 YANIRPVKSVSGTNDRPVDMVIVRENTEDLYIKEERTYIDEATGTKVAEATKRISEVATR 178

Query: 178 RIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNE 237
           +IAK ALDIALQRLK  G ATLTVTHKSNVLSQSDGLFREVC++VYE NK LY  V+YNE
Sbjct: 179 KIAKIALDIALQRLKNTGKATLTVTHKSNVLSQSDGLFREVCRDVYEKNKDLYGNVSYNE 238

Query: 238 QIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEPCH 297
           QIVDSMVYR+FREPECFDV+VAPNLYGDILSDGAAALVGSLG+VPSANVGP+I+IGEPCH
Sbjct: 239 QIVDSMVYRIFREPECFDVVVAPNLYGDILSDGAAALVGSLGVVPSANVGPDIIIGEPCH 298

Query: 298 GSAPDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDST 357
           GSAPDI+G+GI+NP+ATIRS A ML++LGY+  A+DI  AVD NIR  KIKT DLGGDS+
Sbjct: 299 GSAPDISGQGISNPVATIRSAALMLQFLGYNEAAKDIQNAVDENIRSGKIKTPDLGGDSS 358

Query: 358 TQQVIDDILGKL 369
           T +V DDIL KL
Sbjct: 359 TTEVTDDILSKL 370

>Ecym_3326 Chr3 complement(624805..625905) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii ADL214C
          Length = 366

 Score =  545 bits (1403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/369 (72%), Positives = 309/369 (83%), Gaps = 3/369 (0%)

Query: 1   MLRTSVRQFSVSARNASSLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDL 60
           MLR    Q S   R   + K+ TIGLIPGDGIGKEVIP G++VL+ +  K+G+ F++IDL
Sbjct: 1   MLRVGRGQLS--TRTYVTSKSFTIGLIPGDGIGKEVIPVGRKVLEKIGPKYGVDFKYIDL 58

Query: 61  QAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFAN 120
           QAG+QTFLDTG ALP DTV+ L+N CQGALFGAVQSPTTKV+GYSSPIV LRK LGL+AN
Sbjct: 59  QAGWQTFLDTGKALPDDTVEQLRNNCQGALFGAVQSPTTKVQGYSSPIVALRKALGLYAN 118

Query: 121 VRPVKTVEGTDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIA 180
           +RPVK+V+GT  +P+DLVI RENTEDLYIK E+TY D + G R+AEA KRI+E AT+ IA
Sbjct: 119 IRPVKSVDGTGDRPVDLVIARENTEDLYIKSERTYIDKETGGRVAEAIKRISEHATRNIA 178

Query: 181 KTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIV 240
             AL+IALQRLK KG ATLTVTHKSNVLSQSDGLFRE+CK VY+SNK  ++ V YNEQIV
Sbjct: 179 NIALEIALQRLKEKGHATLTVTHKSNVLSQSDGLFREICKSVYQSNKK-FANVQYNEQIV 237

Query: 241 DSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEPCHGSA 300
           DSMVYRLF+EP+CFDVIVAPNLYGDILSDGAAALVGSLG+VPS NVGPNIVIGEPCHGSA
Sbjct: 238 DSMVYRLFKEPQCFDVIVAPNLYGDILSDGAAALVGSLGVVPSVNVGPNIVIGEPCHGSA 297

Query: 301 PDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQ 360
           PDI G+GIANPIATIRS A +LE+LG    A+ I K VD NIR+NKIKT DLGG+ST +Q
Sbjct: 298 PDIVGQGIANPIATIRSAALLLEFLGLPEAARHIEKVVDENIRENKIKTPDLGGNSTGEQ 357

Query: 361 VIDDILGKL 369
           V +DIL ++
Sbjct: 358 VANDILSRI 366

>ADL214C Chr4 complement(328094..329197) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL094C
           (LYS12)
          Length = 367

 Score =  516 bits (1330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/369 (67%), Positives = 302/369 (81%), Gaps = 2/369 (0%)

Query: 1   MLRTSVRQFSVSARNASSLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDL 60
           M R+S       A  A+S KTLTIGLIPGDGIGKEVIPAG++VL+ + KKH + F +  L
Sbjct: 1   MHRSSATSLIHKATYATS-KTLTIGLIPGDGIGKEVIPAGQRVLEAIGKKHDIRFSYEHL 59

Query: 61  QAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFAN 120
            AG+QTFL+TG ALP  TV+ L+ +CQGALFGAVQSPTTKVEGYSSPIV LR++LGL+AN
Sbjct: 60  DAGWQTFLETGNALPGATVEALRERCQGALFGAVQSPTTKVEGYSSPIVALRRQLGLYAN 119

Query: 121 VRPVKTVEGTDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIA 180
           +RPVK+V GT  +P+DLVIVRENTEDLY++ E+TY D   G R+AEA KRI+E AT+RIA
Sbjct: 120 IRPVKSVSGT-GQPVDLVIVRENTEDLYVQQERTYVDAATGKRVAEAIKRISEPATERIA 178

Query: 181 KTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIV 240
           + +L +ALQR +  G   LTVTHKSNVLSQ+DGLF+EVC+EVYE+NK  Y  + YNEQIV
Sbjct: 179 EISLRLALQRQRMGGRGALTVTHKSNVLSQTDGLFKEVCREVYEANKKSYGSIEYNEQIV 238

Query: 241 DSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEPCHGSA 300
           DSMVYRLF+EP CFDV+VAPNLYGD+LSDGAAALVGSLGLVPS NVG NI+IGEPCHGSA
Sbjct: 239 DSMVYRLFKEPHCFDVVVAPNLYGDLLSDGAAALVGSLGLVPSVNVGNNIIIGEPCHGSA 298

Query: 301 PDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQ 360
           PDIAG+GIANPIATIRS + ML++LG    A DI +AV  N++D ++ + DLGG +TTQ+
Sbjct: 299 PDIAGRGIANPIATIRSVSLMLQFLGLEEAASDIDQAVTGNLKDRQVVSPDLGGKNTTQE 358

Query: 361 VIDDILGKL 369
           V+DDIL ++
Sbjct: 359 VLDDILARI 367

>NDAI0C01410 Chr3 complement(295178..296287) [1110 bp, 369 aa] {ON}
           Anc_5.473
          Length = 369

 Score =  194 bits (494), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 141/386 (36%), Positives = 204/386 (52%), Gaps = 39/386 (10%)

Query: 1   MLRTSVRQFSVSARNASSLKTLT-----------IGLIPGDGIGKEVIPAGKQVLQNLNK 49
           +LR + R+F +S +N  S+   T           +  I GDGIG E+  + KQ+      
Sbjct: 6   ILRNTTRRF-LSVKNQPSIGKFTGKPNPSTGKFTVSFIEGDGIGPEISQSVKQIFDA--A 62

Query: 50  KHGLAFEFIDLQAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIV 109
           K  + +E  D+      F++    +P   V  + NK   AL G + +P  K  G+ S  +
Sbjct: 63  KVPIDWEPCDVSP---LFINGLTTIPEPAVQSI-NKNLVALKGPLATPIGK--GHRSLNL 116

Query: 110 QLRKELGLFANVRPVKTVEG--TDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEA 167
            LRK  GLFANVRP K++EG  T    +DLVI+RENTE  Y  IE   T       + ++
Sbjct: 117 TLRKTFGLFANVRPAKSIEGFKTIYDNVDLVIIRENTEGEYSGIEHVVT-----PGVVQS 171

Query: 168 TKRITETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNK 227
            K IT  A++R+ + A + A    +  G   + V HKS +   +DGLF +V KE+ +   
Sbjct: 172 IKLITRDASERVIRYAYEYA----RAIGRPRVIVVHKSTIQRLADGLFVDVAKELSQE-- 225

Query: 228 SLYSGVAYNEQIVDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAAL-VGSLGLVPSA 284
             Y  +    +++D+ V  +   P  +   V V PNLYGDILSD  + L  GSLGL PSA
Sbjct: 226 --YPDIQLETELIDNTVLNVVSNPSSYSNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSA 283

Query: 285 NVGPNIVIGEPCHGSAPDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRD 344
           N+G  + I E  HGSAPDIAG+  ANP A + S+  ML ++G +N A  I KAV + I  
Sbjct: 284 NIGHEVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLNNHADKIEKAVLSTIAS 343

Query: 345 N-KIKTADLGGDSTTQQVIDDILGKL 369
             + +T DL G +TT    D ++G+L
Sbjct: 344 GPEGRTGDLAGKATTSSFTDAVIGRL 369

>NCAS0H02250 Chr8 (441692..442960) [1269 bp, 422 aa] {ON} Anc_5.473
          Length = 422

 Score =  192 bits (488), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 134/353 (37%), Positives = 188/353 (53%), Gaps = 27/353 (7%)

Query: 23  TIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVDIL 82
           T+  I GDGIG E+  + KQ+      K  + +E  D+      F+D    +P   V  +
Sbjct: 91  TVSFIEGDGIGPEISNSVKQIFSA--AKVPIEWETCDVTP---LFIDGLTTIPEPAVQSI 145

Query: 83  KNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVRPVKTVEG--TDAKPIDLVIV 140
            NK   AL G + +P  K  G+ S  + LRK  GLFANVRP ++V+G  T    +DLV++
Sbjct: 146 -NKNLVALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSVKGFKTTYPNVDLVLI 202

Query: 141 RENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLT 200
           RENTE  Y  IE   T       + ++ K IT  A++R+ + A +      +  G   L 
Sbjct: 203 RENTEGEYSGIEHVVTP-----GVVQSIKLITREASERVIRYAFEYC----RAIGRPRLV 253

Query: 201 VTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECFD--VIV 258
           V HKS +   SDGLF  V KE+ +     Y  + +  +++D+ V ++   P  +   V V
Sbjct: 254 VVHKSTIQRLSDGLFVNVAKELSKE----YPDIQFETELIDNTVLKVVSNPSSYTDAVSV 309

Query: 259 APNLYGDILSDGAAAL-VGSLGLVPSANVGPNIVIGEPCHGSAPDIAGKGIANPIATIRS 317
            PNLYGDILSD  + L  GSLGL PS N+G  I I E  HGSAPDIAGK +ANP A + S
Sbjct: 310 CPNLYGDILSDLNSGLSAGSLGLTPSGNIGNEISIFEAVHGSAPDIAGKNMANPTALLLS 369

Query: 318 TAQMLEYLGYSNPAQDIYKAVDANIRDN-KIKTADLGGDSTTQQVIDDILGKL 369
           +  ML ++G S  A  I  AV + I    + +T DL G +TT    D ++ KL
Sbjct: 370 SVMMLNHMGLSKHADQIENAVLSTIASGPESRTGDLAGTATTSTFTDAVIKKL 422

>KLLA0E03125g Chr5 (288825..289931) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  191 bits (484), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 131/353 (37%), Positives = 195/353 (55%), Gaps = 27/353 (7%)

Query: 23  TIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVDIL 82
           T+  I GDG+G E+  + K +      K  + +E  D+      F++    +P   V  +
Sbjct: 37  TVSFIEGDGVGPEISKSVKAIFSA--AKVPIEWESCDVSP---IFVNGLTTIPDPAVASI 91

Query: 83  KNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVRPVKTVEG--TDAKPIDLVIV 140
            NK   AL G + +P  K  G+ S  + LRK  GLFANVRP K++EG  T  + ++LV++
Sbjct: 92  -NKNLIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGYKTTYENVNLVLI 148

Query: 141 RENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLT 200
           RENTE  Y  IE           + ++ K IT+ A++R+ + A + A    ++K    + 
Sbjct: 149 RENTEGEYSGIEHVV-----APGVVQSIKLITQDASERVIRYAFEYARAVDRSK----VL 199

Query: 201 VTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECFD--VIV 258
           V HKS +   +DGLF +V K++     S Y  +    +++D+ V +  + PE +D  V+V
Sbjct: 200 VVHKSTIQRLADGLFVDVAKKL----SSEYPDIELQTELLDNTVLKTVQHPEAYDDVVVV 255

Query: 259 APNLYGDILSDGAAAL-VGSLGLVPSANVGPNIVIGEPCHGSAPDIAGKGIANPIATIRS 317
            PNLYGDILSD  + L  GSLGL PSAN+G  + I E  HGSAPDIAG+  ANP A + S
Sbjct: 256 CPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSAPDIAGQNKANPTALLLS 315

Query: 318 TAQMLEYLGYSNPAQDIYKAVDANI-RDNKIKTADLGGDSTTQQVIDDILGKL 369
           +  ML ++G +  A  I KAV   I  D K +T DLGG ++T    D ++ +L
Sbjct: 316 SVMMLNHMGLTEHADKIEKAVLTTIASDAKNRTGDLGGSASTSSFTDAVIERL 368

>Ecym_2313 Chr2 complement(610493..611605) [1113 bp, 370 aa] {ON}
           similar to Ashbya gossypii AFR137C
          Length = 370

 Score =  189 bits (481), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 131/353 (37%), Positives = 190/353 (53%), Gaps = 27/353 (7%)

Query: 23  TIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVDIL 82
           T+  I GDGIG E+  + K +      K  + +E+ D+      F++    +P   V  +
Sbjct: 39  TVSFIEGDGIGPEISQSVKDIFSA--AKVPVEWEYCDVTP---IFINGLTTIPDPAVQSI 93

Query: 83  KNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVRPVKTVEG--TDAKPIDLVIV 140
            NK   AL G + +P  K  G+ S  + LRK  GLFANVRP K++EG  T  + +DLV++
Sbjct: 94  -NKNLVALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIEGFKTTYENVDLVLI 150

Query: 141 RENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLT 200
           RENTE  Y  IE   +       + ++ K IT  A++R+ + A + A    +  G   + 
Sbjct: 151 RENTEGEYSGIEHVVS-----PGVVQSIKLITRDASERVIRYAFEYA----RAVGRPKVV 201

Query: 201 VTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECFD--VIV 258
           V HKS +   +DGLF  V +EV +     Y  +    +++D+ V  +  +PE +   V V
Sbjct: 202 VVHKSTIQRLADGLFVNVAQEVGKE----YPDIELQPELIDNTVLNVVSKPEKYSDSVAV 257

Query: 259 APNLYGDILSDGAAAL-VGSLGLVPSANVGPNIVIGEPCHGSAPDIAGKGIANPIATIRS 317
            PNLYGDILSD  + L  GSLGL PSAN+G  + I E  HGSAPDIAG+  ANP A + S
Sbjct: 258 CPNLYGDILSDLNSGLSAGSLGLTPSANIGHTVSIFEAVHGSAPDIAGQNCANPTALLLS 317

Query: 318 TAQMLEYLGYSNPAQDIYKAVDANI-RDNKIKTADLGGDSTTQQVIDDILGKL 369
           +  ML ++G    A  I  AV A +  D K +TADL G +TT      ++ +L
Sbjct: 318 SVMMLNHMGLHEHADQIESAVLATVASDKKNRTADLAGTATTSSFTKAVIERL 370

>Smik_15.316 Chr15 (541618..542727) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  187 bits (474), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 137/386 (35%), Positives = 199/386 (51%), Gaps = 39/386 (10%)

Query: 1   MLRTSVRQFSVSARNAS----------SLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKK 50
             R + R+F  + +  S          S    T+  I GDGIG E+  + K++    N  
Sbjct: 6   FFRNTSRRFLATVKQPSIGKYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVP 65

Query: 51  HGLAFEFIDLQAGYQTFLDTGAALPRDTV-DILKNKCQGALFGAVQSPTTKVEGYSSPIV 109
             + +EF D+      F++    +P   V  I KN    AL G + +P  K  G+ S  +
Sbjct: 66  --IEWEFCDVNP---IFVNGLTTIPDPAVQSITKNLV--ALKGPLATPIGK--GHRSLNL 116

Query: 110 QLRKELGLFANVRPVKTVEG--TDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEA 167
            LRK  GLFANVRP K+VEG  T  + +DLV++RENTE  Y  IE           + ++
Sbjct: 117 TLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVC-----PGVVQS 171

Query: 168 TKRITETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNK 227
            K IT  A++R+ + A + A    +  G   + V HKS +   +DGLF  V KE+ +   
Sbjct: 172 IKLITRDASERVIRYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKE-- 225

Query: 228 SLYSGVAYNEQIVDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAAL-VGSLGLVPSA 284
             Y  +    +++D+ V ++   P  +   V V PNLYGDILSD  + L  GSLGL PSA
Sbjct: 226 --YPDITLETELIDNSVLKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSA 283

Query: 285 NVGPNIVIGEPCHGSAPDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRD 344
           N+G  I I E  HGSAPDIAG+  ANP A + S+  ML ++G +N A  I  AV + I  
Sbjct: 284 NIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNYADQIQNAVLSTIAS 343

Query: 345 N-KIKTADLGGDSTTQQVIDDILGKL 369
             + +T DL G +TT    + ++ +L
Sbjct: 344 GPENRTGDLAGAATTSSFTEAVIKRL 369

>Suva_8.188 Chr8 (335409..336518) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  185 bits (470), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 135/386 (34%), Positives = 200/386 (51%), Gaps = 39/386 (10%)

Query: 1   MLRTSVRQFSVSARNAS----------SLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKK 50
            LR + R+F  + +  S          S    T+  I GDGIG E+  + K++    +  
Sbjct: 6   FLRNTSRRFLSTVKQPSIGRYTGKPDPSTGRYTVSFIEGDGIGPEISKSVKKIFSAADVP 65

Query: 51  HGLAFEFIDLQAGYQTFLDTGAALPRDTV-DILKNKCQGALFGAVQSPTTKVEGYSSPIV 109
             + +EF D+      F++    +P   V  I KN    AL G + +P  K  G+ S  +
Sbjct: 66  --INWEFCDVNP---IFVNGLTTIPDPAVQSITKNLV--ALKGPLATPIGK--GHRSLNL 116

Query: 110 QLRKELGLFANVRPVKTVEG--TDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEA 167
            LRK  GLFANVRP K++EG  T  + +DLV++RENTE  Y  IE           + ++
Sbjct: 117 TLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVC-----PGVVQS 171

Query: 168 TKRITETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNK 227
            K IT  A++R+ + A + A    +  G   + V HKS +   +DGLF  V KE+ +   
Sbjct: 172 IKLITREASERVIRYAFEYA----RAIGRPRIIVVHKSTIQRLADGLFVNVAKELSKE-- 225

Query: 228 SLYSGVAYNEQIVDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAAL-VGSLGLVPSA 284
             Y  + +  +++D+ V  +   P  +   V V PNLYGDILSD  + L  GSLGL PSA
Sbjct: 226 --YPDITFETELIDNKVLNVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSA 283

Query: 285 NVGPNIVIGEPCHGSAPDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRD 344
           N+G  + I E  HGSAPDIAGK  ANP A + S+  ML ++G ++ A  I  AV + I  
Sbjct: 284 NIGHKVSIFEAVHGSAPDIAGKDKANPTALLLSSVMMLNHMGLTSHADQIQNAVLSTIAS 343

Query: 345 N-KIKTADLGGDSTTQQVIDDILGKL 369
             + +T DL G +TT    + ++ +L
Sbjct: 344 GPENRTGDLAGTATTSSFTEAVIKRL 369

>AFR137C Chr6 complement(685586..686689) [1104 bp, 367 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR136W
           (IDH2)
          Length = 367

 Score =  185 bits (470), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 136/375 (36%), Positives = 201/375 (53%), Gaps = 33/375 (8%)

Query: 5   SVRQFSVS--ARNASSLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQA 62
           SVRQ S+   A   ++    T+  I GDG+G E+  + K +    +    + +E+ D+  
Sbjct: 16  SVRQPSIGRYAGKPNAAGKYTVSFIEGDGVGPEISQSVKDIFSAASVP--VEWEYCDVTP 73

Query: 63  GYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVR 122
                L T   +P   V  + NK   AL G + +P  K  G+ S  + LRK  GLFANVR
Sbjct: 74  LLVNGLTT---IPEPAVASI-NKNLVALKGPLATPIGK--GHRSLNLTLRKTFGLFANVR 127

Query: 123 PVKTVEG--TDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIA 180
           P K++EG  T    +DLV++RENTE  Y  IE   +       + ++ K IT  A++R+ 
Sbjct: 128 PAKSIEGYKTTYSDVDLVLIRENTEGEYSGIEHVVS-----PGVVQSIKLITREASERVI 182

Query: 181 KTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIV 240
           + A + A    +T G   + V HKS +   +DGLF  V +E+       Y  +    +++
Sbjct: 183 RYAFEYA----RTVGRPKVVVVHKSTIQRLADGLFVNVAQELGRE----YPDIELQTELL 234

Query: 241 DSMVYRLFREPECFDVIVA--PNLYGDILSDGAAAL-VGSLGLVPSANVGPNIVIGEPCH 297
           D+ V  +  +PE +  +VA  PNLYGDILSD  + L  GSLGL PSAN+G  + I E  H
Sbjct: 235 DNTVLNVVTKPEAYKDVVAVCPNLYGDILSDLNSGLSAGSLGLTPSANIGHQVSIFEAVH 294

Query: 298 GSAPDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANI---RDNKIKTADLGG 354
           GSAPDIAG+  ANP A + S+  ML ++G    A  I KAV + I   R+N  +TADL G
Sbjct: 295 GSAPDIAGQNRANPTALLLSSVMMLNHMGLHEHAGRIEKAVLSTIASSREN--RTADLAG 352

Query: 355 DSTTQQVIDDILGKL 369
            ++T    + ++ +L
Sbjct: 353 TASTSSFTNAVIERL 367

>Skud_15.300 Chr15 (534346..535455) [1110 bp, 369 aa] {ON} YOR136W
           (REAL)
          Length = 369

 Score =  185 bits (469), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 134/385 (34%), Positives = 198/385 (51%), Gaps = 37/385 (9%)

Query: 1   MLRTSVRQFSVSARNAS----------SLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKK 50
           + R + R+F  + +  S          S    T+  I GDGIG E+  + K++    N  
Sbjct: 6   LFRNTSRRFLATVKQPSIGRFTGKPNPSTGRYTVSFIEGDGIGPEISKSVKKIFNAANVP 65

Query: 51  HGLAFEFIDLQAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQ 110
             + +E  D+      F++    +P   V  + N    AL G + +P  K  G+ S  + 
Sbjct: 66  --IEWESCDVNP---IFVNGLTTIPDAAVQSITNNLI-ALKGPLATPIGK--GHRSLNLT 117

Query: 111 LRKELGLFANVRPVKTVEG--TDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEAT 168
           LRK  GLFANVRP K+VEG  T  + +DLV++RENTE  Y  IE           + ++ 
Sbjct: 118 LRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHIVC-----PGVVQSI 172

Query: 169 KRITETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKS 228
           K IT  A++R+ + A + A    +  G   + V HKS +   +DGLF  V KE+ +    
Sbjct: 173 KLITRDASERVIRYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKE--- 225

Query: 229 LYSGVAYNEQIVDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAAL-VGSLGLVPSAN 285
            Y  +    +++D+ V ++   P  +   V V PNLYGDILSD  + L  GSLGL PSAN
Sbjct: 226 -YPDIILETELIDNSVLKVVTNPSAYTNAVSVCPNLYGDILSDLNSGLSAGSLGLTPSAN 284

Query: 286 VGPNIVIGEPCHGSAPDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDN 345
           +G  I I E  HGSAPDIAG+  ANP A + S+  ML ++G +N A  I  AV + I   
Sbjct: 285 IGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIASG 344

Query: 346 -KIKTADLGGDSTTQQVIDDILGKL 369
            + +T DL G +TT    + ++ +L
Sbjct: 345 PENRTGDLAGTATTSSFTEAVIKRL 369

>SAKL0G03520g Chr7 (290768..291877) [1110 bp, 369 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 369

 Score =  184 bits (467), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 139/390 (35%), Positives = 203/390 (52%), Gaps = 42/390 (10%)

Query: 1   MLRTSV-----RQFSVSARNAS----------SLKTLTIGLIPGDGIGKEVIPAGKQVLQ 45
           MLR+ V     R+F  S +  S          S    T+  I GDG+G E+  + K +  
Sbjct: 1   MLRSQVLRQLPRRFLSSKKQPSIGRFTGKPNPSTGKYTVSFIEGDGVGPEISKSVKDIFA 60

Query: 46  NLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYS 105
               +  + +E  D+      F++    +P+  VD + NK   AL G + +P  K  G+ 
Sbjct: 61  A--AEVPVEWESCDVTP---LFINGLTTIPQPAVDSI-NKNLIALKGPLATPIGK--GHR 112

Query: 106 SPIVQLRKELGLFANVRPVKTVEG--TDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSR 163
           S  + LRK  GLFANVRP K+VEG  T  + +DLV++RENTE  Y  IE   +       
Sbjct: 113 SLNLTLRKTFGLFANVRPAKSVEGFKTTYENVDLVLIRENTEGEYSGIEHVVS-----PG 167

Query: 164 IAEATKRITETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVY 223
           + ++ K IT  A++R+ + A + A    +  G   + V HKS +   +DGLF +V KE+ 
Sbjct: 168 VVQSIKLITRDASERVIRYAFEYA----RAVGRPKVMVVHKSTIQRLADGLFVDVAKEL- 222

Query: 224 ESNKSLYSGVAYNEQIVDSMVYRLFREPECF--DVIVAPNLYGDILSDGAAAL-VGSLGL 280
               S Y  +    Q++D+ V  +   P  +   V V PNLYGDILSD  + L  GSLGL
Sbjct: 223 ---SSEYPDIQLQLQLLDNTVLNVVSNPGAYADTVSVCPNLYGDILSDLNSGLSAGSLGL 279

Query: 281 VPSANVGPNIVIGEPCHGSAPDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDA 340
            PSAN+G  + I E  HGSAPDIAG+  ANP A + S+  ML ++G    A  I KAV +
Sbjct: 280 TPSANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLYEKADSIEKAVLS 339

