Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0B059302.284ON71771732690.0
TDEL0G021502.284ON66131312901e-169
YIL095W (PRK1)2.284ON81031313031e-168
Smik_9.842.284ON80832112991e-168
Suva_9.1042.284ON80531312941e-167
NCAS0G038102.284ON66132112711e-166
ZYRO0A01848g2.284ON70431312711e-165
Kpol_1003.352.284ON71331312721e-165
Skud_9.782.284ON80931312801e-165
NCAS0B062602.284ON72332312711e-165
KLLA0E08405g2.284ON77731812651e-163
KAFR0H033302.284ON36932212211e-162
ADL217W2.284ON75031512551e-162
Kwal_27.115422.284ON79131312501e-161
NDAI0B035602.284ON75631512471e-161
CAGL0G02607g2.284ON68831312411e-161
SAKL0E07722g2.284ON79131412471e-160
KAFR0J013702.284ON78031412431e-160
TPHA0C033802.284ON69731712261e-159
KLTH0G10318g2.284ON79031312291e-158
NDAI0G006402.284ON62131412041e-156
YNL020C (ARK1)2.284ON63830611951e-155
Skud_14.3092.284ON63932411891e-154
Smik_14.3112.284ON63730611851e-153
Ecym_33232.284ON74831911931e-153
KNAG0H020202.284ON59233511401e-147
Suva_14.3272.284ON63230611401e-146
Kpol_1039.332.284ON70132111101e-141
TBLA0B069402.284ON144332911361e-138
CAGL0J03432g2.284ON62232410791e-137
KNAG0A054302.284ON78832710611e-133
TPHA0D015402.284ON70733110281e-129
Kpol_1052.223.273ON11013178282e-96
KAFR0A010403.273ON9123238096e-95
Kpol_251.43.273ON8383188048e-95
KNAG0J008203.273ON10913228151e-94
CAGL0H10208g3.273ON10273208076e-94
TBLA0E025903.273ON10613178062e-93
SAKL0D03234g3.273ON8583157882e-92
NCAS0A105903.273ON10953207974e-92
Smik_2.1913.273ON11083217881e-90
NDAI0A057003.273ON11573287891e-90
ZYRO0E06864g3.273ON11153197853e-90
TPHA0M011203.273ON7883417684e-90
KLLA0F18612g3.273ON8143107695e-90
Skud_2.1793.273ON10903217801e-89
TDEL0D035203.273ON10493167772e-89
YBR059C (AKL1)3.273ON11083217765e-89
Ecym_26503.273ON8943097657e-89
KNAG0H012203.273ON9133247651e-88
Kwal_27.109453.273ON9353167642e-88
Suva_4.2973.273ON11073197722e-88
KAFR0C004303.273ON9493247652e-88
TBLA0I019303.273ON13613187712e-87
KLTH0C07260g3.273ON9013167501e-86
AGR027C3.273ON9613097503e-86
TPHA0A040303.273ON10543247473e-85
CAGL0K11990g3.273ON9913317443e-85
KNAG0D048107.86ON14402312461e-20
Kwal_56.242746.262ON3463242318e-20
KAFR0A050906.31ON6682862378e-20
SAKL0A03344g6.262ON3643462319e-20
Skud_16.426.262ON3643342319e-20
ZYRO0D05500g7.86ON12621792399e-20
Suva_16.706.262ON3643392301e-19
Kwal_26.71547.86ON12132762381e-19
TPHA0F024306.31ON7982872371e-19
NDAI0H024707.86ON14112562353e-19
KLLA0F07623g7.86ON12292352343e-19
TBLA0E022907.86ON13002342344e-19
YPL236C (ENV7)6.262ON3643222264e-19
KAFR0D012207.86ON10552302334e-19
KNAG0F001701.24ON5432822305e-19
CAGL0F00913g7.86ON12062372325e-19
KLTH0H03080g6.262ON3463322246e-19
TBLA0A047207.86ON12622792318e-19
KLTH0D02486g7.86ON12232312291e-18
Ecym_26407.86ON13252312292e-18
CAGL0M11396g8.279ON11923122282e-18
NCAS0F015807.86ON13822342273e-18
Suva_16.1608.668ON9182042263e-18
CAGL0M02299g8.668ON8932022253e-18
TDEL0H036407.86ON12372352263e-18
NCAS0C016708.668ON8962052245e-18
ABL034W2.479ON14252172238e-18
SAKL0H06754g8.668ON8842892228e-18
Skud_1.447.86ON13562312211e-17
ZYRO0D06776g8.279ON12042232192e-17
KAFR0B028008.279ON10952162182e-17
YAL017W (PSK1)7.86ON13562312192e-17
Smik_1.507.86ON13572312192e-17
TPHA0G016308.668ON8712022173e-17
SAKL0B09856g7.86ON12742762174e-17
KNAG0L005207.86ON3682342104e-17
KAFR0K007007.86ON13812312174e-17
TDEL0A067506.262ON3722712104e-17
TDEL0F040608.279ON11262242164e-17
Skud_16.3403.338ON3882172104e-17
Smik_6.4416.262ON3643332095e-17
NCAS0I004707.86ON10822972165e-17
Smik_13.1596.31ON7052862145e-17
Ecym_21536.262ON3633462095e-17
TBLA0H016605.406ON9962762156e-17
ACR281C7.86ON12592312157e-17
YOL045W (PSK2)7.86ON11011832147e-17
SAKL0H16632g8.279ON10622082147e-17
TPHA0H026307.86ON13672342147e-17
Skud_15.1127.86ON11011832147e-17
Kwal_26.87518.668ON8482032138e-17
CAGL0I07513g3.92ON10761922148e-17
Kpol_1023.266.31ON7392732139e-17
YDR122W (KIN1)8.279ON10642222139e-17
Kpol_1040.207.86ON12972322149e-17
NDAI0C026806.31ON7502762121e-16
Smik_15.1227.86ON11011832121e-16
ZYRO0F07194g8.668ON9382012121e-16
KLLA0E21693g5.406ON10162232121e-16
NCAS0D021006.31ON7262832111e-16
Skud_16.1328.668ON9242862111e-16
Suva_13.1636.31ON7052862111e-16
YMR001C (CDC5)6.31ON7052862102e-16
KNAG0G021108.279ON11922212112e-16
ACL104C5.406ON9472672112e-16
Kwal_56.237178.279ON8582262112e-16
Ecym_42918.279ON11452222112e-16
Skud_13.1546.31ON7052852102e-16
CAGL0H06259g7.86ON13362312112e-16
Kpol_1072.198.668ON8961952102e-16
KLTH0G13288g8.279ON11422262102e-16
ACL006W6.31ON7082762092e-16
Suva_16.3823.338ON3982152053e-16
KLLA0E03587g5.591ON6471972083e-16
Smik_4.3678.279ON10663002093e-16
CAGL0K08514g2.479ON14892322103e-16
Smik_16.2963.338ON3882142043e-16
Kpol_1037.206.31ON7042852083e-16
KLLA0C06138g6.31ON7082882083e-16
NDAI0J012508.279ON11762042093e-16
Skud_4.3838.279ON10653092084e-16
KLTH0D11044g8.668ON8492032084e-16
CAGL0B01925g8.279ON9442162084e-16
Ecym_35863.92ON10771902084e-16
Suva_2.2838.279ON10893002084e-16
Ecym_55055.406ON10032672074e-16
KLTH0F16676g5.406ON8783012075e-16
TDEL0G043806.31ON7222992066e-16
NCAS0B050908.279ON12102232076e-16
KNAG0J016708.668ON10092022066e-16
TPHA0E038501.24ON4822672036e-16
SAKL0E01584g6.31ON6952762056e-16
AGR058W8.279ON10712092067e-16
NDAI0E023908.668ON8832372057e-16
KAFR0G026906.31ON7132972057e-16
NDAI0A085607.86ON13172282068e-16
Smik_12.1558.279ON11622212068e-16
Kwal_55.215455.406ON8652332058e-16
YPL150W8.668ON9012862058e-16
Kwal_56.226933.92ON9841972058e-16
TBLA0C046008.279ON13152222059e-16
Smik_6.3478.668ON9172842059e-16
TBLA0B023103.92ON8191932041e-15
Ecym_30356.31ON7402762031e-15
CAGL0J11638g6.31ON7462772031e-15
TPHA0G032002.479ON15342002041e-15
Ecym_10301.24ON4402771992e-15
Suva_15.1247.86ON11062802032e-15
ACR133C8.668ON8511952022e-15
KLTH0C09548g3.92ON9931972022e-15
NDAI0E012908.654ON7292152022e-15
TDEL0A061408.668ON8611952022e-15
YLR096W (KIN2)8.279ON11472222022e-15
YPR054W (SMK1)3.338ON3882141972e-15
TDEL0D053203.92ON10571912022e-15
Suva_11.1232.479ON15262372022e-15
KNAG0E008506.31ON7112772012e-15
Suva_1.507.86ON13602312013e-15
ZYRO0C07480g6.31ON7742992003e-15
NCAS0C049403.92ON11161882003e-15
KLTH0F00946g1.24ON5121901974e-15
KAFR0C014403.92ON10951901995e-15
KLTH0D10714g8.654ON8722111995e-15
KLLA0F19536g8.279ON11042211995e-15
Kpol_1044.37.86ON9321771985e-15
KLLA0F13552g2.479ON12672111986e-15
Kpol_431.92.479ON15521991986e-15
YDR490C (PKH1)3.92ON7661921977e-15
CAGL0G04609g3.92ON9652931977e-15
Kpol_2002.241.24ON4872741958e-15
Smik_4.7673.92ON7581961968e-15
TPHA0J008208.279ON12182221978e-15
AFR335C3.92ON10332011978e-15
AFR724C1.24ON4402771948e-15
Ecym_73922.479ON14342011978e-15
Skud_12.1648.279ON11602201979e-15
KNAG0D008306.262ON3872701929e-15
TDEL0A027202.496ON9152791961e-14
NDAI0B020708.279ON12583011961e-14
KAFR0H025108.668ON8791561961e-14
TBLA0A035705.406ON9752321951e-14
SAKL0D12628g1.507ON8181751951e-14
SAKL0C09174g3.92ON10711961951e-14
TDEL0C067801.24ON4682831921e-14
TPHA0J004206.31ON7072741941e-14
YKL101W (HSL1)2.479ON15182001952e-14
KLTH0C10912g6.31ON6972871942e-14
SAKL0H07084g8.654ON9192081942e-14
KAFR0D032002.479ON14482321952e-14
Skud_8.1635.406ON10762221942e-14
TPHA0I009201.271ON14342791942e-14
KAFR0B069804.384ON7752851932e-14
CAGL0J03872g8.654ON6612401922e-14
CAGL0L03520g1.271ON14472821932e-14
TDEL0A025502.479ON13692071932e-14
SAKL0G01848g5.406ON8852251923e-14
Suva_15.2975.406ON10741911923e-14
TPHA0H016305.406ON10362511923e-14
Kpol_1031.105.406ON11272261923e-14
Skud_11.1262.479ON15181991933e-14
CAGL0D01694g3.338ON4323211893e-14
TBLA0B039708.654ON12082611914e-14
TBLA0B004906.31ON7872771914e-14
Kpol_1054.23.92ON10962021914e-14
NCAS0A064404.384ON7492831904e-14
YPL141C (FRK1)8.654ON8652081905e-14
KLTH0D05566g2.479ON11282071915e-14
Kwal_26.87098.654ON8292111905e-14
Skud_8.392.496ON9232771905e-14
Kpol_1066.468.279ON12252091905e-14
NCAS0C041008.141ON9053321906e-14
SAKL0C00946g1.24ON5641901886e-14
KNAG0A065402.479ON14322081906e-14
ZYRO0B01166g2.496ON9632881896e-14
Smik_8.422.496ON9392771896e-14
Kwal_26.77882.479ON12672071906e-14
TBLA0B082503.92ON13471921907e-14
YHL007C (STE20)2.496ON9392751897e-14
TBLA0I011502.479ON17452341907e-14
CAGL0L11550g5.406ON10722301897e-14
Suva_15.4114.384ON8152831888e-14
KLLA0B13607g2.496ON9892751898e-14
NDAI0G042903.92ON11131901898e-14
Kwal_33.131121.24ON5051961861e-13
ZYRO0E07876g6.262ON3693341831e-13
Smik_8.2954.384ON8242831871e-13
Ecym_12751.374ON4512971851e-13
Kwal_26.78612.496ON9552791871e-13
SAKL0E02860g2.479ON13771981881e-13
KAFR0D049505.406ON10082591871e-13
ZYRO0C06776g5.591ON8901941871e-13
Kpol_1072.298.654ON8932101871e-13
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0B05930
         (717 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...  1263   0.0  
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...   501   e-169
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...   506   e-168
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...   504   e-168
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...   503   e-167
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...   494   e-166
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...   494   e-165
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....   494   e-165
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...   497   e-165
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...   494   e-165
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...   491   e-163
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...   474   e-162
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...   488   e-162
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...   486   e-161
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...   484   e-161
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...   482   e-161
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...   484   e-160
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...   483   e-160
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...   476   e-159
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...   478   e-158
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284    468   e-156
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...   464   e-155
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...   462   e-154
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...   461   e-153
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...   464   e-153
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...   443   e-147
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...   443   e-146
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...   432   e-141
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...   442   e-138
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...   420   e-137
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...   413   e-133
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...   400   e-129
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...   323   2e-96
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...   316   6e-95
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...   314   8e-95
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...   318   1e-94
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...   315   6e-94
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...   315   2e-93
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...   308   2e-92
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...   311   4e-92
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...   308   1e-90
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...   308   1e-90
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...   306   3e-90
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...   300   4e-90
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...   300   5e-90
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...   305   1e-89
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....   303   2e-89
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...   303   5e-89
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...   299   7e-89
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...   299   1e-88
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...   298   2e-88
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...   301   2e-88
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...   299   2e-88
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...   301   2e-87
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...   293   1e-86
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...   293   3e-86
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....   292   3e-85
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...   291   3e-85
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....    99   1e-20
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    94   8e-20
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}             96   8e-20
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    94   9e-20
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    94   9e-20
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...    97   9e-20
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    93   1e-19
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    96   1e-19
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    96   1e-19
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...    95   3e-19
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...    95   3e-19
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...    95   4e-19
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    92   4e-19
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....    94   4e-19
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...    93   5e-19
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    94   5e-19
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    91   6e-19
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...    94   8e-19
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    93   1e-18
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...    93   2e-18
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...    92   2e-18
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...    92   3e-18
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...    92   3e-18
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...    91   3e-18
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...    92   3e-18
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...    91   5e-18
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...    91   8e-18
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...    90   8e-18
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...    90   1e-17
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...    89   2e-17
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....    89   2e-17
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...    89   2e-17
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...    89   2e-17
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...    88   3e-17
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...    88   4e-17
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    86   4e-17
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    88   4e-17
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    86   4e-17
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....    88   4e-17
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    86   4e-17
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    85   5e-17
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       88   5e-17
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...    87   5e-17
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    85   5e-17
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...    87   6e-17
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...    87   7e-17
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...    87   7e-17
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...    87   7e-17
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...    87   7e-17
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...    87   7e-17
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    87   8e-17
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...    87   8e-17
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....    87   9e-17
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...    87   9e-17
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...    87   9e-17
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...    86   1e-16
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...    86   1e-16
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...    86   1e-16
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...    86   1e-16
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31      86   1e-16
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...    86   1e-16
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...    86   1e-16
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...    86   2e-16
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....    86   2e-16
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...    86   2e-16
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...    86   2e-16
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...    86   2e-16
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...    86   2e-16
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...    86   2e-16
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....    86   2e-16
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...    86   2e-16
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...    85   2e-16
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    84   3e-16
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...    85   3e-16
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...    85   3e-16
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...    86   3e-16
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    83   3e-16
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....    85   3e-16
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...    85   3e-16
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...    85   3e-16
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...    85   4e-16
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...    85   4e-16
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...    85   4e-16
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...    85   4e-16
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...    85   4e-16
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...    84   4e-16
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...    84   5e-16
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...    84   6e-16
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}              84   6e-16
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...    84   6e-16
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    83   6e-16
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...    84   6e-16
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...    84   7e-16
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...    84   7e-16
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...    84   7e-16
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...    84   8e-16
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...    84   8e-16
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...    84   8e-16
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...    84   8e-16
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...    84   8e-16