Query: 341 NIRDN-KIKTADLGGDSTTQQVIDDILGKL 369
            I    + +TADL G ++T    + ++ +L
Sbjct: 340 TIASGPENRTADLAGSASTSSFTEAVIKRL 369

>CAGL0I07227g Chr9 complement(696605..697711) [1107 bp, 368 aa] {ON}
           highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2 isocitrate dehydrogenase
          Length = 368

 Score =  184 bits (466), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 137/384 (35%), Positives = 201/384 (52%), Gaps = 38/384 (9%)

Query: 2   LRTSVRQFSVSAR----------NASSLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKKH 51
            R + R+F  +A+          N S+ K  T+  I GDGIG E+  + K++ Q  +   
Sbjct: 7   FRLNARRFLATAQPSIGRFTGKPNPSTGK-FTVSFIEGDGIGPEISSSVKRIFQAADVP- 64

Query: 52  GLAFEFIDLQAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQL 111
            + +E  D+      F++    +P   V  + NK   AL G + +P  K  G+ S  + L
Sbjct: 65  -VEWETCDVTP---IFVNGLTTIPDPAVQSI-NKNLVALKGPLATPIGK--GHRSLNLTL 117

Query: 112 RKELGLFANVRPVKTVEG--TDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATK 169
           RK   LFANVRP K++EG  T  + +DLV++RENTE  Y  IE   +       + ++ K
Sbjct: 118 RKTFNLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHLVS-----PGVVQSIK 172

Query: 170 RITETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSL 229
            IT  A++R+ + A + A    +  G   L V HKS +   +DGLF  V KE+     + 
Sbjct: 173 LITRDASERVIRYAYEYA----RAIGRPRLIVVHKSTIQRLADGLFVNVAKEL----AAE 224

Query: 230 YSGVAYNEQIVDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAAL-VGSLGLVPSANV 286
           Y  +    +++D+    +   P  +   V V PNLYGDILSD  + L  GSLGL PSAN+
Sbjct: 225 YPDIQLETELIDNTCLNVVSNPSSYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSANI 284

Query: 287 GPNIVIGEPCHGSAPDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIR-DN 345
           G  + I E  HGSAPDIAG+  ANP A + S+  ML ++G +  A  I KAV   I   +
Sbjct: 285 GHKVSIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGMTEHADRIEKAVLGTIAGGS 344

Query: 346 KIKTADLGGDSTTQQVIDDILGKL 369
           + +T DLGG ++T    D I+ KL
Sbjct: 345 EYRTGDLGGSASTTSFTDAIIKKL 368

>KLTH0F15048g Chr6 complement(1232566..1233672) [1107 bp, 368 aa]
           {ON} highly similar to uniprot|P28241 Saccharomyces
           cerevisiae YOR136W IDH2 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 368

 Score =  183 bits (465), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 127/353 (35%), Positives = 191/353 (54%), Gaps = 27/353 (7%)

Query: 23  TIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVDIL 82
           T+  I GDG+G E+  A K +      K  + +E  D+      F++    +P+   D +
Sbjct: 37  TVSFIEGDGVGPEISKAVKDIFAA--AKAPIQWESCDVSP---LFINGLTTIPQPAQDSI 91

Query: 83  KNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVRPVKTVEG--TDAKPIDLVIV 140
            NK   AL G + +P  K  G+ S  + LRK  GLFANVRP K+V+G  T    +DLV++
Sbjct: 92  -NKNLIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSVQGYKTAYDNVDLVLI 148

Query: 141 RENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLT 200
           RENTE  Y  IE   +       + ++ K IT+ A++R+ + A + A    + K    + 
Sbjct: 149 RENTEGEYSGIEHVVS-----PGVVQSIKLITQDASERVIRYAFEYARAVERPK----VV 199

Query: 201 VTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECFD--VIV 258
           V HKS +   +DGLF  V +++ +     Y  +    +++D+ V    R+P  +   V+V
Sbjct: 200 VVHKSTIQRLADGLFVSVAEQLSKE----YPDIELQTELIDNTVLHTVRDPTKYSDVVVV 255

Query: 259 APNLYGDILSDGAAAL-VGSLGLVPSANVGPNIVIGEPCHGSAPDIAGKGIANPIATIRS 317
            PNLYGDILSD  + L  GSLGL PSAN+G  + I E  HGSAPDIAG+  ANP A + S
Sbjct: 256 CPNLYGDILSDMNSGLSAGSLGLTPSANIGHKVSIFEAVHGSAPDIAGQNKANPTALLLS 315

Query: 318 TAQMLEYLGYSNPAQDIYKAVDANIRDN-KIKTADLGGDSTTQQVIDDILGKL 369
           +  ML ++G +  A  I KAV   I    + +T DLGG ++T    + ++ +L
Sbjct: 316 SVMMLNHMGLTEHADKIEKAVFTTIAAGPESRTGDLGGSASTSSFAEAVISRL 368

>KNAG0B04070 Chr2 complement(778658..779779) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  183 bits (465), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 141/394 (35%), Positives = 201/394 (51%), Gaps = 46/394 (11%)

Query: 1   MLRTSVRQFSVSARN--ASSLKT-----------------LTIGLIPGDGIGKEVIPAGK 41
           MLR S+ + S +AR   A+S+K                    +  I GDGIG E+  + K
Sbjct: 1   MLRNSLLRNSFTARRFLATSVKNQPSIGRFTGKPNPATGKFDVSFIEGDGIGPEISQSVK 60

Query: 42  QVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKV 101
            + +    +  + +EF D+   +   L T   +P   V  + NK   AL G + +P  K 
Sbjct: 61  DIFKA--AEVPINWEFCDVTPIFVNGLTT---IPDPAVASI-NKNLIALKGPLATPIGK- 113

Query: 102 EGYSSPIVQLRKELGLFANVRPVKTVEG--TDAKPIDLVIVRENTEDLYIKIEKTYTDPK 159
            G+ S  + LRK   LFANVRP K++EG  T    +DLV++RENTE  Y  IE       
Sbjct: 114 -GHRSLNLTLRKTFNLFANVRPAKSIEGFKTTYSDVDLVLIRENTEGEYSGIEHVV---- 168

Query: 160 DGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVC 219
               + ++ K IT  A++R+ + A + A    K  G   + V HKS +   +DGLF  V 
Sbjct: 169 -APGVVQSIKLITRDASERVIRYAFEYA----KAIGRPRVVVVHKSTIQRLADGLFVNVA 223

Query: 220 KEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAAL-VG 276
           KE+ +     Y  +    +++D+ V  +   P  +   V V PNLYGDILSD  + L  G
Sbjct: 224 KELSKE----YPEIKLETELIDNTVLNVVSNPAGYTDAVSVCPNLYGDILSDLNSGLSAG 279

Query: 277 SLGLVPSANVGPNIVIGEPCHGSAPDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYK 336
           SLGL PSAN+G  I I E  HGSAPDIAG+  ANP A + S+  ML ++G  + A  I +
Sbjct: 280 SLGLTPSANIGNEISIFEAVHGSAPDIAGQNKANPTALLLSSVMMLNHMGLVDQASRIER 339

Query: 337 AVDANI-RDNKIKTADLGGDSTTQQVIDDILGKL 369
           AV   I   +K +T DLGG +TT    D ++  L
Sbjct: 340 AVLTTIASSSKNRTGDLGGSATTSSFTDAVIKNL 373

>YOR136W Chr15 (580250..581359) [1110 bp, 369 aa] {ON}  IDH2Subunit
           of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle;
           phosphorylated
          Length = 369

 Score =  182 bits (463), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 135/386 (34%), Positives = 198/386 (51%), Gaps = 39/386 (10%)

Query: 1   MLRTSVRQFSVSARNAS----------SLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNKK 50
             R + R+F  + +  S          S    T+  I GDGIG E+  + K++    N  
Sbjct: 6   FFRNTSRRFLATVKQPSIGRYTGKPNPSTGKYTVSFIEGDGIGPEISKSVKKIFSAANVP 65

Query: 51  HGLAFEFIDLQAGYQTFLDTGAALPRDTV-DILKNKCQGALFGAVQSPTTKVEGYSSPIV 109
             + +E  D+      F++    +P   V  I KN    AL G + +P  K  G+ S  +
Sbjct: 66  --IEWESCDVSP---IFVNGLTTIPDPAVQSITKNLV--ALKGPLATPIGK--GHRSLNL 116

Query: 110 QLRKELGLFANVRPVKTVEG--TDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEA 167
            LRK  GLFANVRP K++EG  T  + +DLV++RENTE  Y  IE           + ++
Sbjct: 117 TLRKTFGLFANVRPAKSIEGFKTTYENVDLVLIRENTEGEYSGIEHIVC-----PGVVQS 171

Query: 168 TKRITETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNK 227
            K IT  A++R+ + A + A    +  G   + V HKS +   +DGLF  V KE+ +   
Sbjct: 172 IKLITRDASERVIRYAFEYA----RAIGRPRVIVVHKSTIQRLADGLFVNVAKELSKE-- 225

Query: 228 SLYSGVAYNEQIVDSMVYRLFREPECFD--VIVAPNLYGDILSDGAAAL-VGSLGLVPSA 284
             Y  +    +++D+ V ++   P  +   V V PNLYGDILSD  + L  GSLGL PSA
Sbjct: 226 --YPDLTLETELIDNSVLKVVTNPSAYTDAVSVCPNLYGDILSDLNSGLSAGSLGLTPSA 283

Query: 285 NVGPNIVIGEPCHGSAPDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRD 344
           N+G  I I E  HGSAPDIAG+  ANP A + S+  ML ++G +N A  I  AV + I  
Sbjct: 284 NIGHKISIFEAVHGSAPDIAGQDKANPTALLLSSVMMLNHMGLTNHADQIQNAVLSTIAS 343

Query: 345 N-KIKTADLGGDSTTQQVIDDILGKL 369
             + +T DL G +TT    + ++ +L
Sbjct: 344 GPENRTGDLAGTATTSSFTEAVIKRL 369

>Kpol_543.8 s543 (21411..22517) [1107 bp, 368 aa] {ON}
           (21411..22517) [1107 nt, 369 aa]
          Length = 368

 Score =  180 bits (456), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 123/354 (34%), Positives = 189/354 (53%), Gaps = 27/354 (7%)

Query: 22  LTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVDI 81
            T+  I GDG+G E+  + K++         +  E++    G   F++    +P   V++
Sbjct: 36  FTVPFIEGDGVGPEISESVKKIFSAAK----VPIEWVPCDVG-PIFVNGQTTIPEPAVEL 90

Query: 82  LKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVRPVKTVEGTDA--KPIDLVI 139
           + NK   AL G + +P  K  G+ S  + LRK   LFANVRP +++    +  + +DLV+
Sbjct: 91  I-NKHLIALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPARSIPNYKSTYENVDLVL 147

Query: 140 VRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATL 199
           +RENTE  Y  IE   T       + ++ K IT  AT+R+ + A +      +  G   L
Sbjct: 148 IRENTEGEYSGIEHVIT-----PGVIQSIKLITREATERVVRYAFEYT----QAIGRPRL 198

Query: 200 TVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECFD--VI 257
            V HKS +   +DGLF +V +E+     S Y  +    +I+D  +  +  +PE +   V 
Sbjct: 199 LVIHKSTIQRMADGLFVKVAEEL----ASEYPDIKLETEIIDKSILNVVSKPELYSDAVS 254

Query: 258 VAPNLYGDILSDGAAAL-VGSLGLVPSANVGPNIVIGEPCHGSAPDIAGKGIANPIATIR 316
           V PNLYGDILSD  + L  GSLGL PSAN+G  + I E  HGSAPDIAG+  ANP A + 
Sbjct: 255 VCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANPTALLL 314

Query: 317 STAQMLEYLGYSNPAQDIYKAVDANIRD-NKIKTADLGGDSTTQQVIDDILGKL 369
           S+  ML+++G    A  I  AV   I   ++ +TADL G ++T    ++++ +L
Sbjct: 315 SSVMMLKHMGLDEHANKIENAVLTTIASGSENRTADLSGTASTSSFTEEVIQRL 368

>KAFR0B06370 Chr2 complement(1317952..1319088) [1137 bp, 378 aa]
           {ON} Anc_5.473 YOR136W
          Length = 378

 Score =  180 bits (456), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 129/353 (36%), Positives = 184/353 (52%), Gaps = 25/353 (7%)

Query: 23  TIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVDIL 82
           T+  I GDGIG E+  + K + Q  +    + +E  D+       +D    +P + V  +
Sbjct: 45  TVSFIEGDGIGPEISRSVKDIFQAASVP--ITWETCDVSP---ILVDGLTTIPDEAVKSI 99

Query: 83  KNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVRPVKTVEG--TDAKPIDLVIV 140
            NK    L G + +P  K  G+ S  + LRK   LFANVRP K+V G  T    +DLV++
Sbjct: 100 -NKNLVGLKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPAKSVRGFKTTYDNVDLVLI 156

Query: 141 RENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLT 200
           RENTE  Y  IE   T       + ++ K IT  A++R+ + A + A    K  G   + 
Sbjct: 157 RENTEGEYSGIEHVVT-----PGVVQSIKLITRDASERVIRYAFEYA----KAIGRPKVI 207

Query: 201 VTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECFD--VIV 258
           V HKS +   SDGLF  V KE+ +     +  +  + +++D+ V  +   P  +   V V
Sbjct: 208 VVHKSTIQRLSDGLFVNVAKELQKEKN--FQNIELDTELIDNTVLNVVMNPSKYSDAVFV 265

Query: 259 APNLYGDILSDGAAAL-VGSLGLVPSANVGPNIVIGEPCHGSAPDIAGKGIANPIATIRS 317
            PNLYGDILSD  + L  GSLGL PSAN+G  I I E  HGSAPDIAG+  ANP A + S
Sbjct: 266 CPNLYGDILSDLNSGLSAGSLGLTPSANIGDKISIFEAVHGSAPDIAGQNKANPTALLLS 325

Query: 318 TAQMLEYLGYSNPAQDIYKAVDANI-RDNKIKTADLGGDSTTQQVIDDILGKL 369
           +  ML ++G +     I  AV   I   +K +T DLGG +TT    + ++  L
Sbjct: 326 SVMMLHHMGLNEYGDKIENAVLKTIAASSKNRTGDLGGTATTTSFTEAVIDNL 378

>Kwal_55.21273 s55 complement(762121..763227) [1107 bp, 368 aa] {ON}
           YOR136W (IDH2) - NAD+-dependent isocitrate dehydrogenase
           [contig 130] FULL
          Length = 368

 Score =  179 bits (454), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 125/353 (35%), Positives = 190/353 (53%), Gaps = 27/353 (7%)

Query: 23  TIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVDIL 82
           T+  I GDG+G E+  A K +      K  + +E  D+      F++    +P+   D +
Sbjct: 37  TVSFIEGDGVGPEISKAVKDIFAA--AKAPIQWETCDVTP---LFINGLTTIPQPAQDSI 91

Query: 83  KNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVRPVKTVEG--TDAKPIDLVIV 140
            NK   AL G + +P  K  G+ S  + LRK  GLFANVRP K+++G  T    +DLV++
Sbjct: 92  -NKNLIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPAKSIQGFKTAYDNVDLVLI 148

Query: 141 RENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLT 200
           RENTE  Y  IE           + ++ K IT+ A++R+ + A + A    + K    + 
Sbjct: 149 RENTEGEYSGIEHVV-----APGVVQSIKLITQDASERVIRYAFEYARAVERPK----VL 199

Query: 201 VTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECFD--VIV 258
           V HKS +   +DGLF  V +++ +     Y  +    +++D+ V    R+P  +   V+V
Sbjct: 200 VVHKSTIQRLADGLFVSVAEKLAKE----YPDIELQTELIDNTVLHTVRDPLKYSDVVVV 255

Query: 259 APNLYGDILSDGAAAL-VGSLGLVPSANVGPNIVIGEPCHGSAPDIAGKGIANPIATIRS 317
            PNLYGDILSD  + L  GSLGL PSAN+G  + I E  HGSAPDIAG+  ANP A + S
Sbjct: 256 CPNLYGDILSDMNSGLSAGSLGLTPSANIGHEVSIFEAVHGSAPDIAGQNKANPTALLLS 315

Query: 318 TAQMLEYLGYSNPAQDIYKAVDANIRDN-KIKTADLGGDSTTQQVIDDILGKL 369
           +  ML ++G +  A  I KAV + I    + +T DL G ++T    + ++ +L
Sbjct: 316 SVMMLNHMGLTEHADKIEKAVFSTIASGPENRTGDLAGSASTSSFAEAVISRL 368

>TBLA0B02240 Chr2 complement(524111..525232) [1122 bp, 373 aa] {ON}
           Anc_5.473 YOR136W
          Length = 373

 Score =  177 bits (450), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 124/354 (35%), Positives = 187/354 (52%), Gaps = 27/354 (7%)

Query: 22  LTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVDI 81
            T+  I GDG+G E+  + K + +    +  + +E+ D+       L T   +P   V  
Sbjct: 41  FTVPFIEGDGVGPEISKSVKDIFKA--AQVPVDWEYCDVSPLLINGLTT---IPEPAVQQ 95

Query: 82  LKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVRPVKTVEG--TDAKPIDLVI 139
           + NK + AL G + +P  K  G+ S  + LRK  GLFANVRP +++ G  T  K +DLV+
Sbjct: 96  I-NKHKIALKGPLATPIGK--GHRSLNLTLRKTFGLFANVRPARSIRGYETTYKNVDLVL 152

Query: 140 VRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATL 199
           +RENTE  Y  IE           + ++ K IT  A++R+ + A + A    +  G   L
Sbjct: 153 IRENTEGEYSGIEHVV-----APGVVQSIKLITRDASERVIRYAYEYA----RAIGRPRL 203

Query: 200 TVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECFD--VI 257
            V HKS +   +DGLF  + KE+       +  +    +++D+ V  + R+P  +   V 
Sbjct: 204 VVVHKSTIQKLADGLFVNIAKELAPE----FPDIKLETELIDNTVLNVVRDPPSYTDAVT 259

Query: 258 VAPNLYGDILSDGAAAL-VGSLGLVPSANVGPNIVIGEPCHGSAPDIAGKGIANPIATIR 316
           V PNLYGDILSD  + L  GSLGL PSAN+G  + I E  HGSAPDIAG+  ANP A + 
Sbjct: 260 VCPNLYGDILSDLNSGLSAGSLGLTPSANIGNEVSIFEAVHGSAPDIAGQNKANPTALLL 319

Query: 317 STAQMLEYLGYSNPAQDIYKAVDANIRD-NKIKTADLGGDSTTQQVIDDILGKL 369
           S+  ML Y+G  + +  I  A+   I   ++ +T DL G +TT    + ++  L
Sbjct: 320 SSCMMLNYMGLESYSNKIENAILNTIASGSENRTGDLAGTATTSSFTESVIKNL 373

>Kpol_1039.35 s1039 complement(108102..109181) [1080 bp, 359 aa]
           {ON} complement(108102..109181) [1080 nt, 360 aa]
          Length = 359

 Score =  176 bits (445), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 120/350 (34%), Positives = 184/350 (52%), Gaps = 26/350 (7%)

Query: 23  TIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVDIL 82
           T+ L+PGDG+G+E+  +   + +  N    + +E ++L    Q  + T        V+ L
Sbjct: 30  TVTLLPGDGVGREITDSVVSIFEAENLP--IDWERVELSGLEQEDVHTA-------VESL 80

Query: 83  KNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVRPVKTVEGTDAK--PIDLVIV 140
           K    G     +   +   +G++S  V LRKEL ++ANV   K+ +G D +   +DLVI+
Sbjct: 81  KRNKIG--LKGIWHTSADHDGHTSWNVALRKELDIYANVAIFKSFKGVDTRIPDVDLVII 138

Query: 141 RENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLT 200
           RENTE  Y  +E      +    + E+ K +T   T+RIA+ A D A++  +     ++T
Sbjct: 139 RENTEGEYSGLEH-----ESVPGVVESLKIMTAQKTERIARFAFDYAMKYNRK----SVT 189

Query: 201 VTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECFDVIVAP 260
             HK+N++   DGLFR +  E+       Y  V  +  IVD+   +   +P  FDV+VAP
Sbjct: 190 AVHKANIMKLGDGLFRNLVTEI---GAKEYPEVGVSSIIVDNASMQAVAKPHQFDVMVAP 246

Query: 261 NLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEP-CHGSAPDIAGKGIANPIATIRSTA 319
           ++YG IL +  AAL+G  GLVP AN G +  + EP       DI  + IANP A I S  
Sbjct: 247 SMYGTILGNIGAALIGGPGLVPGANYGRDYAVFEPGSRHVGLDIENQNIANPTAMILSAT 306

Query: 320 QMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQVIDDILGKL 369
            ML +LG+ N A  I KAV   I + K  T D+GG +TT +  + ++ KL
Sbjct: 307 LMLNHLGFRNDAARISKAVHEVIAEGKTTTRDIGGSATTTEFTNAVIAKL 356

>ADL223W Chr4 (312893..313981) [1089 bp, 362 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL037C (IDH1)
          Length = 362

 Score =  176 bits (445), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 125/350 (35%), Positives = 181/350 (51%), Gaps = 24/350 (6%)

Query: 23  TIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVDIL 82
           T+ LIPGDGIGKEV  +  Q+ +  N    + +E ++L A     L+      +  V+ L
Sbjct: 31  TVTLIPGDGIGKEVTDSVVQIFEAENVP--VDWESVELSA-----LEENHEGVQKAVESL 83

Query: 83  KNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVRPVKTVEG--TDAKPIDLVIV 140
           K    G L G   +P  +  G+ S  V  RK+L +FANV   K+  G  T  + +DLVI+
Sbjct: 84  KRNKVG-LKGIWHTPADQT-GHGSLNVAFRKQLDIFANVALFKSFPGVKTKLQDVDLVII 141

Query: 141 RENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLT 200
           RENTE  Y  +E           + E+ K +T+  ++RIA+ A D AL+  +      + 
Sbjct: 142 RENTEGEYSGLEHESV-----PGVVESLKIMTKAKSERIARFAFDFALKNNRK----AVC 192

Query: 201 VTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECFDVIVAP 260
             HK+N++   DGLFR    E+       Y  V  +  IVD+   +   +P  FDV+V P
Sbjct: 193 AVHKANIMKLGDGLFRNTVSEI---GAKEYPEVNVSSIIVDNASMQAVAKPHQFDVLVTP 249

Query: 261 NLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEP-CHGSAPDIAGKGIANPIATIRSTA 319
           NLYG IL +  AAL+G  GLVP AN G    + EP C     DI G+ +ANP A I S+ 
Sbjct: 250 NLYGSILGNIGAALIGGPGLVPGANFGREYAVFEPGCRHVGLDIKGQDVANPTAMILSST 309

Query: 320 QMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQVIDDILGKL 369
            ML +LG +  A  I +A    I + K  T D+GG +TT +  + ++ KL
Sbjct: 310 LMLRHLGLNEYADRISRATYETIAEGKRTTKDIGGTATTTEFTNAVIDKL 359

>SAKL0E07876g Chr5 complement(635705..636790) [1086 bp, 361 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037C IDH1 Subunit of mitochondrial NAD( )-
           dependent isocitrate dehydrogenase which catalyzes the
           oxidation of isocitrate to alpha-ketoglutarate in the
           TCA cycle
          Length = 361

 Score =  175 bits (444), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 132/383 (34%), Positives = 189/383 (49%), Gaps = 39/383 (10%)

Query: 1   MLRTSVRQFSVSARNASSLKT-----------LTIGLIPGDGIGKEVIPAGKQVLQNLNK 49
           M R +   F+VS R+ +++ T            T+ LIPGDG+GKEV  +   + +  N 
Sbjct: 1   MFRNT---FAVSKRSLATVATEQLLPKKYGGRYTVTLIPGDGVGKEVTDSVVSIFEAENV 57

Query: 50  KHGLAFEFIDLQAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIV 109
                   ID +    T +D+   + +    + +NK    L G   +P  +  G+ S  V
Sbjct: 58  P-------IDWETINITGVDSEEGVQKAVESLKRNKI--GLKGIWHTPADQT-GHGSLNV 107

Query: 110 QLRKELGLFANVRPVKTVEGTDAK--PIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEA 167
             RK+L +FANV   K V G   K   IDLV++RENTE  Y  +E           + E+
Sbjct: 108 AFRKQLDIFANVALFKNVPGVKTKLSNIDLVVIRENTEGEYSGLEHESV-----PGVVES 162

Query: 168 TKRITETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNK 227
            K IT+  ++RIA+ A D AL+  +     ++   HK+N++   DGLFR    EV  S  
Sbjct: 163 LKIITKAKSERIARFAFDFALKNNRK----SVCAVHKANIMKLGDGLFRNTVNEVGASE- 217

Query: 228 SLYSGVAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVG 287
             Y  +     IVD+   +   +P  FDV+V PNLYG IL +  AAL+G  GLVP AN G
Sbjct: 218 --YPEIDVKNIIVDNASMQAVAKPHQFDVLVTPNLYGSILGNIGAALIGGPGLVPGANFG 275

Query: 288 PNIVIGEP-CHGSAPDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNK 346
               + EP       DI GK +ANP A I S+  ML +LG +  A  I KA    I + K
Sbjct: 276 REYAVFEPGSRHVGLDIKGKDLANPTAMILSSTLMLRHLGLNGYADRISKATYDVIAEGK 335

Query: 347 IKTADLGGDSTTQQVIDDILGKL 369
             T D+GG S+T +    ++ KL
Sbjct: 336 HTTKDIGGSSSTTEFTKSVIDKL 358

>TPHA0J02770 Chr10 (617727..618857) [1131 bp, 376 aa] {ON} Anc_2.278
           YNL037C
          Length = 376

 Score =  174 bits (442), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 126/355 (35%), Positives = 183/355 (51%), Gaps = 27/355 (7%)