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...    84   9e-16
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...    84   9e-16
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...    83   1e-15
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...    83   1e-15
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...    83   1e-15
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....    83   1e-15
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...    81   2e-15
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...    83   2e-15
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...    82   2e-15
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...    82   2e-15
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...    82   2e-15
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...    82   2e-15
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...    82   2e-15
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    80   2e-15
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...    82   2e-15
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    82   2e-15
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...    82   2e-15
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...    82   3e-15
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...    82   3e-15
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...    82   3e-15
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...    80   4e-15
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...    81   5e-15
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...    81   5e-15
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...    81   5e-15
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    81   5e-15
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...    81   6e-15
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...    81   6e-15
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...    80   7e-15
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...    80   7e-15
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    80   8e-15
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...    80   8e-15
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...    80   8e-15
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...    80   8e-15
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    79   8e-15
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...    80   8e-15
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...    80   9e-15
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    79   9e-15
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...    80   1e-14
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}              80   1e-14
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...    80   1e-14
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...    80   1e-14
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    80   1e-14
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...    80   1e-14
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    79   1e-14
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...    79   1e-14
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...    80   2e-14
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...    79   2e-14
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...    79   2e-14
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....    80   2e-14
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...    79   2e-14
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....    79   2e-14
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...    79   2e-14
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...    79   2e-14
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...    79   2e-14
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....    79   2e-14
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...    79   3e-14
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...    79   3e-14
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....    79   3e-14
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...    79   3e-14
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...    79   3e-14
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    77   3e-14
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...    78   4e-14
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...    78   4e-14
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...    78   4e-14
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...    78   4e-14
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...    78   5e-14
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...    78   5e-14
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...    78   5e-14
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...    78   5e-14
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...    78   5e-14
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141     78   6e-14
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    77   6e-14
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...    78   6e-14
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...    77   6e-14
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...    77   6e-14
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...    78   6e-14
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    78   7e-14
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...    77   7e-14
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...    78   7e-14
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...    77   7e-14
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...    77   8e-14
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...    77   8e-14
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...    77   8e-14
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...    76   1e-13
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    75   1e-13
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...    77   1e-13
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...    76   1e-13
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...    77   1e-13
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...    77   1e-13
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....    77   1e-13
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...    77   1e-13
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...    77   1e-13
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...    77   1e-13
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...    77   1e-13
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...    76   1e-13
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...    76   1e-13
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    75   1e-13
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...    76   2e-13
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...    76   2e-13
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...    76   2e-13
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...    76   2e-13
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...    76   2e-13
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...    76   2e-13
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    75   2e-13
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....    76   2e-13
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    75   2e-13
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...    76   2e-13
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...    75   3e-13
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...    75   3e-13
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...    75   3e-13
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        75   3e-13
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...    75   3e-13
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...    75   3e-13
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....    75   3e-13
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...    75   3e-13
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...    75   3e-13
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...    75   4e-13
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...    75   4e-13
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...    75   4e-13
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...    75   4e-13
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...    75   4e-13
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...    75   4e-13
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...    75   4e-13
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...    74   5e-13
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...    75   5e-13
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    74   5e-13
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...    74   5e-13
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...    75   5e-13
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...    75   5e-13
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...    74   5e-13
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    74   5e-13
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...    74   5e-13
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...    74   6e-13
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...    75   6e-13
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...    74   6e-13
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...    75   6e-13
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...    74   6e-13
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...    74   7e-13
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384     74   7e-13
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...    74   7e-13
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...    74   7e-13
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...    74   7e-13
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...    74   7e-13
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...    74   7e-13
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...    74   8e-13
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...    74   8e-13
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...    74   8e-13
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...    74   8e-13
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    73   8e-13
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...    74   9e-13
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    73   9e-13
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    73   9e-13
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...    74   9e-13
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    73   1e-12
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...    74   1e-12
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    72   1e-12
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    73   1e-12
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...    73   1e-12
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...    74   1e-12
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....    73   1e-12
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...    74   1e-12
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...    74   1e-12
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}               73   1e-12
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...    73   1e-12
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    72   1e-12
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...    73   1e-12
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    72   1e-12
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...    73   1e-12
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...    73   2e-12
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...    73   2e-12
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...    73   2e-12
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    72   2e-12
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...    73   2e-12
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...    73   2e-12
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...    72   2e-12
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...    72   2e-12
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...    72   2e-12
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...    71   3e-12
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...    71   3e-12
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...    72   3e-12
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    71   3e-12
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...    72   3e-12
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141     72   3e-12
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...    72   3e-12
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...    71   3e-12
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...    72   3e-12
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496     72   3e-12
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654     72   3e-12
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    71   3e-12
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...    72   3e-12
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....    72   4e-12
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...    72   4e-12
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...    72   4e-12
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...    72   4e-12
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...    72   4e-12
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...    72   4e-12
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...    72   4e-12
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...    71   4e-12
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    70   5e-12
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654     71   5e-12
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...    70   5e-12
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...    70   6e-12
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...    71   6e-12
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    70   7e-12
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...    71   7e-12
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...    70   8e-12
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    70   8e-12
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    70   9e-12
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...    71   9e-12
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...    70   9e-12
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...    71   9e-12
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...    70   9e-12
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...    69   9e-12
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...    70   9e-12
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...    70   9e-12
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    70   1e-11
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    69   1e-11
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...    70   1e-11
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...    70   1e-11
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...    69   1e-11
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...    70   1e-11
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...    70   1e-11
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    70   1e-11
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...    70   1e-11
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...    70   1e-11
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    70   1e-11
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...    70   1e-11
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...    70   1e-11
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...    70   1e-11
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...    70   1e-11
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....    70   1e-11
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    69   1e-11
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...    70   1e-11
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...    70   2e-11
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...    69   2e-11
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52     70   2e-11
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...    70   2e-11
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...    69   2e-11
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    69   2e-11
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...    70   2e-11
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...    69   2e-11
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...    70   2e-11
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...    69   2e-11
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...    70   2e-11
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...    69   2e-11
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    69   2e-11
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    69   2e-11
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...    69   2e-11
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...    69   2e-11
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...    70   2e-11
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...    69   2e-11
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...    69   2e-11
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...    70   2e-11
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    69   2e-11
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...    69   2e-11
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    69   2e-11
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...    69   3e-11
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...    69   3e-11
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...    69   3e-11
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    68   3e-11
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...    69   3e-11
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...    69   3e-11
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...    68   3e-11
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...    69   3e-11
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....    69   3e-11
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    69   3e-11
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...    69   3e-11
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    69   4e-11
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...    69   4e-11
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...    69   4e-11
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...    68   4e-11
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    67   4e-11
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    69   4e-11
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    67   4e-11
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    69   4e-11
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    69   4e-11
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}               69   4e-11
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...    68   4e-11
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...    69   4e-11