Query: 21  TLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVD 80
           T T+  I GDG+G E+  + K +    N    +  ++     G   F++    +P   V 
Sbjct: 43  TYTVPFIEGDGVGPEISKSVKDIFSAAN----VPIQWQPCDVG-PIFVNGLTTIPEPAVK 97

Query: 81  ILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVRPVKTVEGTDA--KPIDLV 138
            +K     AL G + +P  K  G+ S  + LRK   LFANVRP K+V    +  + +DLV
Sbjct: 98  AIKESLV-ALKGPLATPVGK--GHRSLNLTLRKTFDLFANVRPAKSVPNYKSTYENVDLV 154

Query: 139 IVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSAT 198
           ++RENTE  Y  IE   T       + ++ K IT  A++++ + A + A+      G   
Sbjct: 155 LIRENTEGEYSGIEHIVTP-----GVVQSIKLITREASEKVIRYAYEYAI----AVGRPR 205

Query: 199 LTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECFD--V 256
           L V HKS +    DGLF ++  E+    +S Y  +    QI+D+ V  +   P  +   V
Sbjct: 206 LIVVHKSTIQRLGDGLFVQIANEL----QSEYPSIKLETQILDNTVLNVVSNPTLYKDAV 261

Query: 257 IVAPNLYGDILSDGAAAL-VGSLGLVPSANVGPNIVIGEPCHGSAPDIAGKGIANPIATI 315
            V PNLYGDILSD  + L  GSLGL PSAN+G  + I E  HGSAPDIAG+  ANP A +
Sbjct: 262 SVCPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANPTALL 321

Query: 316 RSTAQMLEYLGYSNPAQDIYKAVDANIRDN-KIKTADLGGDSTTQQVIDDILGKL 369
            S+  ML ++G    A  I  AV + I    + +T DLGG +TT    + ++ KL
Sbjct: 322 LSSVMMLNHMGLEEHASRIENAVLSTIASGPESRTGDLGGSATTSSFTECVIKKL 376

>TPHA0D01560 Chr4 complement(321751..322833) [1083 bp, 360 aa] {ON}
           Anc_2.278 YNL037C
          Length = 360

 Score =  174 bits (440), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 125/352 (35%), Positives = 183/352 (51%), Gaps = 29/352 (8%)

Query: 23  TIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLA--FEFIDLQAGYQTFLDTGAALPRDTVD 80
           T+ LIPGDGIGKEV  +  ++  +     GL   +E ID+       +     + +    
Sbjct: 30  TVTLIPGDGIGKEVTDSVVKIFAS----QGLPIDWERIDVPG-----MSNENEVKKAVES 80

Query: 81  ILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVRPVKTVEGTDAK--PIDLV 138
           + +NK    L G   +   +  GY S  V LRK+L +FANV   K+++G   K   +DLV
Sbjct: 81  LKRNKI--GLKGIWHTSADQT-GYGSLNVALRKQLDIFANVAIFKSLKGVKTKIPDVDLV 137

Query: 139 IVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSAT 198
           ++RENTE  Y  +E           + E+ K IT+  T+RIA+ A D AL+  ++    T
Sbjct: 138 VIRENTEGEYSGLEHESV-----PGVVESLKIITKPKTERIARFAFDFALENNRS----T 188

Query: 199 LTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECFDVIV 258
           +T  HK+N++  SDGLF+    EV E     Y  +  N  IVD+   +   +P  FDV+V
Sbjct: 189 VTAVHKANIMKLSDGLFKNTVAEVGEKE---YPDIKVNTIIVDNASMQAVAKPHQFDVMV 245

Query: 259 APNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEP-CHGSAPDIAGKGIANPIATIRS 317
            P++YG IL +  AAL+G  GL+P AN G    + EP       DI  + IANP A I S
Sbjct: 246 TPSMYGTILGNIGAALIGGPGLIPGANYGREHAVFEPGSRHVGLDIENQNIANPTAMILS 305

Query: 318 TAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQVIDDILGKL 369
              ML  LG    ++ I  AV A I + K  T D+GG+++T +  D ++ KL
Sbjct: 306 ATLMLNQLGLREESKRISNAVYAVIEEGKTTTKDIGGNASTTEFTDAVIDKL 357

>Kpol_440.12 s440 (32084..33190) [1107 bp, 368 aa] {ON}
           (32084..33190) [1107 nt, 369 aa]
          Length = 368

 Score =  173 bits (438), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 124/353 (35%), Positives = 186/353 (52%), Gaps = 27/353 (7%)

Query: 23  TIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVDIL 82
           T+  I GDG+G E+  + K +      K  + +E  D+      F++    +P   V  +
Sbjct: 37  TVPFIEGDGVGPEISKSVKDIFAA--AKVPIEWEPCDVGP---IFVNGLTTIPDAAVQSI 91

Query: 83  KNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVRPVKTVEG--TDAKPIDLVIV 140
            NK   AL G + +P  K  G+ S  + LRK   LFANVRP ++V    T  + +DLV++
Sbjct: 92  -NKHLVALKGPLATPIGK--GHRSLNLTLRKTFNLFANVRPARSVPNYKTTYQNVDLVLI 148

Query: 141 RENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLT 200
           RENTE  Y  IE   +       + ++ K IT+ A++R+ + A +      +  G   L 
Sbjct: 149 RENTEGEYSGIEHVIS-----PGVIQSIKLITKDASERVIRYAFEYT----RAIGRPRLV 199

Query: 201 VTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECFD--VIV 258
           V HKS +   +DGLF  V KE+     S Y  +    +++D+ +  +   PE +   V V
Sbjct: 200 VVHKSTIQRMADGLFVNVAKEL----ASEYPDIELQTELIDNTILNVVTHPESYTDAVSV 255

Query: 259 APNLYGDILSDGAAAL-VGSLGLVPSANVGPNIVIGEPCHGSAPDIAGKGIANPIATIRS 317
            PNLYGDILSD  + L  GSLGL PSAN+G  + I E  HGSAPDIAG+  ANP A + S
Sbjct: 256 CPNLYGDILSDLNSGLSAGSLGLTPSANIGDKVSIFEAVHGSAPDIAGQNKANPTALLLS 315

Query: 318 TAQMLEYLGYSNPAQDIYKAVDANIRD-NKIKTADLGGDSTTQQVIDDILGKL 369
           +  ML ++G +  A  I  A+ + I   ++ +T DL G +TT    + ++ KL
Sbjct: 316 SVMMLNHMGLNEHATKIENAILSTIASGSENRTGDLAGTATTSSFTEAVINKL 368

>KLLA0F04103g Chr6 (389159..390244) [1086 bp, 361 aa] {ON}
           uniprot|O94229 Kluyveromyces lactis KLLA0F04103g IDH1
           Isocitrate dehydrogenase subunit 1
          Length = 361

 Score =  172 bits (435), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 121/350 (34%), Positives = 181/350 (51%), Gaps = 25/350 (7%)

Query: 23  TIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVDIL 82
           T+ LIPGDG+GKEV  +  ++ +N N    + +E ID+       L+    + R    + 
Sbjct: 31  TVTLIPGDGVGKEVTDSVVKIFENENIP--IDWETIDISG-----LENTENVQRAVESLK 83

Query: 83  KNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVRPVKTVEG--TDAKPIDLVIV 140
           +NK    L G   +P  +  G+ S  V LRK+L +FANV   K++ G  T    ID+VI+
Sbjct: 84  RNKV--GLKGIWHTPADQT-GHGSLNVALRKQLDIFANVALFKSIPGVKTRLNNIDMVII 140

Query: 141 RENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLT 200
           RENTE  Y  +E           + E+ K +T   ++RIA+ A D AL+  +     ++ 
Sbjct: 141 RENTEGEYSGLEHESV-----PGVVESLKIMTRAKSERIARFAFDFALKNNRK----SVC 191

Query: 201 VTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECFDVIVAP 260
             HK+N++   DGLFR    E+  +    Y  +     IVD+   +   +P  FDV+V P
Sbjct: 192 AVHKANIMKLGDGLFRNTVNEIGANE---YPELDVKNIIVDNASMQAVAKPHQFDVLVTP 248

Query: 261 NLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEP-CHGSAPDIAGKGIANPIATIRSTA 319
           NLYG IL +  +AL+G  GLVP AN G    + EP       DI G+ +ANP A I S+ 
Sbjct: 249 NLYGSILGNIGSALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGQNVANPTAMILSST 308

Query: 320 QMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQVIDDILGKL 369
            ML +LG +  A  I KA    I + K  T D+GG ++T +  + ++ KL
Sbjct: 309 LMLRHLGLNAYADRISKATYDVISEGKSTTRDIGGSASTSEFTNAVIEKL 358

>Ecym_3316 Chr3 (608744..609832) [1089 bp, 362 aa] {ON} similar to
           Ashbya gossypii ADL223W
          Length = 362

 Score =  171 bits (432), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 124/350 (35%), Positives = 178/350 (50%), Gaps = 24/350 (6%)

Query: 23  TIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVDIL 82
           T+ LIPGDG+GKEV  +   + +  N         ID ++   + L+      +  V+ L
Sbjct: 31  TVTLIPGDGVGKEVTDSVVNIFEAENVP-------IDWESVELSGLEENMEGVQKAVESL 83

Query: 83  KNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVRPVKTVEG--TDAKPIDLVIV 140
           K    G L G   +P  +  G+ S  V  RK+L +FANV   K+  G  T  K +DLVI+
Sbjct: 84  KRNKVG-LKGIWSTPADQT-GHGSLNVAFRKQLDIFANVALFKSFPGVKTKLKDVDLVII 141

Query: 141 RENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLT 200
           RENTE  Y  +E           + E+ K +T+  ++RIA+ A D AL+  +     ++ 
Sbjct: 142 RENTEGEYSGLEHESV-----PGVVESLKIMTKAKSERIARFAFDFALKNNRR----SVC 192

Query: 201 VTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECFDVIVAP 260
             HK+N++   DGLFR    E+       Y  +     IVD+   +   +P  FDV+V P
Sbjct: 193 AVHKANIMKLGDGLFRNTVNEI---GAKEYPELEVKSIIVDNASMQAVAKPHQFDVLVTP 249

Query: 261 NLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEP-CHGSAPDIAGKGIANPIATIRSTA 319
           NLYG IL +  AAL+GS GLVP AN G    + EP       DI G+ +ANP A I S+ 
Sbjct: 250 NLYGSILGNVGAALIGSPGLVPGANFGREYAVFEPGSRHVGLDIKGQDVANPTAMILSST 309

Query: 320 QMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQVIDDILGKL 369
            ML +LG ++ A  I KA    I + K  T D+GG ++T Q    I+ KL
Sbjct: 310 LMLRHLGLNDYADRISKATYEVIAEGKHTTKDIGGHASTTQFTKAIVDKL 359

>KLTH0G10186g Chr7 (863151..864233) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|P28834 Saccharomyces cerevisiae
           YNL037C IDH1 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  170 bits (431), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 121/350 (34%), Positives = 178/350 (50%), Gaps = 25/350 (7%)

Query: 23  TIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVDIL 82
           T+ LIPGDG+GKEV  +   + ++ N         ID +    + LD    + +    + 
Sbjct: 30  TVTLIPGDGVGKEVTDSVVSIFESENVP-------IDWETVEISGLDNEEGVQKAVDSLK 82

Query: 83  KNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVRPVKTVEGTDAKP--IDLVIV 140
           +NK    L G   +P+ +  G+ S  V LRK+L +FANV   KTV G  ++   +DLV++
Sbjct: 83  RNKV--GLKGIWHTPSDQT-GHGSLNVALRKQLDIFANVALFKTVPGVPSRHSNVDLVVI 139

Query: 141 RENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLT 200
           RENTE  Y  +E           + E+ K +T+  + RI + A D AL+  +     ++ 
Sbjct: 140 RENTEGEYSGLEHESV-----PGVVESLKIMTKAKSDRIGRFAFDFALKNNRK----SVC 190

Query: 201 VTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECFDVIVAP 260
             HK+N++   DGLFR    E+       Y  +     IVD+   +   +P  FDV+V P
Sbjct: 191 AVHKANIMKLGDGLFRNCINEIGAKE---YPEIEVKNIIVDNASMQAVAKPHQFDVLVTP 247

Query: 261 NLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEP-CHGSAPDIAGKGIANPIATIRSTA 319
           NLYG IL +  AAL+G  GLVP AN G    + EP       DI G+ +ANP A I S+A
Sbjct: 248 NLYGSILGNIGAALIGGPGLVPGANFGREFAVFEPGSRHVGLDIKGQNVANPTAMILSSA 307

Query: 320 QMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQVIDDILGKL 369
            ML +LG ++ A  I KA    I + K  T D+GG ++T      I+ KL
Sbjct: 308 LMLRHLGLNSYADRISKATYDVIAEAKNTTKDIGGSASTTDFTQAIIEKL 357

>TDEL0A03370 Chr1 (599855..600970) [1116 bp, 371 aa] {ON} Anc_5.473
           YOR136W
          Length = 371

 Score =  170 bits (431), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 122/353 (34%), Positives = 181/353 (51%), Gaps = 27/353 (7%)

Query: 23  TIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVDIL 82
           T+  I GDG+G E+  + K +      K  + +E   +       ++    +P    + +
Sbjct: 40  TVSFIEGDGVGPEISKSVKDIFAA--AKVPIVWESCPVTP---LLVNGVTTIPEQAQESI 94

Query: 83  KNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVRPVKTVEG--TDAKPIDLVIV 140
            N+   AL G + +P  K  G+ S  + LRK  GLFANVRP K+VEG  T  + +DLV++
Sbjct: 95  -NRNLVALKGPLATPIGK--GHRSMNLTLRKTFGLFANVRPAKSVEGFKTTYEDVDLVLI 151

Query: 141 RENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLT 200
           RENTE  Y  IE           + ++ K IT  A++R+ + A + A    +  G   L 
Sbjct: 152 RENTEGEYAGIEHVIVP-----GVVQSIKLITREASERVIRYAYEYA----RAVGRPKLV 202

Query: 201 VTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECFD--VIV 258
           V HKS +   +DGLF  V KE+       +  +    +++D+ V  +   P  +   V V
Sbjct: 203 VVHKSTIQRLADGLFVTVAKELAHE----FPDIQLQTELIDNTVLNVVSNPSKYSDVVYV 258

Query: 259 APNLYGDILSDGAAAL-VGSLGLVPSANVGPNIVIGEPCHGSAPDIAGKGIANPIATIRS 317
            PNLYGDILSD  + L  GSLGL PS N+G  + I E  HGSAPDIAG+  ANP A + S
Sbjct: 259 CPNLYGDILSDLNSGLSAGSLGLTPSGNIGHKVSIFEAVHGSAPDIAGQNKANPTALLLS 318

Query: 318 TAQMLEYLGYSNPAQDIYKAVDANIRDN-KIKTADLGGDSTTQQVIDDILGKL 369
           +  ML ++G    A  I KAV   I    + +T DL G ++T    + ++ +L
Sbjct: 319 SVMMLNHMGLFEHASKIEKAVLTTIAAGPESRTGDLAGSASTSSFTEAVISRL 371

>YNL037C Chr14 complement(557920..559002) [1083 bp, 360 aa] {ON}
           IDH1Subunit of mitochondrial NAD(+)-dependent isocitrate
           dehydrogenase, which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 360

 Score =  169 bits (429), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 120/351 (34%), Positives = 185/351 (52%), Gaps = 25/351 (7%)

Query: 22  LTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVDI 81
            T+ LIPGDG+GKE+  + + + +  N    + +E I+++   QT    G     + V+ 
Sbjct: 29  FTVTLIPGDGVGKEITDSVRTIFEAENIP--IDWETINIK---QTDHKEGV---YEAVES 80

Query: 82  LKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVRPVKTVEGTDAK--PIDLVI 139
           LK    G L G   +P  +  G+ S  V LRK+L ++ANV   K+++G   +   IDL++
Sbjct: 81  LKRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIV 138

Query: 140 VRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATL 199
           +RENTE  +  +E           + E+ K +T   T+RIA+ A D A    K     ++
Sbjct: 139 IRENTEGEFSGLEHESV-----PGVVESLKVMTRPKTERIARFAFDFA----KKYNRKSV 189

Query: 200 TVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECFDVIVA 259
           T  HK+N++   DGLFR +  E+ +     Y  +  +  IVD+   +   +P  FDV+V 
Sbjct: 190 TAVHKANIMKLGDGLFRNIITEIGQKE---YPDIDVSSIIVDNASMQAVAKPHQFDVLVT 246

Query: 260 PNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEP-CHGSAPDIAGKGIANPIATIRST 318
           P++YG IL +  AAL+G  GLV  AN G +  + EP       DI G+ +ANP A I S+
Sbjct: 247 PSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSS 306

Query: 319 AQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQVIDDILGKL 369
             ML +LG +  A  I KAV   I + K  T D+GG S+T    ++I+ KL
Sbjct: 307 TLMLNHLGLNEYATRISKAVHETIAEGKHTTRDIGGSSSTTDFTNEIINKL 357

>Smik_14.290 Chr14 (528131..529213) [1083 bp, 360 aa] {ON} YNL037C
           (REAL)
          Length = 360

 Score =  169 bits (428), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 120/351 (34%), Positives = 185/351 (52%), Gaps = 25/351 (7%)

Query: 22  LTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVDI 81
            T+ LIPGDG+GKE+  + K + +   +K  + +E ++++   QT    G     + V+ 
Sbjct: 29  FTVTLIPGDGVGKEITDSVKTIFEA--EKIPVDWETVNIK---QTDHKEGV---YEAVES 80

Query: 82  LKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVRPVKTVEGTDAK--PIDLVI 139
           LK    G L G   +P  +  G+ S  V LRK+L ++ANV   K+++G   +   IDL++
Sbjct: 81  LKRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIV 138

Query: 140 VRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATL 199
           +RENTE  +  +E           + E+ K +T   T+RIA+ A D A    K      +
Sbjct: 139 IRENTEGEFSGLEHESV-----PGVVESLKIMTRPKTERIARFAFDFA----KKYNRKAV 189

Query: 200 TVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECFDVIVA 259
           T  HK+N++   DGLFR +  E+ +     Y  +  +  IVD+   +   +P  FDV+V 
Sbjct: 190 TAVHKANIMKLGDGLFRNIITEIGQKE---YPDIDVSSIIVDNASMQAVAKPHQFDVLVT 246

Query: 260 PNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEP-CHGSAPDIAGKGIANPIATIRST 318
           P++YG IL +  AAL+G  GLV  AN G +  + EP       DI G+ +ANP A I S+
Sbjct: 247 PSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSS 306

Query: 319 AQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQVIDDILGKL 369
             ML +LG +  A  I KAV   I + K  T D+GG S+T    ++I+ KL
Sbjct: 307 VLMLNHLGLNEYATRISKAVHETIAEGKHTTKDIGGSSSTTDFTNEIINKL 357

>Kwal_23.5012 s23 (964254..965339) [1086 bp, 361 aa] {ON} YNL037C
           (IDH1) - alpha-4-beta-4 subunit of mitochondrial
           isocitrate dehydrogenase 1 [contig 7] FULL
          Length = 361

 Score =  169 bits (428), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 118/350 (33%), Positives = 180/350 (51%), Gaps = 25/350 (7%)

Query: 23  TIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVDIL 82
           T+ LIPGDG+GKEV  +   + ++ N         ID +    + LD    + +    + 
Sbjct: 31  TVTLIPGDGVGKEVTDSVVSIFESENIP-------IDWETVEISGLDNQEGVQKAVESLK 83

Query: 83  KNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVRPVKTVEGTDAKP--IDLVIV 140
           +NK    L G   +P+ +  G+ S  V LRK+L +FANV   K+V G  ++   +D+V++
Sbjct: 84  RNKV--GLKGIWHTPSDQT-GHGSLNVALRKQLDIFANVALFKSVPGVPSRHSNVDMVVI 140

Query: 141 RENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLT 200
           RENTE  Y  +E           + E+ K +T+  ++RI + A D A++  +     ++ 
Sbjct: 141 RENTEGEYSGLEHESV-----PGVVESLKIMTKAKSERIGRFAFDFAVKNNRK----SVC 191

Query: 201 VTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECFDVIVAP 260
             HK+N++   DGLFR    EV       Y  +     IVD+   +   +P  FDV+V P
Sbjct: 192 AVHKANIMKLGDGLFRNCINEV---GAKEYPEIDVKNIIVDNASMQAVAKPHQFDVLVTP 248

Query: 261 NLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEP-CHGSAPDIAGKGIANPIATIRSTA 319
           NLYG IL +  AAL+G  GLVP AN G    + EP       DI G+ +ANP A I S++
Sbjct: 249 NLYGSILGNIGAALIGGPGLVPGANFGREYAVFEPGSRHVGLDIKGQNVANPTAMILSSS 308

Query: 320 QMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQVIDDILGKL 369
            ML +LG +  A  I KA    I + K  T D+GG ++T +  + I+ KL
Sbjct: 309 LMLRHLGLNAYADRISKATYDVIAEAKTTTQDIGGSASTTEFTEAIISKL 358

>NDAI0B03590 Chr2 complement(901108..902187) [1080 bp, 359 aa] {ON}
           Anc_2.278
          Length = 359

 Score =  168 bits (426), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 117/351 (33%), Positives = 183/351 (52%), Gaps = 25/351 (7%)

Query: 22  LTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVDI 81
            T+ L+PGDG+GKE+  +   + ++ N    + +E +D+       LD    + +  VD 
Sbjct: 28  FTVTLLPGDGVGKEITDSVVSIFKSENVP--IDWETVDISG-----LDHTEGV-KAAVDS 79

Query: 82  LKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVRPVKTVEGTDAK--PIDLVI 139
           LK    G L G   +P  +V G+ S  V  RK+L ++ANV   K++EG   K   +DLV+
Sbjct: 80  LKRNKIG-LKGIWHTPADQV-GHGSLNVAFRKQLDIYANVAIFKSIEGVKTKIPNVDLVV 137

Query: 140 VRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATL 199
           +RENTE  Y  +E           + E+ K IT++ ++RIA+ A D A    K     ++
Sbjct: 138 IRENTEGEYSGLEHESV-----PGVVESLKIITKSKSERIARFAFDFA----KRNNRKSV 188

Query: 200 TVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECFDVIVA 259
           T  HK+N++  SDGLFR    ++ E     Y  +  +  IVD+   +   +P  FDV+V 
Sbjct: 189 TAVHKANIMKLSDGLFRNTVSKIGEEE---YPEIQTSSIIVDNASMQAVAKPHQFDVMVT 245

Query: 260 PNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEP-CHGSAPDIAGKGIANPIATIRST 318
           P++YG I+ +  AAL+G  GLVP  N G +  + EP       DI G+ +ANP A + S 
Sbjct: 246 PSMYGTIVGNIGAALIGGPGLVPGVNYGRDYAVFEPGSRHVGLDIKGQNVANPTAMLLSA 305

Query: 319 AQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQVIDDILGKL 369
             +L++LG    A  I  AV   I + K  T D+GG ++T +    ++ KL
Sbjct: 306 TLLLDHLGLEKSANRIKSAVYDVIAEGKATTQDIGGSASTTEFTQAVINKL 356

>TPHA0E01480 Chr5 complement(300222..301355) [1134 bp, 377 aa] {ON}
           Anc_5.473 YOR136W
          Length = 377

 Score =  169 bits (427), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 120/353 (33%), Positives = 185/353 (52%), Gaps = 28/353 (7%)

Query: 23  TIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVDIL 82
           T+  I GDG+G E+     + ++ + K   +  ++++   G    ++    +P+  VD +
Sbjct: 46  TVPFIEGDGVGPEI----SKSVRTIFKAAKVPIDWVNCDIG-PLLINGETTIPQTAVDQI 100

Query: 83  KNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVRPVKTVE--GTDAKPIDLVIV 140
            N    AL G + +P    +G+ S  + LRK  GLFANVRP K++    +  + +DL+++
Sbjct: 101 NNSLI-ALKGPLATPVG--QGHRSINLTLRKTFGLFANVRPAKSIPNLASTYENVDLIVI 157

Query: 141 RENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLT 200
           RENTE  Y  IE           + ++ K IT  A++++ K A +      ++ G + L 
Sbjct: 158 RENTEGEYSGIEHEIV-----PGVVQSIKLITRKASEKVIKYAFEYT----RSIGRSNLI 208

Query: 201 VTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECF--DVIV 258
           V HK+ +  + DGLF +  +E+ +     Y  V    +++D+ V      PE +   V V
Sbjct: 209 VVHKATIQRRGDGLFVQTAQEMADK----YPDVNLKLELIDNTVLNCIMNPEKYADSVSV 264

Query: 259 APNLYGDILSDGAAAL-VGSLGLVPSANVGPNIVIGEPCHGSAPDIAGKGIANPIATIRS 317
            PNLYGDILSD  + L  GSLGL PSAN+G   V+ E  HGSAPDIAG+  ANP A + S
Sbjct: 265 CPNLYGDILSDLNSGLSTGSLGLTPSANIG-ETVLYEAVHGSAPDIAGQDKANPTALLLS 323

Query: 318 TAQMLEYLGYSNPAQDIYKAVDANIRDNK-IKTADLGGDSTTQQVIDDILGKL 369
           +  ML ++G    A  I  AV   I   K  +TADLGG +TT      ++  L
Sbjct: 324 SVMMLNHMGLQKYADMIETAVLTTITSGKEFRTADLGGSATTTSFTKAVIENL 376

>Skud_14.293 Chr14 (538202..539287) [1086 bp, 361 aa] {ON} YNL037C
           (REAL)
          Length = 361

 Score =  168 bits (426), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 118/351 (33%), Positives = 187/351 (53%), Gaps = 25/351 (7%)

Query: 22  LTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVDI 81
            T+ LIPGDG+GKE+  + + + +   ++  + +E I+++   QT    G     + V+ 
Sbjct: 29  FTVTLIPGDGVGKEITDSVRTIFEA--ERIPVDWETINIK---QTDHKEGV---YEAVES 80

Query: 82  LKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVRPVKTVEGTDAK--PIDLVI 139
           LK    G L G   +P  +  G+ S  V LRK+L ++ANV   K+++G   +   IDL++
Sbjct: 81  LKRNKIG-LKGLWHTPADQT-GHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIV 138

Query: 140 VRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATL 199
           +RENTE  +  +E           + E+ K +T+  T+RIA+ A D A    K      +
Sbjct: 139 IRENTEGEFSGLEHESV-----PGVVESLKVMTKPKTERIARFAFDFA----KKYNRKAV 189

Query: 200 TVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECFDVIVA 259
           T  HK+N++   DGLFR +  E+ ++    Y  +  +  IVD+   +   +P  FDV+V 
Sbjct: 190 TAVHKANIMKLGDGLFRNIITEIGQTE---YPDIDVSSIIVDNASMQAVAKPHQFDVLVT 246

Query: 260 PNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEP-CHGSAPDIAGKGIANPIATIRST 318
           P++YG IL +  AAL+G  GLV  AN G +  + EP       DI G+ +ANP A I S+
Sbjct: 247 PSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANPTAMILSS 306

Query: 319 AQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQVIDDILGKL 369
             ML +LG +  A  I KAV   I + K  T D+GG S+T    ++++ KL
Sbjct: 307 VLMLNHLGLNENATRISKAVHETIAEGKHTTRDIGGSSSTTDFTNEVINKL 357

>KAFR0J01410 Chr10 complement(256693..257745) [1053 bp, 350 aa] {ON}
           Anc_2.278 YNL037C
          Length = 350

 Score =  167 bits (424), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 123/376 (32%), Positives = 196/376 (52%), Gaps = 37/376 (9%)

Query: 1   MLRTSVRQFSVSARNASSLK-TLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFID 59
           MLR ++ + S+S  +         I LIPG+GIGKEV  + + + Q  N    + +E ++
Sbjct: 1   MLRNTLLRRSISTISPKKYGGRFQITLIPGNGIGKEVTDSVRSIFQAENLP--IDWEIVN 58

Query: 60  LQA---GYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELG 116
           +++   G +T +D+          I +NK   AL G   S    ++G  S  V LRK+L 
Sbjct: 59  IESHRDGIKTAVDS----------IKRNKI--ALKGIWSS--DPIDG--SLNVALRKQLD 102

Query: 117 LFANVRPVKTVEGTDAK--PIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITET 174
           +FANV   K+ +  + +   +DLV++RENTE  +  +E    D      + E+ K +T+ 
Sbjct: 103 IFANVAIFKSFDNVNTRIPNVDLVVIRENTEGEFSGLEHESVDG-----VVESLKIVTKP 157

Query: 175 ATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVA 234
            T+RIA+ A D A    K      +T  HK+N++   DGLF+ +   +  +    Y  + 
Sbjct: 158 KTERIARFAFDFA----KKHNRNHVTAVHKANIMKLGDGLFKNIVAHIGNNE---YPEIK 210

Query: 235 YNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGE 294
            +  IVD+   +   +P  FDV+V+P++YG IL +  AAL+G  GLVP AN G +  + E
Sbjct: 211 NSSIIVDNASMQAVAKPHQFDVLVSPSMYGTILGNIGAALIGGPGLVPGANFGRDYAVFE 270

Query: 295 P-CHGSAPDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLG 353
           P       DI G+ +ANP A I S   ML +LG ++PA+ I  AV   I      T D+G
Sbjct: 271 PGSRHVGLDIKGQNVANPTAMILSATWMLRHLGLTSPAERITNAVKHVIAQGTTVTKDIG 330

Query: 354 GDSTTQQVIDDILGKL 369
           G ++T +  D ++ +L
Sbjct: 331 GTASTTEFTDAVINEL 346

>TBLA0B06910 Chr2 (1634845..1635942) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score =  167 bits (423), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 119/350 (34%), Positives = 183/350 (52%), Gaps = 25/350 (7%)

Query: 23  TIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVDIL 82
           T+ LIPGDG+GKEV  +   +    N    + +E +D+       LD    +      + 
Sbjct: 35  TVTLIPGDGVGKEVTDSVVSIFNAENLP--IDWERVDISG-----LDHEEGVEAAVNSLK 87

Query: 83  KNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVRPVKTVEGTDAK--PIDLVIV 140
           +NK    L G   +   + + + S  V LRK+L ++ANV   KT+ G   +   +DLVI+
Sbjct: 88  RNKI--GLKGIWHTSAGQSD-HGSLNVALRKQLDIYANVAHFKTLPGVKTRIPDVDLVII 144

Query: 141 RENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLT 200
           RENTE  Y  +E           + E+ K IT+  ++RIA+ A D A +R   K    +T
Sbjct: 145 RENTEGEYSGLEHESV-----PGVVESLKIITKEKSERIARFAFDFA-KRFDRK---LVT 195

Query: 201 VTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECFDVIVAP 260
             HK+N++   DGLFR     + E+    Y  +  +  IVD+   +   +P  FDV+V P
Sbjct: 196 AVHKANIMKLGDGLFRNSVTSIGETE---YPDIKVSSIIVDNASMQSVAKPHQFDVLVTP 252

Query: 261 NLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEP-CHGSAPDIAGKGIANPIATIRSTA 319
           ++YG IL +  AAL+G  GLVP AN G    + EP       DI G+ +ANP A I S+ 
Sbjct: 253 SMYGTILGNIGAALIGGPGLVPGANYGTECAVFEPGSRHVGLDIKGQNVANPTAMILSST 312

Query: 320 QMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQVIDDILGKL 369
            +L++LG +N A+ I  AV   I + K+ T D+GG ++T +  ++I+ KL
Sbjct: 313 LLLKHLGLNNEAKKIEDAVYKTIAEGKVTTRDIGGSASTTEFTNEIIKKL 362

>ZYRO0D11220g Chr4 (946652..947758) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P28241 Saccharomyces cerevisiae
           YOR136W IDH2 Subunit of mitochondrial NAD( )- dependent
           isocitrate dehydrogenase which catalyzes the oxidation
           of isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 368

 Score =  167 bits (422), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 124/352 (35%), Positives = 184/352 (52%), Gaps = 27/352 (7%)

Query: 24  IGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVDILK 83
           +  I GDGIG E+  + K +      K  + FE + ++      ++   ++P +    + 
Sbjct: 38  VSFIEGDGIGPEISKSVKDIFAA--AKVPVDFESVVVKP---ILVNGVTSIPEEAQKSI- 91

Query: 84  NKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVRPVKTVEG--TDAKPIDLVIVR 141
           N    AL G + +P  K  G+ S  + LRK  GLFAN+RP K+VEG  T    ++LV++R
Sbjct: 92  NTNLVALKGPLATPVGK--GHRSMNLTLRKTFGLFANLRPAKSVEGFKTIYDNVNLVLIR 149

Query: 142 ENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLTV 201
           ENTE  Y  IE           + ++ K IT  A++R+ + A + A    + +    L V
Sbjct: 150 ENTEGEYAGIEHAIV-----PGVVQSIKLITREASERVIRFAYEYARAAERPR----LIV 200

Query: 202 THKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECFD--VIVA 259
            HKS +   SDGLF +V KE+    +S +  +    +++D+ V     +P  +   V V 
Sbjct: 201 VHKSTIQRLSDGLFVDVAKEL----QSEFPDIKLETELIDNAVLNTVTDPTKYSDAVSVC 256

Query: 260 PNLYGDILSDGAAAL-VGSLGLVPSANVGPNIVIGEPCHGSAPDIAGKGIANPIATIRST 318
           PNLYGDILSD  + L  GSLGL PS N+G  + I E  HGSAPDIAGK  ANP A + S+
Sbjct: 257 PNLYGDILSDMNSGLSAGSLGLTPSGNIGHKVSIFEAVHGSAPDIAGKDKANPTALLLSS 316

Query: 319 AQMLEYLGYSNPAQDIYKAVDANIRDN-KIKTADLGGDSTTQQVIDDILGKL 369
             ML ++G    A  I KAV   I    + +T DL G ++T    + ++ KL
Sbjct: 317 VMMLHHMGLHEHASQIEKAVLTTIAAGPESRTGDLKGSASTSSFTEAVIKKL 368

>NCAS0B06290 Chr2 complement(1186838..1187917) [1080 bp, 359 aa]
           {ON} Anc_2.278
          Length = 359

 Score =  166 bits (421), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 116/351 (33%), Positives = 183/351 (52%), Gaps = 26/351 (7%)

Query: 22  LTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVDI 81
           +T+ L+PGDG+GKE+  +   + Q  N    + +E +D+       LD    +      +
Sbjct: 29  MTVTLLPGDGVGKEITDSVVSIFQAENVP--IDWETVDISQ-----LDHEDGVNAAVESL 81

Query: 82  LKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVRPVKTVEGTDAK--PIDLVI 139
            +NK    L G   +   +V G+ S  V  RK+L ++ANV   K++ G   K   +DLVI
Sbjct: 82  KRNKI--GLKGIWHTSADQV-GHGSLNVAFRKQLDIYANVAFCKSIPGVKTKIPNVDLVI 138

Query: 140 VRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATL 199
           +RENTE  Y  +E           + E+ K +T+  ++RIAK A D A++  +      +
Sbjct: 139 IRENTEGEYSGLEHESV-----PGVVESLKIVTKVNSERIAKFAFDFAMRHDR----KMV 189

Query: 200 TVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECFDVIVA 259
           T  HK+N++  SDGLFR     V E+    Y  +  +  IVD+   +   +P  FDV+V 
Sbjct: 190 TAVHKANIMKLSDGLFRNTVARVGEA----YPQIKNDSIIVDNASMQAVAKPHQFDVMVT 245

Query: 260 PNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEP-CHGSAPDIAGKGIANPIATIRST 318
           P++YG IL +  AAL+G  GLVP  N G    + EP       DI G+ +ANP A I S+
Sbjct: 246 PSMYGTILGNIGAALIGGPGLVPGVNYGREYAVFEPGSRHVGLDIKGQNVANPTAMILSS 305

Query: 319 AQMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQVIDDILGKL 369
             +L++LG ++ A  I KAV   I++    T D+GG+++T +    ++ KL
Sbjct: 306 TLLLQHLGLNDTASRISKAVYDVIKEGNATTKDIGGNASTTEFTKAVIDKL 356

>TDEL0C03840 Chr3 complement(673007..674092) [1086 bp, 361 aa] {ON}
           Anc_2.278 YNL037C
          Length = 361

 Score =  166 bits (421), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 132/386 (34%), Positives = 184/386 (47%), Gaps = 45/386 (11%)

Query: 1   MLRTSV--RQFSVSARNASSLKT-----LTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGL 53
           MLR++V  R F+  A     L         + LIPGDG+GKEV  +   + +  N    L
Sbjct: 1   MLRSAVGKRMFASVAAAEKVLPKKYGGRFVVTLIPGDGVGKEVTDSVVSIFEAEN----L 56

Query: 54  AFEF-------IDLQAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSS 106
             ++       +D + G Q  +D+          + +NK    L G   +      G  S
Sbjct: 57  PIDWDRVDISGLDHEEGVQAAVDS----------LKRNKI--GLKGIWHTSAADQAGKGS 104

Query: 107 PIVQLRKELGLFANVRPVKTVEGTDAK--PIDLVIVRENTEDLYIKIEKTYTDPKDGSRI 164
             V LRKEL ++ANV   K+V G   K   +DLV++RENTE  Y  +E           +
Sbjct: 105 LNVALRKELDIYANVALFKSVPGVKTKIPNVDLVVIRENTEGEYSGLEHESV-----PGV 159

Query: 165 AEATKRITETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYE 224
            E+ K +TE  T+RIA+ A D A    K      +T  HK+N++   DGLFR V   V E
Sbjct: 160 VESLKIMTEDKTERIARFAFDFA----KKYNRHAVTAVHKANIMKLGDGLFRNVVTRVGE 215

Query: 225 SNKSLYSGVAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSA 284
                Y  V     IVD+   +   +P  FDV+V P++YG IL +  AAL+G  GLV  A
Sbjct: 216 QE---YPDVKVGSIIVDNASMQTVAKPHQFDVLVTPSMYGTILGNIGAALIGGPGLVAGA 272

Query: 285 NVGPNIVIGEP-CHGSAPDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYKAVDANIR 343
           N G    + EP       DI  K IANP A I S + ML++LG S  A  I  AV   I 
Sbjct: 273 NYGREYAVFEPGSRHVGLDIKDKNIANPTAMILSASLMLDHLGLSTSATKISNAVHQVIA 332

Query: 344 DNKIKTADLGGDSTTQQVIDDILGKL 369
           + K  T D+GG ++T +    ++ KL
Sbjct: 333 EGKSTTPDIGGSASTTEFTQAVIEKL 358

>ZYRO0D02838g Chr4 (223132..224217) [1086 bp, 361 aa] {ON} similar
           to uniprot|P28834 Saccharomyces cerevisiae YNL037C IDH1
           Subunit of mitochondrial NAD( )-dependent isocitrate
           dehydrogenase which catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate in the TCA cycle
          Length = 361

 Score =  161 bits (408), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 118/350 (33%), Positives = 180/350 (51%), Gaps = 24/350 (6%)

Query: 23  TIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVDIL 82
           T+ LIPGDG+GKEV  +   + +  N    + ++ +D+ +G     D  +A     V+ L
Sbjct: 30  TVTLIPGDGVGKEVTDSVVSIFKAENVP--VDWDRVDI-SGVDRAEDVKSA-----VESL 81

Query: 83  KNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVRPVKTVEGTDAK--PIDLVIV 140
           K    G L G   +      G+ S  V LRKEL ++ANV   K++ G   K   +DLV++
Sbjct: 82  KRNRIG-LKGIWHTSPADQAGHGSLNVALRKELDIYANVARFKSIPGVQVKIPDVDLVVI 140

Query: 141 RENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLT 200
           RENTE  +  +E           + E+ K +T+   +RIA+ A D A    K      + 
Sbjct: 141 RENTEGEFSGLEHESV-----PGVVESLKIMTQDNIERIARFAFDYA----KKNDRKQVV 191

Query: 201 VTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECFDVIVAP 260
             HK+N++   DGLF+ + +EV E     Y  +     IVD+   +    P  FDV+V P
Sbjct: 192 AVHKANIMKMGDGLFKNLVQEVGEKE---YPELQVGNIIVDNASMQTVANPHQFDVLVTP 248

Query: 261 NLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEP-CHGSAPDIAGKGIANPIATIRSTA 319
           ++YG IL +  AAL+G  GLV  AN G ++ + EP       DI G+ +ANP A I S+ 
Sbjct: 249 SMYGTILGNIGAALIGGPGLVAGANYGRDVALFEPGSRHVGLDIKGQNVANPTAMILSSV 308

Query: 320 QMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQVIDDILGKL 369
            +L +LG +  A  I KAV A I + K  T D+GG ++T +  + ++ KL
Sbjct: 309 LLLNHLGLNTSADRISKAVHAVIAEGKSVTRDIGGTASTTEFTEAVINKL 358

>KNAG0A05280 Chr1 (780448..781533) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score =  156 bits (394), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 110/350 (31%), Positives = 173/350 (49%), Gaps = 24/350 (6%)

Query: 23  TIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVDIL 82
           T+ L+PGDG+GKE   +   V    N    + +E +++       LD    +      + 
Sbjct: 28  TVTLLPGDGVGKECTDSVVSVFNAENIP--IDWEIVNISG-----LDHKEGVAAAVQSLR 80

Query: 83  KNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVRPVKTVEG--TDAKPIDLVIV 140
           +NK    L G   +      G+ S  V  RK+L ++ANV   K+++G  T    +DLV++
Sbjct: 81  RNKI--GLKGLWHTSNADQSGHGSLNVAFRKQLDIYANVAVFKSLKGVKTMIPDVDLVVI 138

Query: 141 RENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLT 200
           RENTE  +  +E    +      + E+ K  T   T+RIA+ A + A    +  G   + 
Sbjct: 139 RENTEGEFSGLEHESVEG-----VVESLKVTTLPKTERIARFAFNYA----QKNGRKAVC 189

Query: 201 VTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECFDVIVAP 260
             HK+N++   DGLFR     + E     Y  +  +  IVD+   +   +P  FDV+V P
Sbjct: 190 AVHKANIMKLGDGLFRNTVTSIGEKE---YPDIETSSIIVDNASMQAVAKPHQFDVLVTP 246

Query: 261 NLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEP-CHGSAPDIAGKGIANPIATIRSTA 319
           ++YG I+ +  AAL+G  GLV  AN G    + EP       DI G+ IANP A + S+A
Sbjct: 247 SMYGTIIGNIGAALIGGPGLVAGANFGREYAVFEPGSRHVGLDIKGQNIANPTAMLLSSA 306

Query: 320 QMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQVIDDILGKL 369
            ML +LG +   + I  AV   I +  ++T D+GGD+TT +    ++ KL
Sbjct: 307 LMLNHLGLTKSGKRISDAVREVIAEGDVRTKDIGGDATTTEFTQAVIEKL 356

>CAGL0G02673g Chr7 complement(246455..247531) [1077 bp, 358 aa] {ON}
           highly similar to uniprot|P28834 Saccharomyces
           cerevisiae YNL037c IDH1 or uniprot|P28241 Saccharomyces
           cerevisiae YOR136w IDH2
          Length = 358

 Score =  155 bits (392), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 112/350 (32%), Positives = 176/350 (50%), Gaps = 25/350 (7%)

Query: 23  TIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVDIL 82
           T+ LIPGDG+GKE+  +   + +  N    + +E +D+        D   A     V+ L
Sbjct: 28  TVTLIPGDGVGKEITDSVVSIFEAENIP--VDWERVDISTS-DNIQDVSQA-----VESL 79

Query: 83  KNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVRPVKTVEGTDAK--PIDLVIV 140
           K    G     +   +  +  + S  V LRK+L +FA+V   K+V G   K   +DLV++
Sbjct: 80  KRNKIG--LKGIWHTSADIADHGSFNVALRKQLDMFAHVAFFKSVPGVKTKIPNVDLVVI 137

Query: 141 RENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLT 200
           RENTE  Y  +E           + E+ K IT+  ++RIA+ A D A    K     ++ 
Sbjct: 138 RENTEGEYSGLEHESV-----PGVVESLKIITKAKSERIARFAFDFA----KKYNRKSVC 188

Query: 201 VTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECFDVIVAP 260
             HK+N++   DGLFR    E+     + Y  +  +  IVD+   +   +P  FDV+V P
Sbjct: 189 AVHKANIMKMGDGLFRNTVTEI---GANEYPDIQTSSIIVDNASMQAVAKPHQFDVMVTP 245

Query: 261 NLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEP-CHGSAPDIAGKGIANPIATIRSTA 319
           ++YG I+ +  AAL+G  GLV  A+ G    + EP       DI GK +ANP A I S+ 
Sbjct: 246 SMYGTIIGNIGAALIGGPGLVAGAHYGREHAVFEPGSQHVGLDIKGKNVANPTAMILSST 305

Query: 320 QMLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQVIDDILGKL 369
            ML++LG +  A+ I KA    I   ++ T D+GG ++T +  + I+ +L
Sbjct: 306 LMLQHLGLTESAKRIAKATHDVISLGQVTTKDIGGSASTTEFTEAIIKRL 355

>TBLA0C01500 Chr3 complement(347212..348309) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score =  155 bits (391), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 124/369 (33%), Positives = 189/369 (51%), Gaps = 38/369 (10%)

Query: 23  TIGLIPGDGIGKEVIPAGKQVLQNLN-KKHGLAFEFIDLQAGYQTFLDTGAALPRDTVDI 81
            I ++PGD +G+E++    +VL+ +  K+HG+ F F     G      TG  LP +T++ 
Sbjct: 6   NIVVLPGDHVGQEIVEEAVKVLKIVEEKRHGVKFNFQYHLIGGDAIDKTGDPLPDETLEA 65

Query: 82  LKNKCQGALFGAVQSP---TTKVEGYSSPIVQLRKELGLFANVRPVKTV----------E 128
            K +    L GAV  P   T KV      ++++RKELGL+ N+RP K +          +
Sbjct: 66  AK-QSDAVLLGAVGGPKWGTGKVRPEQG-LLKIRKELGLYGNLRPCKFISDKLIGLSPLK 123

Query: 129 GTDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIAL 188
               K  D V+VRE    +Y    +      DGS +A  +++ +    KRI K A   A 
Sbjct: 124 EEVCKGTDFVVVRELVGGIYFGERQE----DDGSGVAWDSEKYSIEEVKRITKMA---AF 176

Query: 189 QRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLF 248
             L+      +    K+NVL+ S  L+R    E        +  +    Q++DS    L 
Sbjct: 177 LSLQNDPPLPIWSLDKANVLASSR-LWRAAVDETIAE----FPNLKVQHQLIDSAAMMLV 231

Query: 249 REPECFD-VIVAPNLYGDILSDGAAALVGSLGLVPSANVGP----NIVIG--EPCHGSAP 301
           + P   + +I+  N++GDI+SD A+ + GSLGL+PSA++      N   G  EPCHGSAP
Sbjct: 232 KNPTQLNGIILTNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNKAFGLYEPCHGSAP 291

Query: 302 DIAGKGIANPIATIRSTAQMLEY-LGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQ 360
           D+A +G  NP+ATI S A ML+  L      + I +AV   + D  I+TADLGG+STT +
Sbjct: 292 DLA-RGKVNPVATILSAAMMLKLSLDMVQEGEAIERAVSV-VLDRGIRTADLGGNSTTSE 349

Query: 361 VIDDILGKL 369
           + D +  +L
Sbjct: 350 LGDAVAQEL 358

>AAL012C Chr1 complement(320148..321266) [1119 bp, 372 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL018W
           (LEU2)
          Length = 372

 Score =  148 bits (373), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 127/368 (34%), Positives = 195/368 (52%), Gaps = 45/368 (12%)

Query: 24  IGLIPGDGIGKEVIPAGKQVL----QNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTV 79
           I ++PGD IG+EV+    +VL    Q+L+  H   F+F     G      TG+ALP + +
Sbjct: 7   IVVLPGDHIGREVVEEAVKVLGAVEQSLSDVH---FDFQYHLVGGAAIDATGSALPDEAL 63

Query: 80  DILKNKCQGALFGAVQSPTTKVEGYSSP---IVQLRKELGLFANVRPVK-----TVEGTD 131
              K +    L GAV  P  +  G   P   +++LR+ELG++AN+RP        +E + 
Sbjct: 64  GAAK-EADAVLLGAVGGPKWQ-GGAVRPEQGLLKLRQELGVYANLRPCNFAADSLLELSP 121

Query: 132 AKP-----IDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDI 186
            +P      D+++VRE     Y    + + D  DG  +A  T + T    +RIA+ A  +
Sbjct: 122 LRPEIARDTDIMVVRELLGGSYFG--ERHEDEGDG--VAWDTDKYTVKEVQRIARMAGFL 177

Query: 187 ALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYR 246
           ALQ        +L    K+NVL+ S  L+R+  +E ++S    +  V    Q++DS    
Sbjct: 178 ALQHDPPLPVWSLD---KANVLASSR-LWRKTVEETFQSE---FPNVQLQHQLIDSAAMI 230

Query: 247 LFREPECFD-VIVAPNLYGDILSDGAAALVGSLGLVPSANVG--PN----IVIGEPCHGS 299
           L + P  F+ V+V  N++GDI+SD A+ + GSLGL+PSA++   P+      + EPCHGS
Sbjct: 231 LVKNPRAFNGVVVTSNMFGDIISDEASVIPGSLGLLPSASLASLPDSKSAFGLYEPCHGS 290

Query: 300 APDI-AGKGIANPIATIRSTAQMLEY-LGYSNPAQDIYKAVDANIRDNKIKTADLGGDST 357
           APD+ AGK  ANPI  I S A ML+  L      + + +AV   + D+ ++T DL G S+
Sbjct: 291 APDLPAGK--ANPIGCILSAAMMLKLSLNMVAAGEAVEQAVQ-EVLDSGVRTGDLLGSSS 347

Query: 358 TQQVIDDI 365
           T +V D I
Sbjct: 348 TSEVGDAI 355

>Ecym_1296 Chr1 (602530..603621) [1092 bp, 363 aa] {ON} similar to
           Ashbya gossypii AAL012C
          Length = 363

 Score =  147 bits (372), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 125/362 (34%), Positives = 188/362 (51%), Gaps = 37/362 (10%)

Query: 26  LIPGDGIGKEVIPAGKQVLQNLNK-KHGLAFEFIDLQAGYQTFLDTGAALPRDTVDILKN 84
           ++PGD IG+EVI    +VL  + + +  + FEF     G      TGA L   T++  K 
Sbjct: 9   VLPGDYIGQEVIAETIKVLNAIQEARPSINFEFEYHLIGGAAINATGAPLSDKTIEAAK- 67

Query: 85  KCQGALFGAVQSPTTKVEGYSSP---IVQLRKELGLFANVRPV----KTVEGTD------ 131
                L GAV  P     G   P   ++ +RKELGL+AN+RP     K++ G        
Sbjct: 68  AADAVLLGAVGGPEWD-SGAVRPEQGLLAIRKELGLYANLRPCSFISKSLLGLSPLKPEI 126

Query: 132 AKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRL 191
           A+  D VI+RE    +Y    K      DG  +A  +++ T +  +RI +    +ALQ  
Sbjct: 127 AQGTDFVILRELVGGIYFGERKE----DDGDGVAWDSEKYTVSEVERITRMGAFLALQH- 181

Query: 192 KTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFREP 251
                  L    K+NVL+ S  L+R   + V E+ K  +  ++   Q++DS    + + P
Sbjct: 182 --DPPLPLWSFDKANVLASSR-LWR---RTVNETIKREFPQLSVQHQLIDSAAMIMIKNP 235