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    68   4e-11
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...    68   4e-11
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...    69   5e-11
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    68   5e-11
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...    68   5e-11
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...    68   5e-11
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...    68   5e-11
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...    68   5e-11
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...    66   5e-11
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...    68   6e-11
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...    68   6e-11
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...    68   6e-11
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...    68   6e-11
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...    68   6e-11
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...    67   7e-11
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...    68   7e-11
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    67   7e-11
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....    67   7e-11
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....    67   7e-11
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...    67   8e-11
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    67   8e-11
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...    67   8e-11
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...    68   8e-11
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    67   8e-11
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    68   8e-11
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    67   8e-11
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...    67   8e-11
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...    68   8e-11
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...    67   8e-11
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    67   8e-11
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}               67   8e-11
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...    67   8e-11
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    67   8e-11
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...    67   8e-11
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...    67   9e-11
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    67   9e-11
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....    67   9e-11
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...    67   9e-11
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...    67   9e-11
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...    67   1e-10
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...    66   1e-10
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...    66   1e-10
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...    67   1e-10
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...    66   1e-10
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    66   1e-10
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...    66   1e-10
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...    67   1e-10
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...    67   1e-10
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...    67   1e-10
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...    67   1e-10
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192     65   1e-10
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...    67   1e-10
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...    67   1e-10
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...    67   1e-10
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    66   1e-10
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...    66   1e-10
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...    65   1e-10
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    67   1e-10
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    67   1e-10
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...    66   1e-10
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...    66   2e-10
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...    66   2e-10
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...    67   2e-10
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...    66   2e-10
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    66   2e-10
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...    67   2e-10
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...    66   2e-10
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...    66   2e-10
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...    66   2e-10
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...    66   2e-10
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    66   2e-10
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...    66   2e-10
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...    66   2e-10
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    66   2e-10
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...    65   2e-10
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...    66   2e-10
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    65   2e-10
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...    66   2e-10
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...    66   2e-10
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...    65   2e-10
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    66   2e-10
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...    66   2e-10
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...    65   2e-10
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446     65   3e-10
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    65   3e-10
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...    66   3e-10
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    65   3e-10
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...    66   3e-10
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...    65   3e-10
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...    65   3e-10
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    65   3e-10
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...    64   3e-10
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...    65   3e-10
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    64   3e-10
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...    65   4e-10
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...    65   4e-10
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...    65   4e-10
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...    65   4e-10
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...    65   4e-10
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141     64   4e-10
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     65   4e-10
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...    64   4e-10
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    65   4e-10
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...    64   4e-10
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    65   4e-10
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...    65   4e-10
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...    65   4e-10
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...    65   5e-10
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    65   5e-10
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    64   5e-10
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...    65   5e-10
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...    65   5e-10
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    64   5e-10
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    65   5e-10
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...    64   5e-10
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...    65   6e-10
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...    64   6e-10
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    65   6e-10
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...    65   6e-10
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    65   6e-10
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    64   6e-10
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...    64   6e-10
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...    65   7e-10
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    64   7e-10
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...    64   7e-10
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...    64   7e-10
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    64   7e-10
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...    64   7e-10
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    64   7e-10
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    64   7e-10
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...    64   7e-10
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...    64   7e-10
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    65   7e-10
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...    64   8e-10
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...    64   8e-10
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    64   8e-10
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)    64   8e-10
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...    64   8e-10
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    64   8e-10
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...    64   8e-10
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...    64   8e-10
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...    63   9e-10
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...    64   9e-10
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    64   9e-10
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...    64   9e-10
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    64   1e-09
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    64   1e-09
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....    64   1e-09
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...    63   1e-09
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...    63   1e-09
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...    64   1e-09
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    64   1e-09
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}              64   1e-09
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    64   1e-09
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    64   1e-09
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...    64   1e-09
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...    63   1e-09
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...    63   1e-09
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...    64   1e-09
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...    64   1e-09
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...    63   1e-09
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...    63   1e-09
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...    64   1e-09
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...    64   1e-09
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...    63   1e-09
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    64   1e-09
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...    63   1e-09
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    62   1e-09
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...    63   1e-09
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...    64   1e-09
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...    63   1e-09
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    64   1e-09
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...    62   1e-09
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....    63   1e-09
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...    64   1e-09
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...    62   1e-09
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    62   1e-09
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...    64   1e-09
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    63   1e-09
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    63   1e-09
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...    64   2e-09
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}               63   2e-09
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    63   2e-09
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    63   2e-09
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    63   2e-09
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...    63   2e-09
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    63   2e-09
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...    63   2e-09
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...    62   2e-09
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...    63   2e-09
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...    63   2e-09
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...    63   2e-09
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...    63   2e-09
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    62   2e-09
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...    63   2e-09
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    63   2e-09
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    63   2e-09
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...    63   2e-09
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...    62   2e-09
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    62   2e-09
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    62   2e-09
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...    63   2e-09
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    63   2e-09
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    62   2e-09
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...    62   2e-09
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...    63   2e-09
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    63   2e-09
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    63   2e-09
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....    62   2e-09
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...    62   2e-09
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...    63   2e-09
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    62   2e-09
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...    62   2e-09
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    63   2e-09
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...    62   2e-09
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}              62   3e-09
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...    63   3e-09
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...    62   3e-09
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    62   3e-09
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...    62   3e-09
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...    61   3e-09
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...    62   3e-09
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    62   3e-09
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...    62   3e-09
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    62   3e-09
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...    62   3e-09
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...    62   3e-09
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    62   3e-09
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182       62   3e-09
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    62   3e-09
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    62   3e-09
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...    62   3e-09
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    62   3e-09
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    62   3e-09
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    62   3e-09
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...    62   3e-09
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...    62   3e-09
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    62   4e-09
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    62   4e-09
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    61   4e-09
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...    62   4e-09
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    62   4e-09
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...    62   4e-09
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...    62   4e-09
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...    62   4e-09
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...    62   4e-09
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...    62   4e-09
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...    62   4e-09
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...    61   4e-09
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...    61   4e-09
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...    62   4e-09
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    62   4e-09
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...    62   4e-09
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    62   4e-09
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...    62   5e-09
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    62   5e-09
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...    62   5e-09
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...    61   5e-09
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               62   5e-09
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...    62   5e-09
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...    62   5e-09
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...    61   5e-09
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...    61   5e-09
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...    62   5e-09
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    62   5e-09
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     62   5e-09
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    61   5e-09
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...    62   5e-09
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...    62   5e-09
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    61   6e-09
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...    62   6e-09
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    62   6e-09
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    62   6e-09
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}               61   6e-09
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...    61   6e-09
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...    61   6e-09
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    62   6e-09
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    61   6e-09
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    60   6e-09
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...    61   6e-09