Query: 252 ECFD-VIVAPNLYGDILSDGAAALVGSLGLVPSANVGP----NIVIG--EPCHGSAPDIA 304
             F+ +++  N++GDI+SD A+ + GSLGL+PSA++      N   G  EPCHGSAPD+ 
Sbjct: 236 RKFNGIVITSNIFGDIISDAASVIPGSLGLLPSASLASEPDKNNAFGLYEPCHGSAPDLE 295

Query: 305 GKGIANPIATIRSTAQMLEY-LGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQVID 363
            KG ANPIA I S A ML+  L   +  + I  AV   I ++ I+T DLGG++TT +V D
Sbjct: 296 -KGQANPIACILSAAMMLKLSLNMVDEGKAIENAVKQVI-ESGIRTGDLGGNNTTTEVGD 353

Query: 364 DI 365
            +
Sbjct: 354 AV 355

>Kpol_1048.63 s1048 (182096..183190) [1095 bp, 364 aa] {ON}
           (182096..183190) [1095 nt, 365 aa]
          Length = 364

 Score =  147 bits (372), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 127/370 (34%), Positives = 188/370 (50%), Gaps = 38/370 (10%)

Query: 19  LKTLTIGLIPGDGIGKEVIPAGKQVLQNL--NKKHGLAFEFIDLQAGYQTFLDTGAALPR 76
           + T  I ++PGD +G+E++    +VL+ +  +   G+ FEF     G  +   TG  LP 
Sbjct: 1   MSTKKIVVLPGDHVGEEIVDEAIKVLEAVASSSSKGIKFEFQRHLIGGASIDATGTPLPD 60

Query: 77  DTVDILKNKCQGALFGAVQSPTTKVEGYSSP---IVQLRKELGLFANVRPVKTVEGT--- 130
           + +D  KN     L GAV  P     G   P   ++++RKEL L+AN+RP   V  +   
Sbjct: 61  EALDAAKN-SDAVLLGAVGGPKWGT-GDVRPEQGLLKIRKELQLYANLRPCNFVSDSLLG 118

Query: 131 -------DAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTA 183
                   AK  D  +VRE    +Y    K   D  DGS  A   ++ T    +RI + A
Sbjct: 119 LSPLKEEIAKGTDFTVVRELVGGIYFGDRKE--DDGDGS--AWDCEKYTIPEVQRITRMA 174

Query: 184 LDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSM 243
             +ALQ         +    K+NVL+ S  L+R   K V E+ K+ +  +    Q++DS 
Sbjct: 175 AFLALQH---DPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPNLKVQHQLIDSA 227

Query: 244 VYRLFREPECFD-VIVAPNLYGDILSDGAAALVGSLGLVPSANVGP----NIVIG--EPC 296
              L + P   + +I+  N++GDI+SD A+ + GSLGL+PSA++      N   G  EPC
Sbjct: 228 AMILVKSPRQLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPC 287

Query: 297 HGSAPDIAGKGIANPIATIRSTAQMLEY-LGYSNPAQDIYKAVDANIRDNKIKTADLGGD 355
           HGSAPD+  KG  NPIATI S A ML+  L   +    I +AV   + D  I+TADL G 
Sbjct: 288 HGSAPDLP-KGKVNPIATILSAAMMLKLSLNLVDEGIAIEQAV-KQVLDAGIRTADLKGS 345

Query: 356 STTQQVIDDI 365
           ++T +V D +
Sbjct: 346 NSTSEVGDAV 355

>KLTH0H12188g Chr8 (1039347..1040441) [1095 bp, 364 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 364

 Score =  145 bits (367), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 123/369 (33%), Positives = 193/369 (52%), Gaps = 47/369 (12%)

Query: 24  IGLIPGDGIGKEVIPAGKQVLQNLNK-KHGLAFEFIDLQAGYQTFLDTGAALPRDTVDIL 82
           I ++PGD +G+E+     +VL+ +++ +  + FEF     G      TG  LP  +++  
Sbjct: 7   IVVLPGDHVGQEITDEAIKVLKAISEVRSSVKFEFQQHLIGGAAIDATGEPLPDASLEAA 66

Query: 83  KNKCQGALFGAVQSPTTKVEGYSSP---IVQLRKELGLFANVRP----------VKTVEG 129
           K K    L GAV  P     G   P   ++++RKEL L+AN+RP          +  ++ 
Sbjct: 67  K-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPLKA 124

Query: 130 TDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQ 189
             A+  D V+VRE    +Y    K   D  DG  +A  +++ +    +RI + A  +ALQ
Sbjct: 125 EHARGTDFVVVRELVGGIYFGERKE--DEGDG--VAWDSEKYSVPEVQRITRMAAFLALQ 180

Query: 190 RLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFR 249
                   +L    K+NVL+ S  L+R   K V E+ K+ +  +    Q++DS    + +
Sbjct: 181 HNPPLPVWSL---DKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAAMIMVK 233

Query: 250 EPECFD-VIVAPNLYGDILSDGAAALVGSLGLVPSANVGP----NIVIG--EPCHGSAPD 302
            P   + VI+  N++GDI+SD A+ + GSLGL+PSA++      N   G  EPCHGSAPD
Sbjct: 234 NPTQLNGVIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPD 293

Query: 303 IAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYK---AVDANIR---DNKIKTADLGGDS 356
           +  KG  NPIATI S A MLE       + D+++   AV+  +R   D+ I+T DL G +
Sbjct: 294 LE-KGKVNPIATILSAAMMLEL------SLDMFEEGTAVEEAVRRVLDSGIRTGDLRGSN 346

Query: 357 TTQQVIDDI 365
           +TQ+V D +
Sbjct: 347 STQEVGDAV 355

>TDEL0B06000 Chr2 (1060828..1061916) [1089 bp, 362 aa] {ON}
           Anc_1.402 YCL018W
          Length = 362

 Score =  144 bits (363), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 119/364 (32%), Positives = 187/364 (51%), Gaps = 37/364 (10%)

Query: 24  IGLIPGDGIGKEVIPAGKQVLQNLNK-KHGLAFEFIDLQAGYQTFLDTGAALPRDTVDIL 82
           I ++PGD +G+E+     +VL+ +++ +    F F     G      TG  LP + ++  
Sbjct: 5   IVVLPGDHVGQEITEEAIKVLKAISEVRPNATFNFQHHLIGGAAIDATGVPLPDEALEAS 64

Query: 83  KNKCQGALFGAVQSPTTKVEGYSSP---IVQLRKELGLFANVRP----------VKTVEG 129
           K K    L GAV  P     G   P   ++++RKEL L+AN+RP          +  ++ 
Sbjct: 65  K-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASDSLLELSPLKA 122

Query: 130 TDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQ 189
             A+  D V+VRE    +Y    K      +G  +A  +++ +    +RI + A  +ALQ
Sbjct: 123 QYAQGTDFVVVRELVGGIYFGERKE----DEGDGVAWDSEQYSVPEVQRITRMAAFLALQ 178

Query: 190 RLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFR 249
                    +    K+NVL+ S  L+R   K V ++ K  +  ++ N Q++DS    L +
Sbjct: 179 H---NPPLPIWSLDKANVLASSR-LWR---KTVEKTIKEEFPTLSVNHQLIDSAAMILVK 231

Query: 250 EPECFD-VIVAPNLYGDILSDGAAALVGSLGLVPSANVGP----NIVIG--EPCHGSAPD 302
            P   + +I+  N++GDI+SD A+ + GSLGL+PSA++      N   G  EPCHGSAPD
Sbjct: 232 NPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCHGSAPD 291

Query: 303 IAGKGIANPIATIRSTAQMLEY-LGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQV 361
           +A KG  NP+ATI S A ML+  L        I KAV   + D+ I+T DLGG ++T +V
Sbjct: 292 LA-KGKVNPVATILSAAMMLKLSLNMVEEGVAIEKAVK-KVLDDGIRTGDLGGSNSTSEV 349

Query: 362 IDDI 365
            D +
Sbjct: 350 GDAV 353

>YCL018W Chr3 (91324..92418) [1095 bp, 364 aa] {ON}
           LEU2Beta-isopropylmalate dehydrogenase (IMDH), catalyzes
           the third step in the leucine biosynthesis pathway
          Length = 364

 Score =  144 bits (362), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 121/364 (33%), Positives = 185/364 (50%), Gaps = 37/364 (10%)

Query: 24  IGLIPGDGIGKEVIPAGKQVLQNLNK-KHGLAFEFIDLQAGYQTFLDTGAALPRDTVDIL 82
           I ++PGD +G+E+     +VL+ ++  +  + F+F +   G      TG  LP + ++  
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 83  KNKCQGALFGAVQSPTTKVEGYSSP---IVQLRKELGLFANVRPVKTVEGT--DAKPI-- 135
           K K    L GAV  P     G   P   ++++RKEL L+AN+RP      +  D  PI  
Sbjct: 67  K-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPIKP 124

Query: 136 ------DLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQ 189
                 D V+VRE    +Y    K      DG  +A  +++ T    +RI + A  +ALQ
Sbjct: 125 QFAKGTDFVVVRELVGGIYFGKRKE----DDGDGVAWDSEQYTVPEVQRITRMAAFMALQ 180

Query: 190 RLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFR 249
               +    +    K+NVL+ S  L+R   K V E+ K+ +  +    Q++DS    L +
Sbjct: 181 H---EPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMILVK 233

Query: 250 EPECFD-VIVAPNLYGDILSDGAAALVGSLGLVPSANVGP----NIVIG--EPCHGSAPD 302
            P   + +I+  N++GDI+SD A+ + GSLGL+PSA++      N   G  EPCHGSAPD
Sbjct: 234 NPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPD 293

Query: 303 IAGKGIANPIATIRSTAQMLEY-LGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQV 361
           +  K   NPIATI S A ML+  L      + I  AV   + D  I+T DLGG ++T +V
Sbjct: 294 LP-KNKVNPIATILSAAMMLKLSLNLPEEGKAIEDAVK-KVLDAGIRTGDLGGSNSTTEV 351

Query: 362 IDDI 365
            D +
Sbjct: 352 GDAV 355

>Smik_3.66 Chr3 (89718..90812) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  144 bits (362), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 121/364 (33%), Positives = 186/364 (51%), Gaps = 37/364 (10%)

Query: 24  IGLIPGDGIGKEVIPAGKQVLQNLNK-KHGLAFEFIDLQAGYQTFLDTGAALPRDTVDIL 82
           I ++PGD +G+E+     +VL+ +++ +  + F+F +   G      TG  LP + ++  
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISEVRSDVNFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 83  KNKCQGALFGAVQSPTTKVEGYSSP---IVQLRKELGLFANVRPVKTVEGT--DAKPI-- 135
           K K    L GAV  P     G   P   ++++RKEL L+AN+RP      +  D  PI  
Sbjct: 67  K-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPIKP 124

Query: 136 ------DLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQ 189
                 D V+VRE    +Y    K      DG  +A  +++ T    +RI + A  +ALQ
Sbjct: 125 QFAKGTDFVVVRELVGGIYFGKRKE----DDGDGVAWDSEQYTVPEVQRITRMAAFMALQ 180

Query: 190 RLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFR 249
               +    +    K+NVL+ S  L+R   K V E+ K+ +  +    Q++DS    L +
Sbjct: 181 H---EPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMILVK 233

Query: 250 EPECFD-VIVAPNLYGDILSDGAAALVGSLGLVPSANVGP----NIVIG--EPCHGSAPD 302
            P   + +I+  N++GDI+SD A+ + GSLGL+PSA++      N   G  EPCHGSAPD
Sbjct: 234 NPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPD 293

Query: 303 IAGKGIANPIATIRSTAQMLEY-LGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQV 361
           +  K   NPIATI S A ML+  L      + I  AV   + D  I+T DLGG ++T +V
Sbjct: 294 LP-KNKVNPIATILSAAMMLKLSLNLPEEGKAIEDAVK-KVLDAGIRTGDLGGSNSTTEV 351

Query: 362 IDDI 365
            D +
Sbjct: 352 GDAV 355

>NDAI0G04230 Chr7 complement(1015689..1016780) [1092 bp, 363 aa]
           {ON} Anc_1.402
          Length = 363

 Score =  143 bits (360), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 123/369 (33%), Positives = 188/369 (50%), Gaps = 37/369 (10%)

Query: 19  LKTLTIGLIPGDGIGKEVIPAGKQVLQNLNK-KHGLAFEFIDLQAGYQTFLDTGAALPRD 77
           + T  I ++PGD +G+E+     +VL+ + +  + + F+F     G      TG  LP +
Sbjct: 1   MSTKKIVVLPGDHVGEEITAEAVKVLKAIAEVDNSINFDFQYHLIGGAAIDATGVPLPDE 60

Query: 78  TVDILKNKCQGALFGAVQSPTTKVEGYSSP---IVQLRKELGLFANVRP----------V 124
            ++  KN     L GAV  P     G   P   ++++RKELGL+AN+RP          +
Sbjct: 61  ALEASKN-SDAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASESLLGL 118

Query: 125 KTVEGTDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTAL 184
             +    AK  D ++VRE    +Y    K   D  DG  +A  +++ +    +RI + A 
Sbjct: 119 SPLRPEIAKGTDFMVVRELVGGIYFG--KRKEDEGDG--VAWDSEQYSVPEVQRITRMAA 174

Query: 185 DIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMV 244
            +ALQ         +    K+NVL+ S  L+R   K V E+ K+ +  +    Q++DS  
Sbjct: 175 FLALQH---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQNQLIDSAA 227

Query: 245 YRLFREPECFD-VIVAPNLYGDILSDGAAALVGSLGLVPSANVGP----NIVIG--EPCH 297
             L + P   + +I+  N++GDI+SD A+ + GSLGL+PSA++      N   G  EPCH
Sbjct: 228 MILVKNPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDTNTAFGLYEPCH 287

Query: 298 GSAPDIAGKGIANPIATIRSTAQMLEY-LGYSNPAQDIYKAVDANIRDNKIKTADLGGDS 356
           GSAPD+  KG  NPIATI S A ML+  L        I +AV   + D  I+T DLGG +
Sbjct: 288 GSAPDLP-KGKVNPIATILSAAMMLKLSLNLVKQGDAIEEAVK-KVLDAGIRTGDLGGSN 345

Query: 357 TTQQVIDDI 365
           +T +V D I
Sbjct: 346 STTEVGDAI 354

>Skud_3.43 Chr3 (70293..71387) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  142 bits (358), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 119/364 (32%), Positives = 185/364 (50%), Gaps = 37/364 (10%)

Query: 24  IGLIPGDGIGKEVIPAGKQVLQNLNK-KHGLAFEFIDLQAGYQTFLDTGAALPRDTVDIL 82
           I ++PGD +G+E+     +VL+ ++  +  + F+F +   G      TG  LP + ++  
Sbjct: 7   IVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPDEALEAS 66

Query: 83  KNKCQGALFGAVQSPTTKVEGYSSP---IVQLRKELGLFANVRP----------VKTVEG 129
           K K    L GAV  P     G   P   ++++RKEL L+AN+RP          +  ++ 
Sbjct: 67  K-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPIKP 124

Query: 130 TDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQ 189
             AK  D V+VRE    +Y    K      DG  +A   ++ T    +RI + A  +ALQ
Sbjct: 125 QFAKGTDFVVVRELVGGIYFGERKE----DDGDGVAWDCEQYTVPEVQRITRMAAFMALQ 180

Query: 190 RLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFR 249
               +    +    K+NVL+ S  L+R   K V E+ K+ +  +    Q++DS    L +
Sbjct: 181 H---EPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMILVK 233

Query: 250 EPECFD-VIVAPNLYGDILSDGAAALVGSLGLVPSANVGP----NIVIG--EPCHGSAPD 302
            P   + +I+  N++GDI+SD A+ + GSLGL+PSA++      N   G  EPCHGSAPD
Sbjct: 234 NPTHLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPD 293

Query: 303 IAGKGIANPIATIRSTAQMLEY-LGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQV 361
           +  K   NP+ATI S A ML+  L      + I  AV   + D  I+T DLGG ++T +V
Sbjct: 294 LP-KNKVNPVATILSAAMMLKLSLNLPEEGKAIEDAVK-RVLDAGIRTGDLGGSNSTTEV 351

Query: 362 IDDI 365
            D +
Sbjct: 352 GDAV 355

>KLLA0D04906g Chr4 (420903..421991) [1089 bp, 362 aa] {ON} highly
           similar to uniprot|P04173 Saccharomyces cerevisiae
           YCL018W LEU2 Beta-isopropylmalate dehydrogenase
           catalyzes the third step in the leucine biosynthesis
           pathway
          Length = 362

 Score =  142 bits (358), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 120/364 (32%), Positives = 186/364 (51%), Gaps = 37/364 (10%)

Query: 24  IGLIPGDGIGKEVIPAGKQVLQNLNK-KHGLAFEFIDLQAGYQTFLDTGAALPRDTVDIL 82
           I ++PGD +GKEV     +VL  + + +  + F F     G      TG  LP + ++  
Sbjct: 5   IVVLPGDHVGKEVTDEAIKVLNAIAEVRPEIKFNFQHHLIGGAAIDATGTPLPDEALEAS 64

Query: 83  KNKCQGALFGAVQSPTTKVEGYSSP---IVQLRKELGLFANVRP----------VKTVEG 129
           K K    L GAV  P     G   P   ++++RKELGL+AN+RP          +  ++ 
Sbjct: 65  K-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASDSLLDLSPLKP 122

Query: 130 TDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQ 189
             AK  D V+VRE    +Y    K      +G  +A  +++ +    +RI + A  +ALQ
Sbjct: 123 EYAKGTDFVVVRELVGGIYFGERKE----DEGDGVAWDSEKYSVPEVQRITRMAAFLALQ 178

Query: 190 RLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFR 249
           +        +    K+NVL+ S  L+R   K V E+ K+ +  +    Q++DS    L +
Sbjct: 179 Q---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKTEFPQLTVQHQLIDSAAMILVK 231

Query: 250 EPECFD-VIVAPNLYGDILSDGAAALVGSLGLVPSANVGP----NIVIG--EPCHGSAPD 302
            P   + V++  N++GDI+SD A+ + GSLGL+PSA++      N   G  EPCHGSAPD
Sbjct: 232 SPTKLNGVVITNNMFGDIISDEASVIPGSLGLLPSASLASLPDTNKAFGLYEPCHGSAPD 291

Query: 303 IAGKGIANPIATIRSTAQMLEY-LGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQV 361
           +    + NPIATI S A ML+  L      + + +AV  N+ D  ++T DLGG ++T +V
Sbjct: 292 LPANKV-NPIATILSAAMMLKLSLDLVEEGRALEEAVR-NVLDAGVRTGDLGGSNSTTEV 349

Query: 362 IDDI 365
            D I
Sbjct: 350 GDAI 353

>KNAG0I01280 Chr9 complement(245603..246946) [1344 bp, 447 aa] {ON}
           Anc_1.402 YCL018W
          Length = 447

 Score =  143 bits (361), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 126/389 (32%), Positives = 199/389 (51%), Gaps = 40/389 (10%)

Query: 2   LRTSVRQFSVSARNASSLKTLT---IGLIPGDGIGKEVIPAGKQVLQNLNK-KHGLAFEF 57
           L +    F +S  ++++    T   I ++PGD +G+E+     +VL  ++  +  + F+F
Sbjct: 65  LHSHQFNFIISTHHSTTAMAQTTKHIVVLPGDHVGQEITEEAIKVLNAISSVRPNVNFDF 124

Query: 58  IDLQAGYQTFLDTGAALPRDTVDILKNKCQGALFGAVQSPTTKVEGYSSP---IVQLRKE 114
                G      TG  LP + ++  K K    L GAV  P     G   P   ++++RKE
Sbjct: 125 QHHLIGGAAIDATGVPLPDEALEASK-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKE 182

Query: 115 LGLFANVRPVKTVEGT--DAKPI--------DLVIVRENTEDLYIKIEKTYTDPKDGSRI 164
           L L+AN+RP      +  D  P+        D+ IVRE    +Y    K   D  DG  +
Sbjct: 183 LQLYANLRPCNFASDSLLDLSPLKPEIVKGTDICIVRELVGGIYFGERKE--DEGDG--V 238

Query: 165 AEATKRITETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYE 224
           A  +++ + +  +RI + A  +ALQ        +L    K+NVL+ S  L+R   K V E
Sbjct: 239 AWDSEKYSVSEVQRITRMAGFLALQHNPPLPVWSLD---KANVLASSR-LWR---KTVEE 291

Query: 225 SNKSLYSGVAYNEQIVDSMVYRLFREPECFD-VIVAPNLYGDILSDGAAALVGSLGLVPS 283
           + K+ +  +    Q++DS    L + P   + V++A N++GDI+SD A+ + GSLGL+PS
Sbjct: 292 TIKNEFPTLTVQHQLIDSAAMILVKNPTHLNGVVIANNMFGDIISDEASVIPGSLGLLPS 351

Query: 284 ANVGP----NIVIG--EPCHGSAPDIAGKGIANPIATIRSTAQMLEY-LGYSNPAQDIYK 336
           A++      N   G  EPCHGSAPD+  KG  NP+ATI S A ML+  L  +     + K
Sbjct: 352 ASLASLPDTNTAFGLYEPCHGSAPDLP-KGKVNPVATILSVAMMLKLSLNMTEEGIAVEK 410

Query: 337 AVDANIRDNKIKTADLGGDSTTQQVIDDI 365
           AV   + D+ ++TADL G ++T +V D I
Sbjct: 411 AVK-QVLDSGVRTADLRGSNSTSEVGDAI 438

>Kwal_0.225 s0 (111017..112111) [1095 bp, 364 aa] {ON} YCL018W
           (LEU2) - beta-IPM (isopropylmalate) dehydrogenase
           [contig 82] FULL
          Length = 364

 Score =  141 bits (355), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 127/378 (33%), Positives = 194/378 (51%), Gaps = 51/378 (13%)

Query: 21  TLTIGLIPGDGIGKEVIPAGKQVLQNLNK-KHGLAFEFIDLQAGYQTFLDTGAALPRDTV 79
           T  I ++PGD +G+E+     +VL+ +++ +    FEF     G      TG  LP  ++
Sbjct: 4   TKKIVVLPGDHVGQEITEEAVKVLKAISEVRPEKQFEFQYHLIGGAAIDATGEPLPDASL 63

Query: 80  DILKNKCQGALFGAVQSPTTKVEGYSSP---IVQLRKELGLFANVRPVKTVEGT--DAKP 134
           +  K K    L GAV  P     G   P   ++++RKEL L+AN+RP      +  D  P
Sbjct: 64  EAAK-KSDAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSP 121

Query: 135 I--------DLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDI 186
           +        D V+VRE    +Y    K  T    G  +A  +++ +    +RI + A  +
Sbjct: 122 LKPECARGTDFVVVRELVGGIYFGERKEDT----GDGVAWDSEQYSVPEVQRITRMAAFL 177

Query: 187 ALQRLKTKGSATLTVTH--KSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMV 244
           ALQ      S  L V    K+NVL+ S  L+R   K V E+ K+ +  +    Q++DS  
Sbjct: 178 ALQH-----SPPLPVWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAA 228

Query: 245 YRLFREPECFD-VIVAPNLYGDILSDGAAALVGSLGLVPSANVG----PNIVIG--EPCH 297
             L + P   + VI+  N++GDI+SD A+ + GSLGL+PSA++      N   G  EPCH
Sbjct: 229 MILVKNPTQLNGVIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCH 288

Query: 298 GSAPDIAGKGIANPIATIRSTAQMLEYLGYSNPAQDIYK---AVDANIR---DNKIKTAD 351
           GSAPD+  KG  NPIATI S A ML+       + D+++   AV+  +R   D+ ++TAD
Sbjct: 289 GSAPDLP-KGKVNPIATILSAAMMLKL------SLDMFEEGAAVEEAVRKVLDSGVRTAD 341

Query: 352 LGGDSTTQQVIDDILGKL 369
           L G STT +V + ++  L
Sbjct: 342 LKGTSTTSEVGEAVVKAL 359

>CAGL0H03795g Chr8 (356535..357632) [1098 bp, 365 aa] {ON}
          Length = 365

 Score =  139 bits (351), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 120/368 (32%), Positives = 186/368 (50%), Gaps = 38/368 (10%)

Query: 21  TLTIGLIPGDGIGKEVIPAGKQVLQNLN--KKHGLAFEFIDLQAGYQTFLDTGAALPRDT 78
           T TI ++PGD +G+E+     +VL  +   +   + F+F     G      TG  LP + 
Sbjct: 4   TKTIVVLPGDHVGQEITEEAIKVLNAIQECRPDKVNFKFDHHLIGGAAIDATGVPLPDEA 63

Query: 79  VDILKNKCQGALFGAVQSPTTKVEGYSSP---IVQLRKELGLFANVRPVKTVEGT--DAK 133
           ++  K K    L GAV  P     G   P   ++++RKEL L+AN+RP      +  D  
Sbjct: 64  LEASK-KADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLS 121

Query: 134 PI--------DLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALD 185
           P+        D V+VRE    +Y    K      +G  +A  +++ +    +RI + A  
Sbjct: 122 PLKPEIARGTDFVVVRELVGGIYFGERKE----DEGDGVAWDSEKYSVPEVQRITRMAAF 177

Query: 186 IALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVY 245
           +ALQ         +    K+NVL+ S  L+R   K V E+ K+ +  +    Q++DS   
Sbjct: 178 MALQH---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPQLTVQHQLIDSAAM 230

Query: 246 RLFREPECFD-VIVAPNLYGDILSDGAAALVGSLGLVPSANVGP----NIVIG--EPCHG 298
            L + P   + +I+  N++GDI+SD A+ + GSLGL+PSA++      N   G  EPCHG
Sbjct: 231 ILVKNPTHLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHG 290