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    61   6e-09
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...    61   6e-09
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...    60   6e-09
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     61   6e-09
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    62   6e-09
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    61   7e-09
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...    61   7e-09
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...    62   7e-09
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...    61   7e-09
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...    61   7e-09
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    61   7e-09
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    61   7e-09
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...    61   7e-09
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...    61   7e-09
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...    61   7e-09
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...    60   7e-09
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    60   7e-09
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    60   8e-09
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    61   8e-09
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    61   8e-09
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     61   8e-09
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    61   8e-09
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...    61   8e-09
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...    61   8e-09
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...    60   8e-09
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...    60   8e-09
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...    61   9e-09
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...    60   9e-09
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...    61   9e-09
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....    61   9e-09
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...    61   9e-09
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...    60   9e-09
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    60   9e-09
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...    61   1e-08
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...    60   1e-08
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...    60   1e-08
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...    60   1e-08
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...    60   1e-08
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...    60   1e-08
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    60   1e-08
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    60   1e-08
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...    60   1e-08
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...    60   1e-08
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              60   1e-08
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    60   1e-08
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...    60   1e-08
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    60   1e-08
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...    60   1e-08
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...    60   1e-08
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...    60   1e-08
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...    60   1e-08
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    60   1e-08
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...    60   1e-08
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...    60   1e-08
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...    60   1e-08
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...    60   1e-08
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...    60   1e-08
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    60   1e-08
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    60   1e-08
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    60   1e-08
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    60   1e-08
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...    60   1e-08
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...    60   2e-08
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    60   2e-08
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...    60   2e-08
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...    59   2e-08
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...    60   2e-08
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...    60   2e-08
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...    60   2e-08
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    60   2e-08
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...    59   2e-08
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    60   2e-08
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...    59   2e-08
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    60   2e-08
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...    59   2e-08
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...    59   2e-08
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     59   2e-08
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...    60   2e-08
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    60   2e-08
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    60   2e-08
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    60   2e-08
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...    59   2e-08
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...    59   2e-08
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...    59   2e-08
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    59   2e-08
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    59   2e-08
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     60   2e-08
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341      60   2e-08
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       60   2e-08
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192     59   2e-08
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    60   2e-08
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    60   2e-08
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    60   2e-08
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....    60   2e-08
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    59   2e-08
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    59   2e-08
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...    59   2e-08
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...    59   2e-08
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...    59   2e-08
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...    59   2e-08
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}               59   2e-08
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...    60   2e-08
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...    59   2e-08
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    59   2e-08
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...    60   2e-08
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...    59   2e-08
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    60   2e-08
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...    59   2e-08
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...    60   2e-08
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}               59   2e-08
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...    60   2e-08
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    59   3e-08
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...    58   3e-08
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    59   3e-08
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...    59   3e-08
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...    59   3e-08
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...    59   3e-08
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...    58   3e-08
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...    59   3e-08
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    59   3e-08
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    59   3e-08
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    59   3e-08
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    59   3e-08
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    59   3e-08
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    59   3e-08
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...    58   3e-08
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    59   3e-08
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    59   3e-08
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    59   3e-08
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    59   3e-08
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...    59   3e-08
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...    59   3e-08
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...    58   3e-08
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    59   3e-08
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...    58   3e-08
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...    59   4e-08
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...    59   4e-08
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    59   4e-08
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...    58   4e-08
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             59   4e-08
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    59   4e-08
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    59   4e-08
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...    59   4e-08
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...    59   4e-08
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    59   4e-08
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    59   4e-08
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...    58   4e-08
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    58   5e-08
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    59   5e-08
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    58   5e-08
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    59   5e-08
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...    57   5e-08
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    59   5e-08
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    58   5e-08
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    59   5e-08
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    58   5e-08
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...    58   5e-08
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    58   5e-08
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    59   5e-08
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    57   5e-08
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    58   6e-08
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    58   6e-08
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    58   6e-08
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    58   6e-08
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    58   6e-08
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    58   6e-08
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...    58   6e-08
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    58   6e-08
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...    59   6e-08
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...    58   6e-08
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....    58   6e-08
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    58   6e-08
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....    58   6e-08
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...    58   6e-08
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    58   6e-08
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...    58   6e-08
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...    58   6e-08
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...    57   7e-08
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    58   7e-08
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    58   7e-08
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    58   7e-08
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    57   7e-08
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    58   7e-08
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    57   8e-08
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...    58   8e-08
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    57   8e-08
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    57   8e-08
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...    57   8e-08
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              58   8e-08
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...    57   8e-08
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     57   8e-08
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    57   8e-08
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...    57   9e-08
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    58   9e-08
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    58   9e-08
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...    57   9e-08
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    57   9e-08
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    57   9e-08
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...    58   9e-08
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...    57   9e-08
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    57   9e-08
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...    57   9e-08
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    57   9e-08
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    57   1e-07
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...    57   1e-07
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    57   1e-07
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214     57   1e-07
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...    57   1e-07
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...    57   1e-07
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    57   1e-07
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...    57   1e-07
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}               57   1e-07
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    57   1e-07
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    57   1e-07
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    57   1e-07
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...    57   1e-07
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    57   1e-07
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...    57   1e-07
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...    57   1e-07
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...    57   1e-07
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...    57   1e-07
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    56   1e-07
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...    57   1e-07
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...    57   1e-07
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    57   1e-07
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    57   1e-07
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...    57   1e-07
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...    57   1e-07
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    57   1e-07
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    56   1e-07
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...    56   2e-07
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...    57   2e-07
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162     57   2e-07
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...    56   2e-07
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...    57   2e-07
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...    56   2e-07
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    57   2e-07
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...    57   2e-07
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    57   2e-07
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...    57   2e-07
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...    57   2e-07
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    57   2e-07
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    57   2e-07
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    56   2e-07
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    57   2e-07
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...    56   2e-07
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...    56   2e-07
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    56   2e-07
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...    56   2e-07
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    57   2e-07
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    55   2e-07
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    56   2e-07
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    56   2e-07
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    56   2e-07
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    56   2e-07
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...    56   2e-07
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    56   2e-07
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...    56   2e-07
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...    55   2e-07
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    55   2e-07
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    56   2e-07
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    56   2e-07
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    56   2e-07
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    56   2e-07
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    56   2e-07
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    56   3e-07
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    56   3e-07
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    56   3e-07
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    56   3e-07
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    56   3e-07
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    55   3e-07
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    56   3e-07
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...    56   3e-07
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    56   3e-07
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    56   3e-07
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    55   3e-07
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...    55   3e-07
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    56   3e-07
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    56   3e-07
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    56   3e-07
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    55   3e-07
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    56   3e-07
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...    56   3e-07