Query: 299 SAPDIAGKGIANPIATIRSTAQMLEY-LGYSNPAQDIYKAVDANIRDNKIKTADLGGDST 357
           SAPD+  KG  NP+ATI S A ML+  L      + I +AV   + D+ I+TADL G ++
Sbjct: 291 SAPDLP-KGKVNPVATILSAAMMLKLSLDLFEEGEIIEQAVK-KVLDSGIRTADLKGTNS 348

Query: 358 TQQVIDDI 365
           T +V D +
Sbjct: 349 TTEVGDAV 356

>Suva_3.3 Chr3 (1464..2558) [1095 bp, 364 aa] {ON} YCL018W (REAL)
          Length = 364

 Score =  139 bits (351), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 122/367 (33%), Positives = 187/367 (50%), Gaps = 37/367 (10%)

Query: 21  TLTIGLIPGDGIGKEVIPAGKQVLQNLNK-KHGLAFEFIDLQAGYQTFLDTGAALPRDTV 79
           T  I ++PGD +G+E+     +VL+ +++ +  + F+F     G      TG  L  + +
Sbjct: 4   TKKIVVLPGDHVGQEITEEAIKVLKAISEVRPNVKFDFEYHLIGGAAIDATGVPLTDEAL 63

Query: 80  DILKNKCQGALFGAVQSPTTKVEGYSSP---IVQLRKELGLFANVRPVK-----TVEGTD 131
           +  K K    L GAV  P     G   P   ++++RKEL L+AN+RP        +E + 
Sbjct: 64  EASK-KADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLELSP 121

Query: 132 AKP-----IDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDI 186
            KP      D V+VRE    +Y    K      DG  +A  +++ T    +RI + A  +
Sbjct: 122 IKPQFARGTDFVVVRELVGGIYFGKRKE----DDGDGVAWDSEQYTVPEVQRITRMAAFM 177

Query: 187 ALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYR 246
           ALQ    +    +    K+NVL+ S  L+R   K V E+ K+ +  +    Q++DS    
Sbjct: 178 ALQH---QPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLKVQHQLIDSAAMI 230

Query: 247 LFREPECFD-VIVAPNLYGDILSDGAAALVGSLGLVPSANVGP----NIVIG--EPCHGS 299
           L + P   + +I+  N++GDI+SD A+ + GSLGL+PSA++      N   G  EPCHGS
Sbjct: 231 LVKNPTQLNGIIITSNMFGDIISDEASCIPGSLGLLPSASLASLPDKNTAFGLYEPCHGS 290

Query: 300 APDIAGKGIANPIATIRSTAQMLEY-LGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTT 358
           APD+  K   NPIATI S A ML+  L  +   Q I  AV   + D  I+T DLGG ++T
Sbjct: 291 APDLP-KNKVNPIATILSAAMMLKLSLNMTAEGQAIEDAVK-KVLDAGIRTGDLGGSNST 348

Query: 359 QQVIDDI 365
            +V D +
Sbjct: 349 IEVGDAV 355

>ZYRO0E04796g Chr5 (362881..363969) [1089 bp, 362 aa] {ON}
           uniprot|Q96WI0 Zygosaccharomyces rouxii LEU2 3-
           isopropylmalate dehydrogenase
          Length = 362

 Score =  139 bits (349), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 121/365 (33%), Positives = 186/365 (50%), Gaps = 37/365 (10%)

Query: 23  TIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLA-FEFIDLQAGYQTFLDTGAALPRDTVDI 81
            I ++PGD  G+E+     +VL+ +++    A F F     G      TG+ LP D +  
Sbjct: 4   NIVVLPGDHAGQEIAQEAIKVLEAISEVSPEAKFNFQHHLIGGAAIDATGSPLPDDALAA 63

Query: 82  LKNKCQGALFGAVQSPTTKVEGYSSP---IVQLRKELGLFANVRP----------VKTVE 128
            K      L GAV  P     G   P   ++++RKEL L+AN+RP          +  ++
Sbjct: 64  AKKADA-VLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASESLLDLSPLK 121

Query: 129 GTDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIAL 188
              AK  D V+VRE    +Y    K      +G  +A  +++ T+   +R+ + A  +AL
Sbjct: 122 PQHAKGTDFVVVRELVGGIYFGERKE----DEGDGVAWDSEKYTKPEVQRLTRMAAFLAL 177

Query: 189 QRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLF 248
           Q         +    K+NVL+ S  L+R   K V E+ K+ +  +  N Q++DS    L 
Sbjct: 178 QH---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPQLKLNHQLIDSAAMILV 230

Query: 249 REPECFD-VIVAPNLYGDILSDGAAALVGSLGLVPSANVGP----NIVIG--EPCHGSAP 301
           + P   + +++  NL+GDI+SD A+ + GSLGL+PSA++      N   G  EPCHGSAP
Sbjct: 231 KSPTQLNGIVLTSNLFGDIISDEASVIPGSLGLLPSASLASLPDTNEAFGLYEPCHGSAP 290

Query: 302 DIAGKGIANPIATIRSTAQMLEY-LGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQ 360
           D+  KG  NPIA I S A ML+  L  S   + + KAV   + D+ ++T DLGG ++T +
Sbjct: 291 DLP-KGKVNPIAMILSAAMMLKLSLNLSKEGEAVEKAVK-QVLDSGVRTGDLGGSNSTSE 348

Query: 361 VIDDI 365
           V D I
Sbjct: 349 VGDAI 353

>KAFR0I02200 Chr9 (449737..450834) [1098 bp, 365 aa] {ON} Anc_1.402
           YCL018W
          Length = 365

 Score =  139 bits (349), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 126/367 (34%), Positives = 187/367 (50%), Gaps = 39/367 (10%)

Query: 17  SSLKTLTIGLIPGDGIGKEVIPAGKQVLQNLNK-KHGLAFEFIDLQAGYQTFLDTGAALP 75
           SS+K +T+   PGD IG E++    +VL  + +    ++F++     G      TG  L 
Sbjct: 2   SSVKNITV--FPGDHIGTEIVRETVKVLDAIAEVSPNVSFKYNYQLIGGAAIDATGEPLT 59

Query: 76  RDTVDILKNKCQGALFGAVQSPTTKVEGYSSP---IVQLRKELGLFANVRPVKTVEGT-- 130
            + + + KN     L GAV  P     G   P   ++++RKELG++AN+RP + V  T  
Sbjct: 60  DEALQVAKN-SDAILLGAVGGPKWG-HGLVRPEQGLLKIRKELGVYANLRPCQFVSETLL 117

Query: 131 DAKPI--------DLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKT 182
           D  P+        D VIVRE    +Y    +   D  DG    + +  + E   +RI + 
Sbjct: 118 DLSPLKREIVQGTDFVIVRELVGGIYFGERQEAGD--DGVAWDKESYSVPEI--QRITRM 173

Query: 183 ALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDS 242
           A  +ALQ        +L    K+NVL+ S  L+R   K V E+ K+ +  +  N  ++DS
Sbjct: 174 AAFLALQHNPPLPVWSL---DKANVLATSR-LWR---KTVEETIKNEFPTLTINHHLIDS 226

Query: 243 MVYRLFREPECFD-VIVAPNLYGDILSDGAAALVGSLGLVPSANVGP----NIVIG--EP 295
               L + P   + V++  N++GDI+SD A+ + GSLGL+PSA++      N  +G  EP
Sbjct: 227 AAMTLVQNPTKLNGVVITTNMFGDIISDEASVIPGSLGLLPSASLASLPDKNDALGLYEP 286

Query: 296 CHGSAPDIAGKGIANPIATIRSTAQMLEY-LGYSNPAQDIYKAVDANIRDNKIKTADLGG 354
           CHGSAPD+     ANPIATI S A M +  L  +     I +AV   I D  IKT DLGG
Sbjct: 287 CHGSAPDLPADH-ANPIATILSAAMMCKLSLNLTKEGNAIEEAVKRTI-DAGIKTGDLGG 344

Query: 355 DSTTQQV 361
            +TT +V
Sbjct: 345 KNTTTEV 351

>Suva_14.302 Chr14 (546468..547370) [903 bp, 300 aa] {ON} YNL037C
           (REAL)
          Length = 300

 Score =  134 bits (337), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 97/293 (33%), Positives = 152/293 (51%), Gaps = 25/293 (8%)

Query: 22  LTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVDI 81
            T+ LIPGDG+GKEV  + K + +  N    + +E I+++   QT  D    +      +
Sbjct: 29  FTVTLIPGDGVGKEVTDSVKTIFEAENIP--IDWETINIK---QT--DHKEGVNEAVESL 81

Query: 82  LKNKCQGALFGAVQSPTTKVEGYSSPIVQLRKELGLFANVRPVKTVEGTDAK--PIDLVI 139
            +NK    L G   +P  +  G+ S  V LRK+L ++ANV   K+++G   +   IDL++
Sbjct: 82  RRNKI--GLKGLWHTPADQT-GHGSLNVALRKQLDIYANVALFKSLKGVKTRIPDIDLIV 138

Query: 140 VRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATL 199
           +RENTE  +  +E           + E+ K +T+  T+RIA+ A D A    K      +
Sbjct: 139 IRENTEGEFSGLEHESV-----PGVVESLKIMTKPKTERIARFAFDFA----KKYNRKAV 189

Query: 200 TVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECFDVIVA 259
           T  HK+N++   DGLFR +  E+ +     Y  +  +  IVD+   +   +P  FDV+V 
Sbjct: 190 TAVHKANIMKLGDGLFRNIITEIGQKE---YPDIDVSSIIVDNASMQAVAKPHQFDVLVT 246

Query: 260 PNLYGDILSDGAAALVGSLGLVPSANVGPNIVIGEP-CHGSAPDIAGKGIANP 311
           P++YG IL +  AAL+G  GLV  AN G +  + EP       DI G+ +ANP
Sbjct: 247 PSMYGTILGNIGAALIGGPGLVAGANFGRDYAVFEPGSRHVGLDIKGQNVANP 299

>NCAS0C04870 Chr3 complement(993177..994274) [1098 bp, 365 aa] {ON}
           Anc_1.402
          Length = 365

 Score =  134 bits (336), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 117/372 (31%), Positives = 182/372 (48%), Gaps = 46/372 (12%)

Query: 21  TLTIGLIPGDGIGKEVIPAGKQVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVD 80
           T  I ++PGD +G E+     +VL+ + +      +F      +Q  L  GAA+    V 
Sbjct: 4   TKKIVVLPGDHVGGEITEEAIKVLKAIEQVESSKVKF-----DFQYHLIGGAAIDAAGVP 58

Query: 81  IL------KNKCQGALFGAVQSPTTKVEGYSSP---IVQLRKELGLFANVRP-------- 123
           +         K    L GAV  P     G   P   ++++RKELGL+AN+RP        
Sbjct: 59  LTDEALEASKKADAVLLGAVGGPKWGT-GAVRPEQGLLKIRKELGLYANLRPCNFASEPL 117

Query: 124 --VKTVEGTDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAK 181
             +  +    AK  D ++VRE    +Y    K      DG  +A  +++ +    +RI +
Sbjct: 118 LGLSPLRPEIAKGTDFMVVRELVGGIYFGERKE----DDGDGVAWDSEKYSVPEVERITR 173

Query: 182 TALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVD 241
            A  +ALQ         +    K+NVL+ S  L+R   K V  + K+ +  +    Q++D
Sbjct: 174 MAAFLALQH---NPPLPIWSLDKANVLASSR-LWR---KTVEATIKNEFPTLTVQNQLID 226

Query: 242 SMVYRLFREPECFD-VIVAPNLYGDILSDGAAALVGSLGLVPSANVG----PNIVIG--E 294
           S    L + P   + +I+  N++GDI+SD A+ + GSLGL+PSA++      N   G  E
Sbjct: 227 SAAMILVKNPTQLNGIIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYE 286

Query: 295 PCHGSAPDIAGKGIANPIATIRSTAQMLEY-LGYSNPAQDIYKAVDANIRDNKIKTADLG 353
           PCHGSAPD+  K   NP+ATI S A ML+  L      + + +AV   + D  ++T DLG
Sbjct: 287 PCHGSAPDLP-KNKVNPVATILSAAMMLKLSLNMVKEGEAVEEAVR-RVLDAGVRTGDLG 344

Query: 354 GDSTTQQVIDDI 365
           G ++TQ+V D I
Sbjct: 345 GSNSTQEVGDAI 356

>SAKL0D08690g Chr4 complement(723302..724396) [1095 bp, 364 aa] {ON}
           highly similar to uniprot|P04173 Saccharomyces
           cerevisiae YCL018W LEU2 Beta-isopropylmalate
           dehydrogenase catalyzes the third step in the leucine
           biosynthesis pathway
          Length = 364

 Score =  129 bits (324), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 115/365 (31%), Positives = 184/365 (50%), Gaps = 37/365 (10%)

Query: 24  IGLIPGDGIGKEVIPAGKQVLQNLNK-KHGLAFEFIDLQAGYQTFLDTGAALPRDTVDIL 82
           I ++PGD +G+E+     +VL  +++ +  + F++     G      TG  LP D     
Sbjct: 7   IVVLPGDHVGQEITAEAIRVLDAISEVRPDVKFDYQYHLIGGAAIDATGVPLP-DEALDA 65

Query: 83  KNKCQGALFGAVQSPTTKVEGYSSP---IVQLRKELGLFANVRP----------VKTVEG 129
             K    L GAV  P     G   P   ++++RKEL L+AN+RP          +  ++ 
Sbjct: 66  AKKADAVLLGAVGGPKWGT-GQVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPLKP 124

Query: 130 TDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQ 189
             AK  D V+VRE    +Y    K      +G  +A  +++ +    +RI + A  +ALQ
Sbjct: 125 EYAKGTDFVVVRELVGGIYFGERKE----DEGDGVAWDSEKYSVPEVQRITRMAAFLALQ 180

Query: 190 RLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFR 249
           +        +    K+NVL+ S  L+R   K V E+ K+ +  +    Q++DS    L +
Sbjct: 181 Q---NPPLPIWSLDKANVLASSR-LWR---KTVEETIKNEFPTLTVQHQLIDSAAMILVK 233

Query: 250 EPECFD-VIVAPNLYGDILSDGAAALVGSLGLVPSANVG----PNIVIG--EPCHGSAPD 302
            P   + +++  N++GDI+SD A+ + GSLGL+PSA++      N   G  EPCHGSAPD
Sbjct: 234 SPTKLNGIVITSNMFGDIISDEASVIPGSLGLLPSASLASLPDSNTAFGLYEPCHGSAPD 293

Query: 303 IAGKGIANPIATIRSTAQMLEY-LGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQV 361
           +  K   NPIATI S A ML+  L        + +AV   + D  I+TADL G+++T +V
Sbjct: 294 LP-KNKVNPIATILSAAMMLKLSLNLVEEGNAVEEAV-RRVLDAGIRTADLRGENSTSEV 351

Query: 362 IDDIL 366
            D ++
Sbjct: 352 GDAVV 356

>TPHA0B03730 Chr2 complement(878199..879296) [1098 bp, 365 aa] {ON}
           Anc_1.402 YCL018W
          Length = 365

 Score =  117 bits (293), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 110/368 (29%), Positives = 178/368 (48%), Gaps = 42/368 (11%)

Query: 23  TIGLIPGDGIGKEVIPAGKQVLQNLN--KKHGLAFEFIDLQAGYQTFLDTGAALPRDTVD 80
            I ++PGD +G EV     ++L+ +   + + + F F     G      TG  LP ++++
Sbjct: 6   NIVVLPGDHVGGEVTEEAVKILKAIEEVRNNKVKFNFEYHLIGGAAIDATGNPLPDESLE 65

Query: 81  ILKNKCQGALFGAVQSPTTKVEGYSSP---IVQLRKELGLFANVRP----------VKTV 127
             K +    L GAV  P     G   P   ++++RKEL L+AN+RP          +  +
Sbjct: 66  ASK-RADAVLLGAVGGPKWGT-GSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLSPL 123

Query: 128 EGTDAKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIA 187
           +   AK  D  +VRE    +Y    K      DG  +A  +++ +    +RI + A  +A
Sbjct: 124 KEKYAKGTDFTVVRELVGGIYFGKRKE----DDGDGVAWDSEQYSVPEVQRITRMAAFLA 179

Query: 188 LQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRL 247
           +Q         +    K+NVL+ S  L+R   K V E+ ++ +  +  + Q++DS    L
Sbjct: 180 MQH---NPPLPIWSLDKANVLASSR-LWR---KTVEETIQNEFPSLKVSHQLIDSAAMIL 232

Query: 248 FREPECFD-VIVAPNLYGDILSDGAAALVG--------SLGLVPSANVGPNIVIGEPCHG 298
            + P   + +I+  N++GDI+SD A+ + G        SL  +P  N    +   EPCHG
Sbjct: 233 VKNPTQLNGIIITNNMFGDIISDEASVIPGSLGLLPSASLSSLPDTNSAFGLY--EPCHG 290

Query: 299 SAPDIAGKGIANPIATIRSTAQMLEY-LGYSNPAQDIYKAVDANIRDNKIKTADLGGDST 357
           SAPD+  KG  NPI TI S A ML+  L        + +AV   + DN I+TADLGG ++
Sbjct: 291 SAPDLP-KGKVNPIGTILSVAMMLKLSLNLKEEGIAVEEAV-RRVLDNNIRTADLGGSNS 348

Query: 358 TQQVIDDI 365
           T  + D +
Sbjct: 349 TSDIGDAV 356

>KAFR0H03160 Chr8 complement(602807..604072) [1266 bp, 421 aa] {ON}
           Anc_1.396 YLR174W
          Length = 421

 Score = 65.1 bits (157), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 69/134 (51%), Gaps = 11/134 (8%)

Query: 172 TETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYS 231
           T  + K  A+ + ++AL+R        L  T K+ VL + DG F+++ +E+YES+  +  
Sbjct: 188 TRKSIKGFARASFEMALKR-----KMPLFFTTKNTVLKRYDGKFKDIFQEMYESDYKVQF 242

Query: 232 ---GVAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGP 288
              G+ Y  +++D MV ++ +    F +I   N  GD+ SD  A   GSLGL+ S  V P
Sbjct: 243 DEIGILYEHRLIDDMVAQMLKSTGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSMLVAP 301

Query: 289 N--IVIGEPCHGSA 300
           +      E  HG+ 
Sbjct: 302 DGKTFESEAAHGTV 315

>Ecym_1306 Chr1 complement(619565..620812) [1248 bp, 415 aa] {ON}
           similar to Ashbya gossypii AAL022W
          Length = 415

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/214 (28%), Positives = 93/214 (43%), Gaps = 36/214 (16%)

Query: 101 VEGYSSPIVQLRKELGLFANVRPVKTVEGTDAKPIDLVIVRENTEDLYIKIEK------- 153
           V G+  PI+  R   G                K  D+VI  E T  L  K +        
Sbjct: 121 VSGWKEPIIIGRHAFG-------------DQYKATDVVIPGEGTLKLVFKSKDGDESKDI 167

Query: 154 ---TYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQ 210
               +  PKDG  +A +     E+ T   AK++ ++AL+R        L  T K+ +L +
Sbjct: 168 DLDVFEFPKDGG-VAMSMYNTAESITG-FAKSSFELALER-----KMPLYSTTKNTILKK 220

Query: 211 SDGLFREVCKEVYE---SNKSLYSGVAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDIL 267
            DG F+++ + +YE     K    G+ Y  +++D MV ++ +    F +I   N  GD+ 
Sbjct: 221 YDGQFKDIFEGMYEREYKQKFEAVGIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQ 279

Query: 268 SDGAAALVGSLGLVPSANVGPN--IVIGEPCHGS 299
           SD  A   GSLGL+ S  V P+      E  HG+
Sbjct: 280 SDIVAQGFGSLGLMTSVLVSPDGKTFESEAAHGT 313

>AAL022W Chr1 (302946..304193) [1248 bp, 415 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR174W (IDP2) and
           YNL009W (IDP3)
          Length = 415

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 59/214 (27%), Positives = 96/214 (44%), Gaps = 36/214 (16%)

Query: 101 VEGYSSPIVQLRKELGLFANVRPVKTVEGTDAKPIDLVIVRENTEDLYIKIE-------- 152
           V G++ PI+  R   G                K  D+VI  E T  L  + +        
Sbjct: 121 VPGWNEPIIVGRHAFG-------------DQYKATDVVIPGEGTLKLVFESKDGDKSKNL 167

Query: 153 --KTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQ 210
             + +  PKDG  +A      T++ T   AK++ ++ALQR        L  T K+ +L +
Sbjct: 168 DLEVFEYPKDGG-VAMTMYNTTDSITG-FAKSSFELALQR-----KMPLYSTTKNTILKK 220

Query: 211 SDGLFREVCKEVYESN---KSLYSGVAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDIL 267
            DG F+++ + +Y +    K   +G+ Y  +++D MV ++ +    F +I   N  GD+ 
Sbjct: 221 YDGKFKDIFEGMYAAEYKEKFEAAGIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQ 279

Query: 268 SDGAAALVGSLGLVPSANVGPN--IVIGEPCHGS 299
           SD  A   GSLGL+ S  V P+      E  HG+
Sbjct: 280 SDIVAQGFGSLGLMTSVLVSPDGKTFESEAAHGT 313

>TDEL0B06100 Chr2 complement(1076365..1077609) [1245 bp, 414 aa]
           {ON} Anc_1.396 YLR174W
          Length = 414

 Score = 62.0 bits (149), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 76/147 (51%), Gaps = 13/147 (8%)

Query: 158 PKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFRE 217
           PKDG  +  A    TE+ T   AK + ++AL+R        L  T K+ +L + DG F++
Sbjct: 172 PKDGG-VGMAMYNTTESITG-FAKASFELALER-----KLPLYSTTKNTILKKYDGKFKD 224

Query: 218 VCKEVY-ESNKSLYS--GVAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAAL 274
           V +++Y +  +S +   G+ Y  +++D MV ++ +    F +I   N  GD+ SD  A  
Sbjct: 225 VFEQMYADQYQSRFEELGIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDIVAQG 283

Query: 275 VGSLGLVPSANVGPN--IVIGEPCHGS 299
            GSLGL+ S  V P+      E  HG+
Sbjct: 284 FGSLGLMTSVLVTPDGKTFESEAAHGT 310

>TBLA0C01290 Chr3 complement(283624..284880) [1257 bp, 418 aa] {ON}
           Anc_1.396 YLR174W
          Length = 418

 Score = 61.6 bits (148), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 74/150 (49%), Gaps = 13/150 (8%)

Query: 155 YTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGL 214
           +T PKDG  +A      TE+ T   AK + + AL+R        L  T K+ +L Q DG 
Sbjct: 176 FTYPKDGG-VAMTMYNTTESITD-FAKASFEFALER-----KIPLYSTTKNTILKQYDGK 228

Query: 215 FREVCKEVYE---SNKSLYSGVAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGA 271
           F+++ +E+Y     +K     + Y  +++D MV ++ +    F +I   N  GD+ SD  
Sbjct: 229 FKDIFEEMYAKEYEDKFKVLNIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDVV 287

Query: 272 AALVGSLGLVPSANVGPN--IVIGEPCHGS 299
           A   GSLGL+ S  + P+      E  HG+
Sbjct: 288 AQGFGSLGLMTSVLLTPDGSSFESEAAHGT 317

>SAKL0D08426g Chr4 (705189..706424) [1236 bp, 411 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 411

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/152 (30%), Positives = 76/152 (50%), Gaps = 13/152 (8%)

Query: 153 KTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSD 212
           K +  PK G  +A A    TE+ T   AK + ++AL+R        L  T K+ +L + D
Sbjct: 168 KVFDFPKHGG-VAMAMYNTTESITG-FAKASFELALER-----KLPLYSTTKNTILKRYD 220

Query: 213 GLFREVCKEVYESN---KSLYSGVAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSD 269
           G F+++ + +Y S+   K    G+ Y  +++D MV ++ +    + +I   N  GD+ SD
Sbjct: 221 GKFKDIFESMYASDYQDKFEVIGIWYEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESD 279

Query: 270 GAAALVGSLGLVPSANVGPN--IVIGEPCHGS 299
             A   GSLGL+ S  V P+      E  HG+
Sbjct: 280 IVAQGFGSLGLMSSVLVTPDGKTFESEAAHGT 311

>KLTH0H12012g Chr8 (1026586..1027827) [1242 bp, 413 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 413

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/207 (28%), Positives = 98/207 (47%), Gaps = 22/207 (10%)

Query: 101 VEGYSSPIVQLRKELGLFANVRPVKTVEGTDAKPIDLVIVR---ENTEDLYIKIEKTYTD 157
           V G+  PI+  R   G       V  +EG  A  + LV      +  +DL +++   Y  
Sbjct: 121 VPGWQRPIIIGRHAFGDQYKATDV-AIEG--AGELRLVFRSRDGDQAKDLDLQV---YEF 174

Query: 158 PKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFRE 217
           P+ G  +A A    TE+  +  A+ + ++ALQR        L  T K+ +L + DG F++
Sbjct: 175 PESGG-VALAMYNTTES-IRGFARASFELALQR-----KMPLYSTTKNTILKRYDGRFKD 227

Query: 218 VCKEVYESN---KSLYSGVAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAAL 274
             + +YE+    +   +G+ Y  +++D MV ++ +    F VI   N  GD+ SD  A  
Sbjct: 228 EFEAMYEAEYRERFERAGIWYEHRLIDDMVAQMLKSAGGF-VIAMKNYDGDVQSDIVAQG 286

Query: 275 VGSLGLVPSANVGPN--IVIGEPCHGS 299
            GSLGL+ S  V P+      E  HG+
Sbjct: 287 FGSLGLMTSVLVTPDGRAFESEAAHGT 313

>CAGL0H03663g Chr8 (337533..338789) [1257 bp, 418 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174w IDP2 isocitrate dehydrogenase or uniprot|P53982
           Saccharomyces cerevisiae YNL009w IDP3 or uniprot|P21954
           Saccharomyces cerevisiae YDL066w IDP1
          Length = 418

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 87/174 (50%), Gaps = 17/174 (9%)

Query: 172 TETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESN---KS 228
           T+ +    A+ + ++A++R        L  T K+ +L + DG F+++ +++Y+ +   K 
Sbjct: 186 TDESITGFARASFELAIKR-----KLPLFFTTKNTILKKYDGRFKDIFQKMYDEDYKGKF 240

Query: 229 LYSGVAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGP 288
              G++Y  +++D MV ++ +    F +I   N  GD+ SD  A   GSLGL+ S  + P
Sbjct: 241 KELGISYEHRLIDDMVAQMIKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSTLLTP 299

Query: 289 N--IVIGEPCHGSAPDI-----AGKGIA-NPIATIRSTAQMLEYLGYSNPAQDI 334
           +  I   E  HG+          GK  + N IATI + +Q + + G  +   D+
Sbjct: 300 DGKIFESEAAHGTVTRHYRQYQKGKETSTNSIATIFAWSQGIIHRGKVDQTPDV 353

>Kpol_1055.78 s1055 (207889..209172) [1284 bp, 427 aa] {ON}
           (207889..209172) [1284 nt, 428 aa]
          Length = 427

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 72/133 (54%), Gaps = 11/133 (8%)

Query: 172 TETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESN-KSLY 230
           T+ + +  A ++  +A+ +        L ++ K+ +L + DG F+++ +E+YES+ KS +
Sbjct: 196 TDESIRGFAHSSFKLAINK-----KLNLFLSTKNTILKKYDGRFKDIFQEIYESDYKSQF 250

Query: 231 S--GVAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGP 288
              G++Y  +++D MV ++ +    F ++   N  GD+ SD  A   GSLGL+ S  V P
Sbjct: 251 ENLGISYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTP 309

Query: 289 N--IVIGEPCHGS 299
           +      E  HG+
Sbjct: 310 DGKTFESEAAHGT 322

>Kwal_23.4210 s23 (619516..620784) [1269 bp, 422 aa] {ON} YDL066W
           (IDP1) - Mitochondrial form of NADP-specific isocitrate
           dehydrogenase [contig 1] FULL
          Length = 422

 Score = 59.3 bits (142), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 90/204 (44%), Gaps = 16/204 (7%)

Query: 101 VEGYSSPIVQLRKELGLFANVRPVKTVEGTDAKPIDLVIVRENTEDLYIKIEKTYTDPKD 160
           V G+  PI+     +G  A+    +  +    K   L +V    +    KI + +     
Sbjct: 129 VPGWQKPII-----IGRHAHGDQYRATDAIIEKAGKLELVHRPADGSEPKILQVHEFKGT 183

Query: 161 GSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCK 220
           G+R        T+ + +  A  +  +AL +        L ++ K+ +L Q DG F+++ +
Sbjct: 184 GARGVALAMYNTDESIRGFAHASFKLALSK-----RLNLFMSTKNTILKQYDGRFKDIFQ 238

Query: 221 EVYESNKSLY---SGVAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGS 277
           EVY           G++Y  +++D MV ++ +    F V+   N  GD+LSD  A   GS
Sbjct: 239 EVYAQEYQTQFRDEGISYEHRLIDDMVAQMIKSRGGF-VMALKNYDGDVLSDIVAQGFGS 297

Query: 278 LGLVPSANVGPN--IVIGEPCHGS 299
           LGL+ S  V P+      E  HG+
Sbjct: 298 LGLMTSMLVTPDGKTFESEAAHGT 321

>NCAS0A08720 Chr1 complement(1722511..1723752) [1242 bp, 413 aa]
           {ON} Anc_1.396
          Length = 413

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 41/133 (30%), Positives = 67/133 (50%), Gaps = 11/133 (8%)

Query: 172 TETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESN-KSLY 230
           T  A +  A+++  +AL+R        L  T K+ +L + DG F+ V +++YE   K  +
Sbjct: 187 TTDAIEGFARSSFQLALER-----QLPLYSTTKNTILKKYDGKFKSVFEDMYEREYKQQF 241

Query: 231 S--GVAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGP 288
              G+ Y  +++D MV ++ +    F +I   N  GD+ SD  A   GSLGL+ S  V P
Sbjct: 242 EDLGIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVAP 300

Query: 289 N--IVIGEPCHGS 299
           +      E  HG+
Sbjct: 301 DGKTFESEAAHGT 313

>ZYRO0E05016g Chr5 complement(379654..380889) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P41939 Saccharomyces
           cerevisiae YLR174W IDP2 Cytosolic NADP-specific
           isocitrate dehydrogenase catalyzes oxidation of
           isocitrate to alpha- ketoglutarate levels are elevated
           during growth on non- fermentable carbon sources and
           reduced during growth on glucose
          Length = 411

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 77/152 (50%), Gaps = 13/152 (8%)

Query: 153 KTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSD 212
           + +  PK G  +A A    TE + +  AK + ++AL+R        L  T K+ +L + D
Sbjct: 169 QVFEFPKGGG-VAMAMYNTTE-SIEGFAKASFELALER-----KQPLYSTTKNTILKKYD 221

Query: 213 GLFREVCKEVYESN-KSLYS--GVAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSD 269
           G F+++ + +YE   +S +   G+ Y  +++D MV ++ +    + +I   N  GD+ SD
Sbjct: 222 GKFKDIFEAMYEKEYRSQFEKLGIWYEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVQSD 280

Query: 270 GAAALVGSLGLVPSANVGPN--IVIGEPCHGS 299
             A   GSLGL+ S  V P+      E  HG+
Sbjct: 281 IVAQGFGSLGLMTSVLVTPDGKTFESEAAHGT 312

>KLLA0F12342g Chr6 (1137608..1138855) [1248 bp, 415 aa] {ON} highly
           similar to uniprot|P41939 Saccharomyces cerevisiae
           YLR174W IDP2 Cytosolic NADP-specific isocitrate
           dehydrogenase catalyzes oxidation of isocitrate to
           alpha- ketoglutarate levels are elevated during growth
           on non- fermentable carbon sources and reduced during
           growth on glucose
          Length = 415

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 63/229 (27%), Positives = 106/229 (46%), Gaps = 27/229 (11%)

Query: 143 NTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLTVT 202
           NTE++ + +     + K G  +A A     E+ T   A  +  +AL+R        L  T
Sbjct: 162 NTENIELSVYDFDEESKGG--VAMAMYNTLESITG-FAHASFKMALER-----GLPLYST 213

Query: 203 HKSNVLSQSDGLFREVCKEVYESN-KSLYS--GVAYNEQIVDSMVYRLFREPECFDVIVA 259
            K+ +L + DG F++V + +YES  KS +   G+ Y  +++D MV ++ +    + +I  
Sbjct: 214 TKNTILKKYDGKFKDVFESLYESQYKSAFEAKGIWYEHRLIDDMVAQMLKSKGGY-IIAM 272

Query: 260 PNLYGDILSDGAAALVGSLGLVPSANVGPN--IVIGEPCHGSA-----PDIAGKGIA-NP 311
            N  GD+ SD  A   GSLGL+ S  + P+      E  HG+          GK  + N 
Sbjct: 273 KNYDGDVESDIVAQGFGSLGLMTSVLITPDGKAFESEAAHGTVTRHYRQHQQGKETSTNS 332

Query: 312 IATIRSTAQMLEYLGYSNPAQDIYK-------AVDANIRDNKIKTADLG 353
           IA+I +  + L   G  +   D+ K       A    +++++I T DL 
Sbjct: 333 IASIFAWTRGLIQRGKLDSTPDVVKFAELVESATVNTVQEDEIMTKDLA 381

>KNAG0I01320 Chr9 complement(255478..256716) [1239 bp, 412 aa] {ON}
           Anc_1.396 YLR174W
          Length = 412

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 83/173 (47%), Gaps = 14/173 (8%)

Query: 132 AKPIDLVIVRENTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRL 191
           A  + LV   +N E+  + ++  Y  P+DG          T+ + +  AK +  +A++R 
Sbjct: 151 AGKLKLVFEPDNPEEETLSLD-VYHYPRDGG--VAMVMYNTKESIEGFAKASFQLAVER- 206

Query: 192 KTKGSATLTVTHKSNVLSQSDGLFREVCKEVYE---SNKSLYSGVAYNEQIVDSMVYRLF 248
                  L  T K+ +L + DG+F+++ + +YE     K    G+ Y  +++D MV ++ 
Sbjct: 207 ----KMPLYSTTKNTILKKYDGMFKDIFEGMYEREYKEKFEELGIWYEHRLIDDMVAQML 262

Query: 249 REPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPN--IVIGEPCHGS 299
           +    + +I   N  GD+ SD  A   GSLGL+ S  + P+      E  HG+
Sbjct: 263 KSSGGY-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFESEAAHGT 314

>KNAG0H01670 Chr8 (298481..299755) [1275 bp, 424 aa] {ON} Anc_1.396
           YLR174W
          Length = 424

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 79/158 (50%), Gaps = 11/158 (6%)

Query: 172 TETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESN-KSLY 230
           T  + +  AK++ ++AL+R        L    K+ +L + DGLF+++ +++Y+ + K+ +
Sbjct: 188 TTGSIESFAKSSFELALKR-----KLPLFFATKNTILKEYDGLFKDIFEKLYKDHYKTKF 242

Query: 231 S--GVAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGP 288
              G+ +  +++D MV ++ +    F ++   N  GD+ SD  A   GSLGL+ S  V P
Sbjct: 243 EELGITFEHRLIDDMVAQMLKSNGGF-ILSLKNYDGDVQSDIVAQGFGSLGLMTSMLVTP 301

Query: 289 N--IVIGEPCHGSAPDIAGKGIANPIATIRSTAQMLEY 324
           +  +   E  HG+      K       +  STA +  +
Sbjct: 302 DDSVFESEAAHGTVTRHFRKYQKGEETSTNSTASIFAW 339

>KAFR0I02130 Chr9 (438428..439654) [1227 bp, 408 aa] {ON} Anc_1.396
           YLR174W
          Length = 408

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 66/134 (49%), Gaps = 11/134 (8%)

Query: 172 TETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESN-KSLY 230
           T  + +  A+ +  +A++R        L  T K+ +L Q DG F+++ K VYE+  K  +
Sbjct: 183 TRESIESFARASFTMAIER-----KLPLYSTTKNTILKQYDGQFKDIFKTVYENEYKETF 237

Query: 231 S--GVAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGP 288
              G+ Y  +++D MV ++ +    F +I   N  GD+ SD  A   GSLGL+ S  +  
Sbjct: 238 EELGIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSTLIAA 296

Query: 289 N--IVIGEPCHGSA 300
           +      E  HG+ 
Sbjct: 297 DGKTFESEAAHGTV 310

>CAGL0B04917g Chr2 complement(477939..479174) [1236 bp, 411 aa] {ON}
           highly similar to uniprot|P41939 Saccharomyces
           cerevisiae YLR174w IDP2 isocitrate dehydrogenase or
           uniprot|P53982 Saccharomyces cerevisiae YNL009w IDP3 or
           uniprot|P21954 Saccharomyces cerevisiae YDL066w IDP1
          Length = 411

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 74/150 (49%), Gaps = 13/150 (8%)

Query: 155 YTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGL 214
           Y  PK+G  +A      TE + +  A+ + ++AL+         L  T K+ +L + DG 
Sbjct: 170 YNFPKEGG-VAMMMYNTTE-SIRGFARASFNMALEH-----EMPLYSTTKNTILKKYDGK 222

Query: 215 FREVCKEVYESN-KSLYS--GVAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGA 271
           F++  + +YE+  K  +   G+ Y  +++D MV ++ +    F +I   N  GD+ SD  
Sbjct: 223 FKDTFESMYEAEYKEQFEAKGIWYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVESDIV 281

Query: 272 AALVGSLGLVPSANVGPN--IVIGEPCHGS 299
           A   GSLGL+ S  + P+      E  HG+
Sbjct: 282 AQGFGSLGLMTSVLISPDGKTFESEAAHGT 311

>CAGL0D00770g Chr4 (95715..96986) [1272 bp, 423 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066w IDP1 isocitrate dehydrogenase or uniprot|P41939
           Saccharomyces cerevisiae YLR174w IDP2 or uniprot|P53982
           Saccharomyces cerevisiae YNL009w IDP3
          Length = 423

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 68/133 (51%), Gaps = 11/133 (8%)

Query: 172 TETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYES---NKS 228
           T+ + +  A ++  +ALQ+        L ++ K+ +L + DG F+++ +EVY+S    K 
Sbjct: 197 TDESIRGFAHSSFKLALQK-----KLNLFLSTKNTILKKYDGRFKDIFQEVYDSEYKQKF 251

Query: 229 LYSGVAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGP 288
               + Y  +++D MV ++ +    F ++   N  GD+ SD  A   GSLGL+ S  + P
Sbjct: 252 AELNITYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILITP 310

Query: 289 N--IVIGEPCHGS 299
           +      E  HG+
Sbjct: 311 DGKTFESEAAHGT 323

>YDL066W Chr4 (334835..336121) [1287 bp, 428 aa] {ON}
           IDP1Mitochondrial NADP-specific isocitrate
           dehydrogenase, catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate; not required for mitochondrial
           respiration and may function to divert
           alpha-ketoglutarate to biosynthetic processes
          Length = 428

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 75/144 (52%), Gaps = 12/144 (8%)

Query: 161 GSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCK 220
           GS +A A    T+ + +  A ++  +A+ +        L ++ K+ +L + DG F+++ +
Sbjct: 192 GSGVAMAMYN-TDESIEGFAHSSFKLAIDK-----KLNLFLSTKNTILKKYDGRFKDIFQ 245

Query: 221 EVYESN-KSLYS--GVAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGS 277
           EVYE+  KS +   G+ Y  +++D MV ++ +    F ++   N  GD+ SD  A   GS
Sbjct: 246 EVYEAQYKSKFEQLGIHYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGS 304

Query: 278 LGLVPSANVGPN--IVIGEPCHGS 299
           LGL+ S  V P+      E  HG+
Sbjct: 305 LGLMTSILVTPDGKTFESEAAHGT 328

>Kwal_0.191 s0 (98033..99268) [1236 bp, 411 aa] {ON} YLR174W (IDP2)
           - Cytosolic form of NADP-dependent isocitrate
           dehydrogenase [contig 82] FULL
          Length = 411

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 65/126 (51%), Gaps = 11/126 (8%)

Query: 179 IAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESN-KSLYS--GVAY 235
            A+ + ++ALQR        L  T K+ +L + DG F++V + +Y +  +S +   G+ Y
Sbjct: 192 FARASFELALQR-----RMPLYSTTKNTILKKYDGKFKDVFEAMYAAEYQSRFEELGIWY 246

Query: 236 NEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPN--IVIG 293
             +++D MV ++ +    F +I   N  GD+ SD  A   GSLGL+ S  V P+      
Sbjct: 247 EHRLIDDMVAQMLKSTGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLVTPDGKTFES 305

Query: 294 EPCHGS 299
           E  HG+
Sbjct: 306 EAAHGT 311

>Skud_4.189 Chr4 (330300..331589) [1290 bp, 429 aa] {ON} YDL066W
           (REAL)
          Length = 429

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 75/144 (52%), Gaps = 12/144 (8%)

Query: 161 GSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCK 220
           GS +A A    T+ + +  A ++  +A+ +        L ++ K+ +L + DG F+++ +
Sbjct: 193 GSGVAMAMYN-TDESIEGFAHSSFKLAIDK-----KLNLFLSTKNTILKKYDGRFKDIFQ 246

Query: 221 EVYESN-KSLYS--GVAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGS 277
           EVYE+  KS +   G+ Y  +++D MV ++ +    F ++   N  GD+ SD  A   GS
Sbjct: 247 EVYEAEYKSKFEKLGIHYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGS 305

Query: 278 LGLVPSANVGPN--IVIGEPCHGS 299
           LGL+ S  V P+      E  HG+
Sbjct: 306 LGLMTSILVTPDGKTFESEAAHGT 329

>NDAI0G00850 Chr7 (179074..180333) [1260 bp, 419 aa] {ON} Anc_1.396
          Length = 419

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 73/155 (47%), Gaps = 11/155 (7%)

Query: 150 KIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLS 209
           KI   ++ P DG+         T  + K  AK +  +AL+R        L +  K+ +L 
Sbjct: 166 KIINVFSFPNDGTGGIAMVMYNTVDSIKGFAKASFIMALKR-----KLPLFLATKNTILK 220

Query: 210 QSDGLFREVCKEVYESN---KSLYSGVAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDI 266
           + DG F+ +  ++Y++    K    G+ Y  +++D MV ++ +    F +I   N  GD+
Sbjct: 221 KYDGRFKSIFDDMYQNEFKEKFEKLGLTYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDV 279

Query: 267 LSDGAAALVGSLGLVPSANVGPN--IVIGEPCHGS 299
            SD  A   GSLGL+ S  + P+      E  HG+
Sbjct: 280 QSDIVAQGFGSLGLMTSQLITPDGKTFQSEAAHGT 314

>KLLA0B03355g Chr2 (303444..304733) [1290 bp, 429 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066W IDP1 Mitochondrial NADP-specific isocitrate
           dehydrogenase catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate not required for mitochondrial
           respiration and may function to divert alpha-
           ketoglutarate to biosynthetic processes
          Length = 429

 Score = 55.8 bits (133), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 57/204 (27%), Positives = 97/204 (47%), Gaps = 19/204 (9%)

Query: 101 VEGYSSPIVQLRKELGLFANVRPVKTVEGTDAKPIDLVIVRENTEDLYIKIEKTYTDPKD 160
           V G+  PIV     +G  A+    K  +     P  L +V + T+    K  + Y D K 
Sbjct: 140 VPGWEKPIV-----IGRHAHGDQYKATDLVVPGPGKLELVYKPTDGSETKTLEVY-DYK- 192

Query: 161 GSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCK 220
           G  IA A    T+ + +  A  +  +A+ +        L ++ K+ +L + DG F+++ +
Sbjct: 193 GPGIALAMYN-TDESIRGFAHASFKLAITK-----KLNLYLSTKNTILKKYDGRFKDIFQ 246

Query: 221 EVYESN-KSLYS--GVAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGS 277
           E+Y+S  KS +   G+ Y  +++D MV ++ +    F ++   N  GD+ SD  A   GS
Sbjct: 247 EIYDSEYKSEFEKLGIWYEHRLIDDMVAQMIKSKGGF-ILAFKNYDGDVQSDIVAQGFGS 305

Query: 278 LGLVPSANVGPN--IVIGEPCHGS 299
           LGL+ S  V P+      E  HG+
Sbjct: 306 LGLMTSVLVTPDGKAFESEAAHGT 329

>AER061C Chr5 complement(749709..750986) [1278 bp, 425 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL066W
           (IDP1)
          Length = 425

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 69/133 (51%), Gaps = 11/133 (8%)

Query: 172 TETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESN-KSLY 230
           TE + +  A  +  +AL +        L ++ K+ +L Q DG F++V +E+Y++  K+ +
Sbjct: 202 TEESIRGFAHASFRLALAK-----QLNLFLSTKNTILKQYDGRFKDVFEELYQAQYKAEF 256

Query: 231 S--GVAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGP 288
              G+ Y  +++D MV ++ +    F ++   N  GD+ SD  A   GSLGL+ S  V P
Sbjct: 257 ERLGIYYEHRLIDDMVAQMVKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTP 315

Query: 289 N--IVIGEPCHGS 299
           +      E  HG+
Sbjct: 316 DGKTFESEAAHGT 328

>Suva_10.271 Chr10 (476726..477964) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 76/152 (50%), Gaps = 13/152 (8%)

Query: 153 KTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSD 212
           K Y  P++G  +A      T+ + K  AK + ++AL+R        L  T K+ +L + D
Sbjct: 168 KVYDYPENGG-VAMMMYNTTD-SIKGFAKASFELALER-----KLPLYSTTKNTILKKYD 220

Query: 213 GLFREVCKEVY-ESNKSLYS--GVAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSD 269
           G F++V + +Y E  K  +   G+ Y  +++D MV ++ +    + +I   N  GD+ SD
Sbjct: 221 GKFKDVFEAMYAEVYKEKFEALGIWYEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESD 279

Query: 270 GAAALVGSLGLVPSANVGPN--IVIGEPCHGS 299
             A   GSLGL+ S  + P+      E  HG+
Sbjct: 280 IVAQGFGSLGLMTSLLITPDGKTFESEAAHGT 311

>KLTH0D14476g Chr4 complement(1184813..1186075) [1263 bp, 420 aa]
           {ON} highly similar to uniprot|P21954 Saccharomyces
           cerevisiae YDL066W IDP1 Mitochondrial NADP-specific
           isocitrate dehydrogenase catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate not required for
           mitochondrial respiration and may function to divert
           alpha- ketoglutarate to biosynthetic processes
          Length = 420

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 85/182 (46%), Gaps = 19/182 (10%)

Query: 190 RLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESN-KSLY--SGVAYNEQIVDSMVYR 246
           RL       L +  K+ +L Q DG F+++ +++Y++  +  +  +G++Y  +++D MV +
Sbjct: 207 RLALSKQLNLFLATKNTILKQYDGRFKDLFQQLYDAEYREAFERAGISYEHRLIDDMVAQ 266

Query: 247 LFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGP--NIVIGEPCHGS----- 299
           + +    F V+   N  GD+ SD  A   GSLGL+ S  + P  N    E  HG+     
Sbjct: 267 MIKSRGGF-VLALKNYDGDVQSDIVAQGFGSLGLMSSVLITPDGNAFESEAAHGTVTRHF 325

Query: 300 -----APDIAGKGIANPIATIRSTAQMLEYLG---YSNPAQDIYKAVDANIRDNKIKTAD 351
                  + +   IA+  A  R  A+  +  G    ++ A  +  A    ++D+ I T D
Sbjct: 326 RLHQQGKETSTNSIASIFAWTRGLARRADLDGTPAVADFAHALEGATLRTVQDDAIMTKD 385

Query: 352 LG 353
           L 
Sbjct: 386 LA 387

>SAKL0H02860g Chr8 (280944..282209) [1266 bp, 421 aa] {ON} highly
           similar to uniprot|P21954 Saccharomyces cerevisiae
           YDL066W IDP1 Mitochondrial NADP-specific isocitrate
           dehydrogenase catalyzes the oxidation of isocitrate to
           alpha-ketoglutarate not required for mitochondrial
           respiration and may function to divert alpha-
           ketoglutarate to biosynthetic processes
          Length = 421

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 53/206 (25%), Positives = 96/206 (46%), Gaps = 24/206 (11%)

Query: 101 VEGYSSPIVQLRKELGLFANVRPVKTVEGTDAKP--IDLVIVRENTEDLYIKIEKTYTDP 158
           V G+  PI+     +G  A+    K  +     P  ++LV   EN  +   K+ + Y   
Sbjct: 133 VPGWEKPII-----IGRHAHGDQYKATDAVIPGPGKLELVYKPENGPE---KVMEVYDYK 184

Query: 159 KDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREV 218
             G  +A      TE + +  A  +  +AL +        L ++ K+ +L + DG F+++
Sbjct: 185 GPGVALAMYN---TEESIRGFAHASFKLALTK-----KLNLYLSTKNTILKKYDGRFKDI 236

Query: 219 CKEVYESN-KSLY--SGVAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALV 275
            +E+Y++  K  +  +G+ Y  +++D MV ++ +    F ++   N  GD+ SD  A   
Sbjct: 237 FQELYDAEYKKQFEAAGIYYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGF 295

Query: 276 GSLGLVPSANVGPN--IVIGEPCHGS 299
           GSLGL+ S  V P+      E  HG+
Sbjct: 296 GSLGLMTSVLVTPDGKTFESEAAHGT 321

>Smik_12.235 Chr12 (451719..452957) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 65/126 (51%), Gaps = 11/126 (8%)

Query: 179 IAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVY-ESNKSLYS--GVAY 235
            AK + ++A++R        L  T K+ +L + DG F++V + +Y ES K  +   G+ Y
Sbjct: 192 FAKASFELAIER-----KLPLYSTTKNTILKKYDGKFKDVFEGMYAESYKEKFESLGIWY 246

Query: 236 NEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPN--IVIG 293
             +++D MV ++ +    + +I   N  GD+ SD  A   GSLGL+ S  + P+      
Sbjct: 247 EHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGKTFES 305

Query: 294 EPCHGS 299
           E  HG+
Sbjct: 306 EAAHGT 311

>Skud_12.239 Chr12 (451342..452580) [1239 bp, 412 aa] {ON} YLR174W
           (REAL)
          Length = 412

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 66/133 (49%), Gaps = 11/133 (8%)

Query: 172 TETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESN---KS 228
           T  + +  AK + ++A++R        L  T K+ +L + DG F++V + +Y  N   K 
Sbjct: 185 TTNSIEGFAKASFELAIER-----KLPLYSTTKNTILKKYDGKFKDVFEAMYAENYKEKF 239

Query: 229 LYSGVAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGP 288
              G+ Y  +++D MV ++ +    + +I   N  GD+ SD  A   GSLGL+ S  + P
Sbjct: 240 ESLGIWYEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSMLITP 298

Query: 289 N--IVIGEPCHGS 299
           +      E  HG+
Sbjct: 299 DGKTFESEAAHGT 311

>Smik_4.169 Chr4 (311244..312530) [1287 bp, 428 aa] {ON} YDL066W
           (REAL)
          Length = 428

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 75/144 (52%), Gaps = 12/144 (8%)

Query: 161 GSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCK 220
           GS +A A    T+ + +  A ++  +A+ +        L ++ K+ +L + DG F+++ +
Sbjct: 192 GSGVAMAMYN-TDESIEGFAHSSFKLAIDK-----KLNLFLSTKNTILKKYDGRFKDIFQ 245