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               56   3e-07
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...    56   3e-07
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    55   3e-07
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    56   3e-07
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    56   3e-07
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    56   3e-07
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...    55   3e-07
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...    56   3e-07
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    56   3e-07
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...    56   3e-07
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    55   3e-07
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    55   3e-07
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    55   4e-07
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...    55   4e-07
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    55   4e-07
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    55   4e-07
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    55   4e-07
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    55   4e-07
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    55   4e-07
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    55   4e-07
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    55   4e-07
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    55   4e-07
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...    55   4e-07
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    55   4e-07
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...    55   4e-07
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    55   4e-07
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    56   4e-07
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    55   4e-07
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    55   4e-07
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...    55   4e-07
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...    55   4e-07
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...    55   4e-07
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    55   4e-07
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    55   4e-07
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    55   4e-07
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    55   4e-07
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    55   4e-07
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...    55   5e-07
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    55   5e-07
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    55   5e-07
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    54   5e-07
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    55   5e-07
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    55   5e-07
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...    54   5e-07
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    55   5e-07
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    55   6e-07
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...    55   6e-07
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    55   6e-07
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    55   6e-07
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    55   6e-07
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    55   6e-07
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...    55   6e-07
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    55   6e-07
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...    55   6e-07
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...    55   6e-07
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               55   6e-07
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    54   6e-07
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    55   6e-07
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    55   7e-07
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    55   7e-07
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    55   7e-07
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    54   7e-07
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     54   7e-07
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    55   7e-07
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...    54   7e-07
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    55   7e-07
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    55   7e-07
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    55   7e-07
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...    54   7e-07
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...    55   7e-07
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...    54   8e-07
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    54   8e-07
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    55   8e-07
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....    54   8e-07
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    54   8e-07
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    54   8e-07
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    54   8e-07
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...    54   9e-07
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    54   9e-07
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....    55   9e-07
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    54   9e-07
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...    54   9e-07
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    54   9e-07
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    54   9e-07
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    54   1e-06
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...    54   1e-06
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...    54   1e-06
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}               54   1e-06
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    54   1e-06
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    54   1e-06
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    54   1e-06
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...    54   1e-06
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...    54   1e-06
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...    54   1e-06
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    54   1e-06
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...    54   1e-06
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    54   1e-06
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    54   1e-06
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...    54   1e-06
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    54   1e-06
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}               54   1e-06
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    54   1e-06
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     54   1e-06
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    54   1e-06
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    54   1e-06
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    54   1e-06
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    54   1e-06
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    53   1e-06
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    54   1e-06
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    54   1e-06
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    53   1e-06
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    54   1e-06
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}              54   1e-06
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    53   1e-06
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    54   1e-06
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    54   1e-06
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...    54   1e-06
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...    54   2e-06
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    53   2e-06
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    54   2e-06
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    54   2e-06
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    54   2e-06
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    54   2e-06
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    53   2e-06
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....    54   2e-06
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              53   2e-06
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    54   2e-06
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...    54   2e-06
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    53   2e-06
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...    54   2e-06
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...    53   2e-06
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    53   2e-06
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    53   2e-06
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    53   2e-06
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....    53   2e-06
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    53   2e-06
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...    53   2e-06
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...    53   2e-06
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    52   2e-06
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...    53   2e-06
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    53   2e-06
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    53   2e-06
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...    53   2e-06
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...    53   2e-06
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    53   2e-06
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...    53   2e-06
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...    52   2e-06
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    52   2e-06
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    52   2e-06
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    53   2e-06
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    53   2e-06
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              52   2e-06
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...    53   2e-06
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...    52   2e-06
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    52   3e-06
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    52   3e-06
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    52   3e-06
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    53   3e-06
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    52   3e-06
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    53   3e-06
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    52   3e-06
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    52   3e-06
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    53   3e-06
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...    53   3e-06
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    52   3e-06
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    52   3e-06
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    52   3e-06
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    52   3e-06
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    53   3e-06
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...    52   3e-06
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    52   3e-06
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    52   3e-06
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    52   3e-06
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...    52   3e-06
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    52   3e-06
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    52   3e-06
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...    52   3e-06
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     52   3e-06
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    52   4e-06
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    52   4e-06
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    52   4e-06
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    52   4e-06
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    51   4e-06
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      52   4e-06
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    52   4e-06
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    51   4e-06
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    51   4e-06
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...    52   4e-06
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    52   4e-06
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    52   4e-06
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    52   4e-06
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    52   4e-06
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    52   4e-06
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    50   4e-06
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...    52   4e-06
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    52   4e-06
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...    52   5e-06
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    51   5e-06
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    52   5e-06
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...    52   5e-06
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    52   5e-06
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    51   5e-06
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    52   5e-06
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    52   5e-06
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    51   5e-06
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...    51   5e-06
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    52   5e-06
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    52   5e-06
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...    51   6e-06
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    52   6e-06
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    52   6e-06
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...    51   6e-06
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    51   6e-06
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    51   6e-06
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    51   6e-06
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    50   6e-06
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    51   6e-06
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...    52   6e-06
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...    51   6e-06
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...    51   6e-06
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    51   6e-06
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    51   6e-06
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...    51   6e-06
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    51   7e-06
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    52   7e-06
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    51   7e-06
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...    51   7e-06
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    50   7e-06
NDAI0F03150 Chr6 complement(757283..758923) [1641 bp, 546 aa] {O...    51   7e-06
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...    51   7e-06
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    51   7e-06
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    51   7e-06
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    51   7e-06
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...    51   7e-06
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    50   7e-06
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    51   8e-06
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    50   8e-06
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    51   8e-06
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    52   8e-06
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...    51   8e-06
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    51   8e-06
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...    51   8e-06
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    51   8e-06
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...    51   9e-06
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    51   9e-06
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    51   9e-06
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...    51   9e-06
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...    51   9e-06
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    50   9e-06
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    51   1e-05
CAGL0G06138g Chr7 complement(585585..587204) [1620 bp, 539 aa] {...    51   1e-05
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...    51   1e-05
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    51   1e-05
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    51   1e-05
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    50   1e-05
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    50   1e-05
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...    50   1e-05
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    50   1e-05
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    50   1e-05
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...    50   1e-05
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    50   1e-05
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    50   1e-05
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    49   1e-05
Suva_15.332 Chr15 complement(575263..575547,575959..576084,57614...    50   1e-05
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              49   1e-05
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    50   1e-05
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    49   1e-05
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    49   1e-05
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     50   1e-05
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    49   1e-05
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...    50   1e-05
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...    50   2e-05
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    50   2e-05
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...    50   2e-05
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    49   2e-05
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    50   2e-05
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...    50   2e-05
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    50   2e-05
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...    50   2e-05
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    50   2e-05
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    50   2e-05
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...    50   2e-05
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...    50   2e-05
Kpol_1027.20 s1027 complement(43412..44974) [1563 bp, 520 aa] {O...    50   2e-05
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    49   2e-05
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    49   2e-05
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    50   2e-05
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...    50   2e-05
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    49   2e-05
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    50   2e-05
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    49   2e-05
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    50   2e-05
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...    49   2e-05
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    50   2e-05
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    49   2e-05
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    50   2e-05
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    50   2e-05
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....    50   2e-05
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...    50   2e-05
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    50   2e-05
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    49   2e-05
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    50   2e-05
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    49   2e-05
Smik_8.216 Chr8 complement(349478..351145) [1668 bp, 555 aa] {ON...    49   2e-05
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...    50   2e-05
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...    49   2e-05
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    49   3e-05
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    49   3e-05
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...    49   3e-05
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    49   3e-05
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    49   3e-05
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...    49   3e-05
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    50   3e-05
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    49   3e-05
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    49   3e-05
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    49   3e-05
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...    49   3e-05
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    49   3e-05
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    49   3e-05
YHR135C Chr8 complement(372694..374310) [1617 bp, 538 aa] {ON}  ...    49   3e-05
NDAI0B04530 Chr2 complement(1128472..1130094) [1623 bp, 540 aa] ...    49   3e-05
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    49   3e-05
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...    49   3e-05
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      49   3e-05
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    49   3e-05
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...    49   3e-05
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...    49   3e-05
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    49   3e-05
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    49   3e-05
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...    49   3e-05
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    49   3e-05
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...    49   3e-05
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    48   3e-05
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    49   4e-05
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...    49   4e-05
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    48   4e-05
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    49   4e-05
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...    49   4e-05
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...    49   4e-05
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...    49   4e-05
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...    49   4e-05
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...    49   4e-05
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    48   4e-05
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    49   4e-05
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    48   4e-05
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    48   4e-05
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    48   4e-05
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    48   4e-05
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    48   4e-05
NCAS0B07200 Chr2 complement(1363351..1364940) [1590 bp, 529 aa] ...    49   4e-05
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    48   4e-05
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    48   5e-05
KNAG0I01360 Chr9 complement(262712..264556) [1845 bp, 614 aa] {O...    49   5e-05
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...    49   5e-05
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    49   5e-05
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...    49   5e-05
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    48   5e-05
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    49   5e-05
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    48   5e-05
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    49   5e-05
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    49   5e-05
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    48   5e-05
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    48   5e-05
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    49   5e-05
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    48   5e-05
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    48   6e-05
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    47   6e-05
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...    48   6e-05
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    48   6e-05
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...    48   7e-05
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    48   7e-05
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    47   7e-05
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    48   7e-05
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    47   7e-05
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    48   7e-05
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...    48   7e-05
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    48   7e-05
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...    48   7e-05
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    47   7e-05
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    47   8e-05
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...    48   8e-05
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    48   8e-05
TDEL0F00910 Chr6 (157379..159070) [1692 bp, 563 aa] {ON} Anc_2.1...    48   8e-05
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    48   8e-05
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...    48   8e-05
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...    48   8e-05
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...    48   8e-05
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    48   8e-05
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     48   8e-05
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    47   8e-05
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    48   8e-05
Skud_8.196 Chr8 complement(346056..346463,346494..347684) [1599 ...    48   8e-05
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...    48   8e-05
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    47   9e-05
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    48   9e-05
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    47   9e-05
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    48   9e-05
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    47   9e-05
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    48   9e-05
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     48   9e-05
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    48   9e-05
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    47   9e-05
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    47   1e-04
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    48   1e-04
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...    47   1e-04
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    48   1e-04
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    47   1e-04
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...    47   1e-04
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    48   1e-04
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    47   1e-04
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    47   1e-04
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...    47   1e-04
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    47   1e-04
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    47   1e-04
Skud_14.179 Chr14 complement(334239..335924) [1686 bp, 561 aa] {...    47   1e-04
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    47   1e-04
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                 47   1e-04
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    47   1e-04
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    47   1e-04
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    47   1e-04
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    46   1e-04
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    47   1e-04
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    47   1e-04
Suva_14.185 Chr14 complement(340104..341789) [1686 bp, 561 aa] {...    47   1e-04
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    46   2e-04
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    47   2e-04
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    47   2e-04
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...    47   2e-04
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    47   2e-04
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    47   2e-04
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    47   2e-04
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    47   2e-04
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    47   2e-04
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    47   2e-04
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    46   2e-04
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    46   2e-04
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...    47   2e-04
Smik_14.174 Chr14 complement(323054..324709) [1656 bp, 551 aa] {...    47   2e-04
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...    47   2e-04
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...    47   2e-04
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...    47   2e-04
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...    47   2e-04
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    46   2e-04
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    47   2e-04
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...    47   2e-04
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    47   2e-04
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    46   2e-04
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              47   2e-04
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...    46   2e-04
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    46   2e-04
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...    47   2e-04
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...    47   2e-04
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...    46   2e-04
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    46   2e-04
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    47   2e-04
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    46   2e-04
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    46   2e-04
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    46   3e-04
KAFR0A07320 Chr1 complement(1478564..1480033) [1470 bp, 489 aa] ...    46   3e-04
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    45   3e-04
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    46   3e-04
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    46   3e-04
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    46   3e-04
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    46   3e-04
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    46   3e-04
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    45   3e-04
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    46   3e-04
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    46   3e-04
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    46   3e-04
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    46   3e-04
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    46   3e-04
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...    45   3e-04
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    46   3e-04
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    46   3e-04
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    46   3e-04
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    45   3e-04
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    46   3e-04
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...    46   4e-04
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...    46   4e-04
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...    46   4e-04
KNAG0F01490 Chr6 (270931..272604) [1674 bp, 557 aa] {ON} Anc_2.1...    46   4e-04
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    46   4e-04
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    46   4e-04
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    45   4e-04
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    46   4e-04
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    45   4e-04
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...    45   4e-04
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...    45   4e-04
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    46   4e-04
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...    46   4e-04
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    46   4e-04
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    45   4e-04
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    45   4e-04
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...    45   5e-04
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    45   5e-04
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    45   5e-04
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    45   5e-04
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    45   5e-04
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...    45   5e-04
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    45   5e-04
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    45   5e-04
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    45   5e-04
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...    45   5e-04
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...    45   5e-04
Skud_15.228 Chr15 (403382..404401) [1020 bp, 339 aa] {ON} YOR061...    45   6e-04
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    45   6e-04
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    45   6e-04
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    45   6e-04
TBLA0D00250 Chr4 (61918..63618) [1701 bp, 566 aa] {ON} Anc_2.105...    45   6e-04
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    45   6e-04
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    44   6e-04
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    45   6e-04
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    44   6e-04
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    44   7e-04
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    45   7e-04
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...    45   7e-04
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    45   7e-04
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    45   7e-04
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...    45   7e-04
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      45   7e-04
YNL154C Chr14 complement(343636..345276) [1641 bp, 546 aa] {ON} ...    45   7e-04
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    44   7e-04
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    45   7e-04
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...    45   7e-04
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    45   8e-04
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    45   8e-04
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    45   8e-04
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    45   8e-04
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    45   8e-04
TPHA0H01300 Chr8 (293254..294282) [1029 bp, 342 aa] {ON} Anc_5.6...    44   8e-04
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    44   8e-04
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...    45   8e-04
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    44   8e-04
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...    45   9e-04
YOR061W Chr15 (441534..442553) [1020 bp, 339 aa] {ON}  CKA2Alpha...    44   9e-04
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    44   9e-04
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    44   0.001
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...    45   0.001
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...    44   0.001
Suva_8.111 Chr8 (204414..205433) [1020 bp, 339 aa] {ON} YOR061W ...    44   0.001
SAKL0G00990g Chr7 complement(89700..90824) [1125 bp, 374 aa] {ON...    44   0.001
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    44   0.001
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    45   0.001
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    44   0.001
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    44   0.001
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...    44   0.001
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    44   0.001
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    44   0.001
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...    44   0.001
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...    44   0.001
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    44   0.001
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    44   0.001
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...    44   0.001
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    44   0.001
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    44   0.001
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    44   0.001
KNAG0H03710 Chr8 complement(687550..689184) [1635 bp, 544 aa] {O...    44   0.001
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    43   0.001
ZYRO0A08448g Chr1 complement(677122..678225) [1104 bp, 367 aa] {...    44   0.001
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...    44   0.001
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    44   0.001
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...    43   0.001
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    44   0.001
Smik_15.241 Chr15 (407598..408617) [1020 bp, 339 aa] {ON} YOR061...    43   0.001
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    44   0.001