Query: 221 EVYESN-KSLYS--GVAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGS 277
           +VYE+  KS +   G+ Y  +++D MV ++ +    F ++   N  GD+ SD  A   GS
Sbjct: 246 KVYEAQYKSKFEALGIHYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGS 304

Query: 278 LGLVPSANVGPN--IVIGEPCHGS 299
           LGL+ S  V P+      E  HG+
Sbjct: 305 LGLMTSILVTPDGKTFESEAAHGT 328

>Suva_14.339 Chr14 (594794..596047) [1254 bp, 417 aa] {ON} YNL009W
           (REAL)
          Length = 417

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 66/133 (49%), Gaps = 11/133 (8%)

Query: 172 TETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESN-KSLY 230
           T  + K  AK + ++AL+R        L  T K+ +L   D  F+++  +++++  K  +
Sbjct: 185 TNDSIKGFAKASFELALKR-----KLPLFFTTKNTILKNYDNQFKQIFDKLFDAEYKEQF 239

Query: 231 S--GVAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGP 288
              G+ Y  +++D MV ++ +    F +I   N  GD+ SD  A   GSLGL+ S  + P
Sbjct: 240 QALGITYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSILITP 298

Query: 289 N--IVIGEPCHGS 299
           +      E  HG+
Sbjct: 299 DGKTFESEAAHGT 311

>KNAG0D04410 Chr4 complement(799414..800700) [1287 bp, 428 aa] {ON}
           Anc_4.254 YDL066W
          Length = 428

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 76/155 (49%), Gaps = 17/155 (10%)

Query: 172 TETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESN-KSLY 230
           T+ + +  A  +  +AL +        L ++ K+ +L + DG F+++ +E++++  K  +
Sbjct: 202 TDESIRGFAHASFKLALSK-----KLDLFLSTKNTILKRYDGRFKDLFQEIFDAEYKQQF 256

Query: 231 --SGVAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGP 288
             SG+ Y  +++D MV ++ +    F ++   N  GD+ SD  A   GSLGL+ S  V P
Sbjct: 257 EESGIQYQHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTP 315

Query: 289 N--IVIGEPCHGSAPDIAGK------GIANPIATI 315
           +      E  HG+      K         NPIA+I
Sbjct: 316 DGKTFESEAAHGTVTRHYRKYQRGEETSTNPIASI 350

>NCAS0A02510 Chr1 complement(476363..477643) [1281 bp, 426 aa] {ON}
           Anc_4.254
          Length = 426

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 71/133 (53%), Gaps = 11/133 (8%)

Query: 172 TETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESN-KSLY 230
           T+ + +  A ++  +AL +        L ++ K+ +L + DG F+++ +E+++   K+ +
Sbjct: 200 TDESIRGFAHSSFKLALTK-----KLNLFLSTKNTILKKYDGRFKDIFQEIFDMEYKTKF 254

Query: 231 S--GVAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGP 288
           +  G++Y  +++D MV ++ +    F ++   N  GD+ SD  A   GSLGL+ S  V P
Sbjct: 255 ANLGISYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTP 313

Query: 289 N--IVIGEPCHGS 299
           +      E  HG+
Sbjct: 314 DGKTFESEAAHGT 326

>Kpol_1048.70 s1048 complement(198298..199557) [1260 bp, 419 aa]
           {ON} complement(198298..199557) [1260 nt, 420 aa]
          Length = 419

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 65/133 (48%), Gaps = 11/133 (8%)

Query: 172 TETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESN---KS 228
           T  + K  A ++ + AL++        L  T K+ +L + DG ++++  ++YE +   K 
Sbjct: 190 TTRSIKGFAHSSFEFALEK-----GLPLYSTTKNTILKKYDGQYKDIFNDMYEKDYKDKF 244

Query: 229 LYSGVAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGP 288
              G+ Y  +++D MV ++ +    F VI   N  GD+ SD  A   GSLGL+ S  +  
Sbjct: 245 EAKGIWYEHRLIDDMVAQMLKSKGGF-VIAMKNYDGDVQSDVVAQGFGSLGLMSSILISD 303

Query: 289 N--IVIGEPCHGS 299
           +      E  HG+
Sbjct: 304 DGKTFESEAAHGT 316

>YLR174W Chr12 (504591..505829) [1239 bp, 412 aa] {ON}
           IDP2Cytosolic NADP-specific isocitrate dehydrogenase,
           catalyzes oxidation of isocitrate to
           alpha-ketoglutarate; levels are elevated during growth
           on non-fermentable carbon sources and reduced during
           growth on glucose
          Length = 412

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 38/128 (29%), Positives = 65/128 (50%), Gaps = 15/128 (11%)

Query: 179 IAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVY-----ESNKSLYSGV 233
            AK + ++A++R        L  T K+ +L + DG F++V + +Y     E  +SL  G+
Sbjct: 192 FAKASFELAIER-----KLPLYSTTKNTILKKYDGKFKDVFEAMYARSYKEKFESL--GI 244

Query: 234 AYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPN--IV 291
            Y  +++D MV ++ +    + +I   N  GD+ SD  A   GSLGL+ S  + P+    
Sbjct: 245 WYEHRLIDDMVAQMLKSKGGY-IIAMKNYDGDVESDIVAQGFGSLGLMTSVLITPDGKTF 303

Query: 292 IGEPCHGS 299
             E  HG+
Sbjct: 304 ESEAAHGT 311

>YNL009W Chr14 (614821..616083) [1263 bp, 420 aa] {ON}
           IDP3Peroxisomal NADP-dependent isocitrate dehydrogenase,
           catalyzes oxidation of isocitrate to alpha-ketoglutarate
           with the formation of NADP(H+), required for growth on
           unsaturated fatty acids
          Length = 420

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 47/154 (30%), Positives = 72/154 (46%), Gaps = 17/154 (11%)

Query: 153 KTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSD 212
           K Y  PK G  IA A    T  + K  AK + ++AL+R        L  T K+ +L   D
Sbjct: 168 KVYEFPKSGG-IAMAMFN-TNDSIKGFAKASFELALKR-----KLPLFFTTKNTILKNYD 220

Query: 213 GLFREVC-----KEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDIL 267
             F+++      KE  E  ++L   + Y  +++D MV ++ +    F +I   N  GD+ 
Sbjct: 221 NQFKQIFDNLFDKEYKEKFQAL--KITYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQ 277

Query: 268 SDGAAALVGSLGLVPSANVGPN--IVIGEPCHGS 299
           SD  A   GSLGL+ S  + P+      E  HG+
Sbjct: 278 SDIVAQGFGSLGLMTSILITPDGKTFESEAAHGT 311

>KAFR0G03260 Chr7 complement(675642..676907) [1266 bp, 421 aa] {ON}
           Anc_4.254 YDL066W
          Length = 421

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 83/174 (47%), Gaps = 17/174 (9%)

Query: 172 TETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESN-KSLY 230
           T+ + +  A ++  +AL +        L +  K+ +L + DG F+++ +++Y    K+ +
Sbjct: 197 TDESIEGFAHSSFQVALNK-----KLNLFLATKNTILKKYDGRFKDIFQQIYNGQYKAKF 251

Query: 231 S--GVAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGP 288
              G+ Y  +++D MV ++ +    F ++   N  GD+ SD  A   GSLGL+ S  V P
Sbjct: 252 EQLGITYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILVSP 310

Query: 289 N--IVIGEPCHGSAP------DIAGKGIANPIATIRSTAQMLEYLGYSNPAQDI 334
           +      E  HG+         +  +   N IA+I + ++ L   G  +  +D+
Sbjct: 311 DGKTFESEAAHGTVTRHFRRHQMGEETSTNSIASIFAWSRGLAKRGELDGTKDV 364

>ZYRO0B12496g Chr2 complement(1007086..1008354) [1269 bp, 422 aa]
           {ON} highly similar to uniprot|P21954 Saccharomyces
           cerevisiae YDL066W IDP1 Mitochondrial NADP-specific
           isocitrate dehydrogenase catalyzes the oxidation of
           isocitrate to alpha-ketoglutarate not required for
           mitochondrial respiration and may function to divert
           alpha- ketoglutarate to biosynthetic processes
          Length = 422

 Score = 52.8 bits (125), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 49/204 (24%), Positives = 93/204 (45%), Gaps = 19/204 (9%)

Query: 101 VEGYSSPIVQLRKELGLFANVRPVKTVEGTDAKPIDLVIVRENTEDLYIKIEKTYTDPKD 160
           V G+  PI+     +G  A+    K  +   AKP  L +V    +       + Y     
Sbjct: 133 VPGWEKPII-----IGRHAHADQYKATDTLVAKPGKLELVHRPEDGSEPTTLEVYDYKGP 187

Query: 161 GSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCK 220
           G  +A      T+ + +     +  +AL +        L ++ K+ +L + DG F+++ +
Sbjct: 188 GVALAMYN---TDESIRGFGHASFKLALDK-----KLNLYLSTKNTILKKYDGRFKDIFQ 239

Query: 221 EVYESN-KSLY--SGVAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGS 277
           E+Y++  K+ +  +G+ Y  +++D MV ++ +    F ++   N  GD+ SD  A   GS
Sbjct: 240 ELYDTQYKAEFEKAGIFYEHRLIDDMVAQMVKSKGGF-IMALKNYDGDVQSDIVAQGFGS 298

Query: 278 LGLVPSANVGPN--IVIGEPCHGS 299
           LGL+ S  + P+      E  HG+
Sbjct: 299 LGLMTSVLITPDGKTFESEAAHGT 322

>Skud_14.318 Chr14 (581597..582859) [1263 bp, 420 aa] {ON} YNL009W
           (REAL)
          Length = 420

 Score = 52.4 bits (124), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 62/126 (49%), Gaps = 11/126 (8%)

Query: 179 IAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESN---KSLYSGVAY 235
            AK + ++AL+R        L  T K+ +L   D  F+E+  +++++    K    G+ Y
Sbjct: 192 FAKASFELALKR-----RLPLFFTTKNTILKSYDNQFKEIFDKLFDAEYKEKFQALGITY 246

Query: 236 NEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPN--IVIG 293
             +++D MV ++ +    F ++   N  GD+ SD  A   GSLGL+ S  + P+      
Sbjct: 247 EHRLIDDMVAQMLKSRGGF-IVAMKNYDGDVQSDIVAQGFGSLGLMTSLLITPDAKTFES 305

Query: 294 EPCHGS 299
           E  HG+
Sbjct: 306 EAAHGT 311

>TDEL0E01160 Chr5 (234217..235488) [1272 bp, 423 aa] {ON} Anc_4.254
           YDL066W
          Length = 423

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 70/133 (52%), Gaps = 11/133 (8%)

Query: 172 TETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESN-KSLY 230
           T+ + +  A  +  +AL +        L ++ K+ +L + DG F+++ +E++++  K+ +
Sbjct: 197 TDESIRGFAHASFKLALNK-----KLNLFLSTKNTILKKYDGRFKDIFQEIFDAEYKTQF 251

Query: 231 --SGVAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGP 288
             + ++Y  +++D MV ++ +    F ++   N  GD+ SD  A   GSLGL+ S  V P
Sbjct: 252 EAANISYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSVLVTP 310

Query: 289 N--IVIGEPCHGS 299
           +      E  HG+
Sbjct: 311 DGKTFESEAAHGT 323

>Smik_14.319 Chr14 (573167..574423) [1257 bp, 418 aa] {ON} YLR174W
           (REAL)
          Length = 418

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 75/167 (44%), Gaps = 22/167 (13%)

Query: 143 NTEDLYIKIEKTYTDPKDGSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLTVT 202
           N+ED    I+    D  D   IA A    T  + +  AK + ++AL+R        L  T
Sbjct: 157 NSEDGKENIDLKVYDFPDSGGIAMAMFN-TNNSIEGFAKASFELALKR-----KLPLFFT 210

Query: 203 HKSNVLSQSD--------GLFREVCKEVYESNKSLYSGVAYNEQIVDSMVYRLFREPECF 254
            K+ +L   D        GLF E  +E +++      G+ Y  +++D MV ++ +    F
Sbjct: 211 TKNTILKNYDNQFKQIFDGLFNEKYREKFQA-----LGIKYEHRLIDDMVAQMLKSKGGF 265

Query: 255 DVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPN--IVIGEPCHGS 299
            +I   N  GD+ SD  A   GSLGL+ S  V P+      E  HG+
Sbjct: 266 -IIAMKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGT 311

>Suva_4.184 Chr4 (324382..325671) [1290 bp, 429 aa] {ON} YDL066W
           (REAL)
          Length = 429

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 72/144 (50%), Gaps = 12/144 (8%)

Query: 161 GSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCK 220
           GS +A A    T+ + +  A ++  +A+ +        L ++ K+ +L + DG F+++ +
Sbjct: 193 GSGVAMAMYN-TDESIEGFAHSSFKMAIDK-----KLNLFLSTKNTILKKYDGRFKDIFQ 246

Query: 221 EVYESN---KSLYSGVAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGS 277
            +YE+    K    G+ Y  +++D MV ++ +    F ++   N  GD+ SD  A   GS
Sbjct: 247 NIYEAQYKPKFEELGIHYEHRLIDDMVAQMVKSKGGF-IMALKNYDGDVQSDIVAQGFGS 305

Query: 278 LGLVPSANVGPN--IVIGEPCHGS 299
           LGL+ S  V P+      E  HG+
Sbjct: 306 LGLMTSILVTPDGKTFESEAAHGT 329

>NCAS0G03620 Chr7 complement(675224..676480) [1257 bp, 418 aa] {ON}
           Anc_1.396
          Length = 418

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 57/116 (49%), Gaps = 6/116 (5%)

Query: 190 RLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVY-ESNKSLYS--GVAYNEQIVDSMVYR 246
           ++  K    L  T K+ +L + DG F+++  E+Y    K  +   G+ Y  +++D MV +
Sbjct: 202 QMAIKKKIPLYFTTKNTILKKYDGTFKDIFMEMYLNEYKDEFDKLGIFYEHRLIDDMVAQ 261

Query: 247 LFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPN--IVIGEPCHGSA 300
           + +    F +I   N  GD+ SD  A   GSLGL+ S  + P+      E  HG+ 
Sbjct: 262 MLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFQSEAAHGTV 316

>TPHA0B02210 Chr2 (509945..511246) [1302 bp, 433 aa] {ON} Anc_4.254
           YDL066W
          Length = 433

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 85/173 (49%), Gaps = 19/173 (10%)

Query: 199 LTVTHKSNVLSQSDGLFREVCKEVYES---NKSLYSGVAYNEQIVDSMVYRLFREPECFD 255
           L ++ K+ +L + DG F++V +EV++S   +K     + Y  +++D MV ++ +    + 
Sbjct: 229 LFLSTKNTILKKYDGRFKDVFQEVFDSTYKDKFEALNIKYEHRLIDDMVAQMIKSKGGY- 287

Query: 256 VIVAPNLYGDILSDGAAALVGSLGLVPSANVGPN--IVIGEPCHGSA-----PDIAGKGI 308
           ++   N  GD+ SD  A   GSLGL+ S  V P+      E  HG+          GK  
Sbjct: 288 IMALKNYDGDVQSDIVAQGFGSLGLMTSILVTPDGKTFESEAAHGTVTRHYRQHQQGKQT 347

Query: 309 A-NPIATIRSTAQMLEYLGY--SNP-----AQDIYKAVDANIRDNKIKTADLG 353
           + N IA+I + ++ L   G   + P     AQ + KA    ++++ I T DL 
Sbjct: 348 STNSIASIFAWSRGLAKRGELDNTPDVMKFAQTLEKATLDTVQEDGIMTKDLA 400

>NDAI0D04360 Chr4 (1024297..1025571) [1275 bp, 424 aa] {ON}
           Anc_4.254
          Length = 424

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 72/144 (50%), Gaps = 12/144 (8%)

Query: 161 GSRIAEATKRITETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCK 220
           GS +A A    T+ + +  A ++  +A+ +        L ++ K+ +L + DG F+++ +
Sbjct: 192 GSGVALAMYN-TDESIEGFAHSSFKLAIDK-----KLNLFLSTKNTILKKYDGRFKDIFQ 245

Query: 221 EVYESN---KSLYSGVAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGS 277
            +YE++   K     + Y  +++D MV ++ +    F ++   N  GD+ SD  A   GS
Sbjct: 246 SIYETHYKAKFQQLNINYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGS 304

Query: 278 LGLVPSANVGPN--IVIGEPCHGS 299
           LGL+ S  V P+      E  HG+
Sbjct: 305 LGLMTSILVTPDGKTFESEAAHGT 328

>Ecym_3265 Chr3 (504267..505541) [1275 bp, 424 aa] {ON} similar to
           Ashbya gossypii AER061C
          Length = 424

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 67/133 (50%), Gaps = 11/133 (8%)

Query: 172 TETATKRIAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESN-KSLY 230
           T+ + +  A  +  +AL +        L ++ K+ +L   DG F+++ +E+Y++  K+ +
Sbjct: 198 TDESIRGFAHASFKLALTK-----KLNLFLSTKNTILKTYDGRFKDIFQELYDTQYKTEF 252

Query: 231 --SGVAYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGP 288
              G+ Y  +++D MV ++ +    F ++   N  GD+ SD  A   GSLGL+ S    P
Sbjct: 253 ENHGIYYEHRLIDDMVAQMIKSKGGF-IMALKNYDGDVQSDIVAQGFGSLGLMTSILATP 311

Query: 289 N--IVIGEPCHGS 299
           +      E  HG+
Sbjct: 312 DGKTFESEAAHGT 324

>TPHA0B03660 Chr2 (863280..864548) [1269 bp, 422 aa] {ON} Anc_1.396
           YLR174W
          Length = 422

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 63/128 (49%), Gaps = 15/128 (11%)

Query: 179 IAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVY-----ESNKSLYSGV 233
            A+++ + AL+R        L  T K+ +L + DG F+++ + +Y     E  K+L   +
Sbjct: 203 FARSSFEFALER-----KLPLYSTTKNTILKKYDGQFKDIFESMYKEEYEEKFKAL--NI 255

Query: 234 AYNEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPN--IV 291
            Y  +++D MV ++ +    F +I   N  GD+ SD  A   GSLGL+ S  +  +    
Sbjct: 256 WYEHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLISDDGKTF 314

Query: 292 IGEPCHGS 299
             E  HG+
Sbjct: 315 ESEAAHGT 322

>TBLA0A08010 Chr1 (1981576..1982862) [1287 bp, 428 aa] {ON}
           Anc_4.254 YDL066W
          Length = 428

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 80/168 (47%), Gaps = 25/168 (14%)

Query: 150 KIEKTYTDPKDGSRIAEATKRI-------------TETATKRIAKTALDIALQRLKTKGS 196
           K+E  +T PKD S+  +  K               T+ + +  A ++ ++A+ +     +
Sbjct: 166 KLEMIFT-PKDPSKAKDVYKVYDFKGPGVGMGMYNTDDSIRGFAYSSFNLAVNK-----N 219

Query: 197 ATLTVTHKSNVLSQSDGLFREVCKEVYESN-KSLYS--GVAYNEQIVDSMVYRLFREPEC 253
             L +  K+ +L + DG F+++ +E+YE+  K  +    + Y  +++D MV ++ +    
Sbjct: 220 MNLFLATKNTILKKYDGRFKDIFQEIYENEYKKEFERLNITYEHRLIDDMVAQMIKSKGG 279

Query: 254 FDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPN--IVIGEPCHGS 299
           + ++   N  GD+ SD  A   GSLGL+ S    P+      E  HG+
Sbjct: 280 Y-IMALKNYDGDVQSDIVAQGFGSLGLMTSILASPDGKTFESEAAHGT 326

>NDAI0G05160 Chr7 complement(1250883..1252145) [1263 bp, 420 aa]
           {ON} Anc_1.396
          Length = 420

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 60/127 (47%), Gaps = 11/127 (8%)

Query: 179 IAKTALDIALQRLKTKGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYS---GVAY 235
            A ++  +AL+R        L  T K+ +L + DG F+++ + +YE          G+ Y
Sbjct: 200 FALSSFKLALER-----KMPLYSTTKNTILKRYDGKFKDIFENMYEEQFREQFEELGIWY 254

Query: 236 NEQIVDSMVYRLFREPECFDVIVAPNLYGDILSDGAAALVGSLGLVPSANVGPN--IVIG 293
             +++D MV ++ +    F +I   N  GD+ SD  A   GSLGL+ S  +  +      
Sbjct: 255 EHRLIDDMVAQMLKSKGGF-IIAMKNYDGDVQSDIVAQGFGSLGLMTSVLISSDGKSFES 313

Query: 294 EPCHGSA 300
           E  HG+ 
Sbjct: 314 EAAHGTV 320

>Suva_14.303 Chr14 (547367..547525) [159 bp, 53 aa] {ON} YNL037C
           (REAL)
          Length = 53

 Score = 37.0 bits (84), Expect = 0.004,   Method: Composition-based stats.
 Identities = 20/49 (40%), Positives = 28/49 (57%)

Query: 321 MLEYLGYSNPAQDIYKAVDANIRDNKIKTADLGGDSTTQQVIDDILGKL 369
           ML +LG +  A  I KAV   I + K  T D+GG S+T    ++I+ KL
Sbjct: 2   MLNHLGLNESATRISKAVHETIAEGKHTTRDIGGSSSTTDFTNEIINKL 50

>TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.78
           YAL021C
          Length = 797

 Score = 38.1 bits (87), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 47/110 (42%), Gaps = 13/110 (11%)

Query: 101 VEGYSSPIVQLRKELGLFANVRPVKTVEGTDAKPID--LVIVRENTEDLYIKIEKTYTDP 158
            E Y +P++Q     GLF      KT+   D+K +D   V  REN      + +  Y D 
Sbjct: 521 FEEYWAPLMQKHGYSGLFHAKTRAKTMHSKDSKKVDGCCVFYREN------EFKLAYKDA 574

Query: 159 KDGSRIAEATKRI--TETATKRIA---KTALDIALQRLKTKGSATLTVTH 203
            D S + +  K+   TE    R       A+ + LQ +K+  S  +  TH
Sbjct: 575 VDFSGVWQKHKKFQRTEDYLNRAMNKDNVAIYLKLQHIKSGESVWIVTTH 624

>AFR599W Chr6 (1516363..1517448) [1086 bp, 361 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL055C (PSA1)
          Length = 361

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (64%)

Query: 261 NLYGDILSDGAAALVGSLGLVPSANVGPNIVIGE 294
           N+ G+++ D +A + GS  L P   +GPN+ IGE
Sbjct: 250 NIVGNVIIDPSAKISGSAKLGPDVVIGPNVTIGE 283

>ZYRO0A08162g Chr1 (654330..655148) [819 bp, 272 aa] {ON} similar to
           uniprot|Q07505 Saccharomyces cerevisiae YDL086W
          Length = 272

 Score = 32.0 bits (71), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 35  EVIPAGKQVLQNLNKKHGLAFEFIDLQAGYQTFLDTGAALPRDTVDILKNKCQGALF 91
            V P G+ ++++  +K G+AF F+++ A    F+   ++  R   +I  + C G LF
Sbjct: 192 HVPPEGRDLIRDQLRKSGVAFSFLEVHAAQHAFIRDESSKGRYDAEI-TDSCLGFLF 247

>YPR134W Chr16 (798051..798857) [807 bp, 268 aa] {ON}  MSS18Nuclear
           encoded protein needed for efficient splicing of
           mitochondrial COX1 aI5beta intron; mss18 mutations block
           cleavage of 5' exon - intron junction; phenotype of
           intronless strain suggests additional functions
          Length = 268

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 24/38 (63%)

Query: 100 KVEGYSSPIVQLRKELGLFANVRPVKTVEGTDAKPIDL 137
           KVE + SP +QL+++  L    RPV+ V  T+ + +D+
Sbjct: 131 KVEVHDSPFLQLQRDSNLLFAERPVRYVSTTEGEGVDI 168

>CAGL0M01342g Chr13 (150584..152002) [1419 bp, 472 aa] {ON} similar
           to uniprot|P28795 Saccharomyces cerevisiae YDR329c PAS3
           peroxisomal assembly protein
          Length = 472

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 51/112 (45%), Gaps = 17/112 (15%)

Query: 149 IKIEKTYTDPKDGSRIAEATKRITETATKRIAKTA-----------LDIAL----QRLKT 193
           ++ E  + DPKD   I + ++R+T+    R+ KT            LDI +    Q LK 
Sbjct: 295 VRSEFGHLDPKDALTIDDFSERLTKVYY-RVNKTLFLVNEEKEKPLLDIMIPRTPQELKN 353

Query: 194 KGSATLTVTHKSNVLSQSDGLFREVCKEVYESNKSLYSGVAYNEQIVDSMVY 245
                + +     +L Q D + R++CKE+ +  KS  + +   + I +S  Y
Sbjct: 354 VLEQAMDL-ESLQLLEQDDSILRQLCKEMEKYMKSEATSIVMEQAINESFDY 404

>CAGL0D01034g Chr4 complement(121908..122993) [1086 bp, 361 aa] {ON}
           highly similar to uniprot|P41940 Saccharomyces
           cerevisiae YDL055c PSA1 mannose-1-phosphate
           guanyltransferase
          Length = 361

 Score = 30.0 bits (66), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 21/34 (61%)

Query: 261 NLYGDILSDGAAALVGSLGLVPSANVGPNIVIGE 294
           N+ G+++ D +A +  S  + P   +GPN+ IGE
Sbjct: 250 NIVGNVMVDPSAKIAASAKVGPDVVIGPNVTIGE 283

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.134    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 36,245,018
Number of extensions: 1531918
Number of successful extensions: 3833
Number of sequences better than 10.0: 157
Number of HSP's gapped: 3595
Number of HSP's successfully gapped: 157
Length of query: 369
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 258
Effective length of database: 40,753,473
Effective search space: 10514396034
Effective search space used: 10514396034
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 66 (30.0 bits)