CAGL0J05940g Chr10 (562687..564147) [1461 bp, 486 aa] {ON} simil...    44   0.002
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    44   0.002
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    44   0.002
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    43   0.002
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    44   0.002
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...    44   0.002
TPHA0I01240 Chr9 (283537..285210) [1674 bp, 557 aa] {ON} Anc_2.1...    44   0.002
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    44   0.002
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    44   0.002
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    44   0.002
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...    43   0.002
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    44   0.002
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    44   0.002
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...    43   0.002
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    44   0.002
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    43   0.002
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...    41   0.002
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    43   0.002
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    43   0.002
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    43   0.002
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    43   0.002
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...    43   0.002
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    43   0.002
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    43   0.002
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    43   0.002
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    43   0.002
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    43   0.002
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...    42   0.002
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     43   0.002
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    44   0.002
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    42   0.002
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    43   0.002
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    42   0.002
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    43   0.003
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    43   0.003
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    43   0.003
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    43   0.003
SAKL0E12100g Chr5 complement(1004036..1005622) [1587 bp, 528 aa]...    43   0.003
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    43   0.003
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    43   0.003
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    43   0.003
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...    43   0.003
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    42   0.003
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    43   0.003
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    43   0.003
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    43   0.003
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    43   0.003
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...    42   0.003
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    43   0.003
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...    42   0.003
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    42   0.004
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    42   0.004
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...    43   0.004
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       42   0.004
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    42   0.004
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    42   0.004
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    42   0.004
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...    42   0.004
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...    42   0.004
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    42   0.004
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    42   0.004
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    42   0.004
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     42   0.005
CAGL0G02035g Chr7 (179911..180930) [1020 bp, 339 aa] {ON} highly...    42   0.005
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    42   0.005
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    42   0.005
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    42   0.005
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    42   0.005
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...    42   0.005
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    42   0.005
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    42   0.005
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    42   0.006
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    42   0.006
KAFR0F00520 Chr6 (111106..112659) [1554 bp, 517 aa] {ON} Anc_2.1...    42   0.006
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     42   0.006
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    42   0.006
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...    42   0.006
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    42   0.006
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    41   0.006
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      42   0.007
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    42   0.007
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...    42   0.007
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    41   0.007
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...    41   0.007
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    42   0.008
Suva_15.32 Chr15 complement(56314..57447) [1134 bp, 377 aa] {ON}...    41   0.008
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    41   0.008
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    42   0.008
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    42   0.008
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    42   0.008
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    42   0.008
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    42   0.009
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    41   0.009
TDEL0B02610 Chr2 complement(470263..471282) [1020 bp, 339 aa] {O...    41   0.009
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    41   0.010
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...    40   0.010
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    41   0.010
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    41   0.010
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    41   0.010
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    41   0.010
ZYRO0B16038g Chr2 (1300484..1301515) [1032 bp, 343 aa] {ON} high...    40   0.010
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    41   0.010
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...    40   0.011
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...    40   0.011
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...    40   0.011
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    41   0.011
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    41   0.011
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    41   0.012
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    41   0.012
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    40   0.013
Kwal_47.17868 s47 (587449..588546) [1098 bp, 365 aa] {ON} YMR139...    40   0.013
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    41   0.013
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    41   0.013
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    41   0.014
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...    40   0.014
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    41   0.014
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    41   0.015
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    41   0.015
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    40   0.015
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    40   0.015
Kpol_489.20 s489 complement(59150..60178) [1029 bp, 342 aa] {ON}...    40   0.016
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    40   0.016
KNAG0L01860 Chr12 (336795..337817) [1023 bp, 340 aa] {ON} Anc_5....    40   0.016
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    40   0.017
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    40   0.017
Ecym_4056 Chr4 complement(119406..120428) [1023 bp, 340 aa] {ON}...    40   0.017
ADR204W Chr4 (1062593..1063612) [1020 bp, 339 aa] {ON} Syntenic ...    40   0.017
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...    40   0.018
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    40   0.018
CAGL0L06820g Chr12 (769035..770135) [1101 bp, 366 aa] {ON} highl...    40   0.018
YJL057C Chr10 complement(328118..330121) [2004 bp, 667 aa] {ON} ...    40   0.019
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    40   0.019
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    40   0.020
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    40   0.020
NCAS0A08770 Chr1 complement(1733181..1734890) [1710 bp, 569 aa] ...    40   0.020
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    40   0.021
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    40   0.021
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    40   0.021
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...    40   0.022
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    40   0.022
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    40   0.023
Kwal_0.155 s0 (84856..86619) [1764 bp, 587 aa] {ON} YLR248W (RCK...    40   0.023
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...    40   0.023
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    40   0.024
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      40   0.024
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    40   0.025
KLLA0F16467g Chr6 (1519800..1520822) [1023 bp, 340 aa] {ON} high...    39   0.026
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    40   0.026
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    39   0.026
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    39   0.027
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    40   0.027
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    40   0.028
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    39   0.028
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    39   0.031
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...    39   0.032
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    39   0.033
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    39   0.033
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...    39   0.035
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    39   0.038
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    39   0.038
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    39   0.038
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    39   0.039
NCAS0C05490 Chr3 (1114733..1115755) [1023 bp, 340 aa] {ON} Anc_5...    39   0.040
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    39   0.042
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               39   0.043
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    39   0.044
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    39   0.044
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    39   0.045
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    39   0.047
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    39   0.048
Kpol_1035.34 s1035 (79914..80978) [1065 bp, 354 aa] {ON} (79914....    39   0.049
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    39   0.050
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    39   0.052
TBLA0F01730 Chr6 complement(431961..433004) [1044 bp, 347 aa] {O...    39   0.053
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    39   0.054
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    39   0.057
CAGL0J05082g Chr10 (483782..485743) [1962 bp, 653 aa] {ON} simil...    39   0.058
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    39   0.059
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    39   0.061
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...    39   0.063
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    38   0.067
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    38   0.068
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    39   0.069
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    38   0.070
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    39   0.071
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    38   0.076
TDEL0B06160 Chr2 complement(1086672..1088327) [1656 bp, 551 aa] ...    38   0.077
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    38   0.078
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    38   0.079
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    38   0.080
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    38   0.082
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    38   0.085
TBLA0A09370 Chr1 complement(2310412..2311443) [1032 bp, 343 aa] ...    38   0.087
TPHA0J02290 Chr10 (508389..510779) [2391 bp, 796 aa] {ON} Anc_6....    38   0.088
KLLA0D13266g Chr4 complement(1137750..1141208) [3459 bp, 1152 aa...    38   0.092
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    37   0.099
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               38   0.10 
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    37   0.11 
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    38   0.11 
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...    38   0.12 
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    37   0.12 
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    38   0.12 
KAFR0K01310 Chr11 (270172..271191) [1020 bp, 339 aa] {ON} Anc_5....    37   0.12 
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    37   0.13 
TPHA0B02780 Chr2 complement(633307..634449) [1143 bp, 380 aa] {O...    37   0.13 
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             37   0.14 
KLTH0F04686g Chr6 (413669..416209) [2541 bp, 846 aa] {ON} weakly...    37   0.14 
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    37   0.14 
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               37   0.15 
TPHA0I02660 Chr9 (582108..584219) [2112 bp, 703 aa] {ON} Anc_1.3...    37   0.16 
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    37   0.17 
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    37   0.19 
Skud_16.391 Chr16 (704392..705723) [1332 bp, 443 aa] {ON} YPR106...    37   0.19 
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    37   0.20 
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               37   0.21 
KLLA0E13531g Chr5 (1193481..1194902) [1422 bp, 473 aa] {ON} some...    37   0.21 
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    37   0.21 
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    37   0.22 
Kwal_27.12562 s27 (1274883..1279139) [4257 bp, 1418 aa] {ON} YBR...    37   0.23 
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    37   0.23 
ZYRO0G08316g Chr7 (677123..679465) [2343 bp, 780 aa] {ON} simila...    37   0.24 
Kwal_33.13825 s33 (409772..412477) [2706 bp, 901 aa] {ON} YKL171...    37   0.24 
Suva_6.133 Chr6 (221952..223955) [2004 bp, 667 aa] {ON} YJL057C ...    37   0.24 
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    37   0.24 
Ecym_8164 Chr8 (342672..346076) [3405 bp, 1134 aa] {ON} similar ...    37   0.26 
Kwal_47.18098 s47 (685497..686621) [1125 bp, 374 aa] {ON} YIL035...    36   0.27 
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    36   0.28 
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    37   0.28 
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    36   0.33 
Kpol_1065.32 s1065 complement(65735..70255) [4521 bp, 1506 aa] {...    36   0.37 
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    36   0.39 
KLTH0A03542g Chr1 (306667..307803) [1137 bp, 378 aa] {ON} highly...    36   0.41 
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    35   0.43 
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    36   0.45 
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    36   0.53 
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    35   0.54 
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    35   0.55 
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    35   0.56 
Skud_10.153 Chr10 (288733..290742) [2010 bp, 669 aa] {ON} YJL057...    35   0.60 
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    35   0.62 
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    35   0.66 
Smik_10.183 Chr10 complement(319743..321746) [2004 bp, 667 aa] {...    35   0.70 
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    35   0.72 
Kpol_1027.1 s1027 (1..2088) [2088 bp, 695 aa] {ON} (1..2088) [20...    35   0.74 
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    35   0.75 
Smik_16.346 Chr16 (617471..618802) [1332 bp, 443 aa] {ON} YPR106...    35   0.75 
KNAG0I03000 Chr9 (596789..598840) [2052 bp, 683 aa] {ON} Anc_4.4...    35   0.77 
NDAI0B02430 Chr2 (608926..610590) [1665 bp, 554 aa] {ON} Anc_8.132     35   0.80 
CAGL0K12496g Chr11 (1219220..1220302) [1083 bp, 360 aa] {ON} sim...    35   0.80 
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    35   0.84 
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    35   0.84 
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    35   0.99 
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    34   1.1  
AER348C Chr5 complement(1275897..1277774) [1878 bp, 625 aa] {ON}...    35   1.1  
KLTH0F17490g Chr6 (1413752..1414774) [1023 bp, 340 aa] {ON} high...    34   1.2  
TDEL0G01540 Chr7 complement(303940..306300) [2361 bp, 786 aa] {O...    34   1.3  
AFR492W Chr6 (1323730..1325805) [2076 bp, 691 aa] {ON} Syntenic ...    34   1.3  
SAKL0F07854g Chr6 (600324..601442) [1119 bp, 372 aa] {ON} highly...    34   1.5  
TDEL0H02380 Chr8 complement(399810..400931) [1122 bp, 373 aa] {O...    34   1.6  
Skud_6.41 Chr6 complement(81310..82416) [1107 bp, 368 aa] {ON} Y...    33   1.7  
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    33   2.0  
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    33   2.2  
KLLA0F22297g Chr6 complement(2083448..2085547) [2100 bp, 699 aa]...    33   2.2  
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    33   2.3  
NDAI0G05790 Chr7 complement(1433294..1435252) [1959 bp, 652 aa] ...    33   2.6  
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    33   2.6  
TBLA0B05130 Chr2 complement(1207884..1210484) [2601 bp, 866 aa] ...    33   2.7  
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    33   2.7  
Kpol_1063.4 s1063 complement(10790..11932) [1143 bp, 380 aa] {ON...    33   3.1  
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    33   3.2  
TBLA0E02460 Chr5 (620609..621745) [1137 bp, 378 aa] {ON} Anc_7.2...    33   3.4  
KLLA0C07216g Chr3 (626227..628278) [2052 bp, 683 aa] {ON} simila...    32   5.7  
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    32   6.2  
TBLA0D01110 Chr4 (283160..285640) [2481 bp, 826 aa] {ON} Anc_8.7...    32   8.2  
TPHA0C01810 Chr3 complement(413495..414790) [1296 bp, 431 aa] {O...    31   9.1  

>TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON}
           Anc_2.284 YNL020C
          Length = 717

 Score = 1263 bits (3269), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 630/717 (87%), Positives = 630/717 (87%)

Query: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60
           MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV
Sbjct: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60

Query: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120
           PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF
Sbjct: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120

Query: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180
           MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS
Sbjct: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180

Query: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240
           VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC
Sbjct: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300
           YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ
Sbjct: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300

Query: 301 GIPCPLPNFYLQRQQATQLMMNNTNGSIYPIXXXXXXXXXXXXXXXXXXXSQIAAQHSSN 360
           GIPCPLPNFYLQRQQATQLMMNNTNGSIYPI                   SQIAAQHSSN
Sbjct: 301 GIPCPLPNFYLQRQQATQLMMNNTNGSIYPIPTQNTMMNQMPPPMNMMNNSQIAAQHSSN 360

Query: 361 MMPQSIPQPLYTXXXXXXXXXXXXXXXXXXXPTSPIMSQGLFTGPTLHHNLTSPISQPKS 420
           MMPQSIPQPLYT                   PTSPIMSQGLFTGPTLHHNLTSPISQPKS
Sbjct: 361 MMPQSIPQPLYTNYSNNSMNANMNMSPNYAYPTSPIMSQGLFTGPTLHHNLTSPISQPKS 420

Query: 421 KSENTTGNDDPFAKLKDQALFNKVNANNTNTSVNDHSFNMYSTKQQXXXXXXXXXXXXXX 480
           KSENTTGNDDPFAKLKDQALFNKVNANNTNTSVNDHSFNMYSTKQQ              
Sbjct: 421 KSENTTGNDDPFAKLKDQALFNKVNANNTNTSVNDHSFNMYSTKQQNMANNFNNNNSNNM 480

Query: 481 XPLMKQRSDRTRIFDMPQNKTPAMTQNSVNYLLPGHSSEQSIRKSTSSTSLRNIQNGGNQ 540
            PLMKQRSDRTRIFDMPQNKTPAMTQNSVNYLLPGHSSEQSIRKSTSSTSLRNIQNGGNQ
Sbjct: 481 NPLMKQRSDRTRIFDMPQNKTPAMTQNSVNYLLPGHSSEQSIRKSTSSTSLRNIQNGGNQ 540

Query: 541 VLSQIMFNNNKTGERTXXXXXXXXXXXXKNMVPYIPPNSFTSTNNAMVFRENESSKASIK 600
           VLSQIMFNNNKTGERT            KNMVPYIPPNSFTSTNNAMVFRENESSKASIK
Sbjct: 541 VLSQIMFNNNKTGERTSSTSSVSAPSLSKNMVPYIPPNSFTSTNNAMVFRENESSKASIK 600

Query: 601 LRVQNLLKTSNSGNNDNSLRRTTSDTQNGSQSNNSLRKVNTHQVDSNYTTSEXXXXXXXX 660
           LRVQNLLKTSNSGNNDNSLRRTTSDTQNGSQSNNSLRKVNTHQVDSNYTTSE        
Sbjct: 601 LRVQNLLKTSNSGNNDNSLRRTTSDTQNGSQSNNSLRKVNTHQVDSNYTTSEKKKAPKPP 660

Query: 661 XXXXXXXXXXXXXXANLQGMKFMKSENVEQEIKERKENSKKQLQKMEVDFSQRYPSV 717
                         ANLQGMKFMKSENVEQEIKERKENSKKQLQKMEVDFSQRYPSV
Sbjct: 661 PKPDYLRPKKPPKPANLQGMKFMKSENVEQEIKERKENSKKQLQKMEVDFSQRYPSV 717

>TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.284
           YNL020C
          Length = 661

 Score =  501 bits (1290), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 224/313 (71%), Positives = 261/313 (83%)

Query: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60
           MNQP I NY+PGT L VG H   +I YLTSGGFAQ+Y  ++ P +     N+ACLKRVIV
Sbjct: 1   MNQPEIPNYNPGTVLTVGSHHAKVISYLTSGGFAQVYSAEIQPADAFIDSNVACLKRVIV 60

Query: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120
           P+K  LNTLRAEV+AM+LL+   HVV YIDS+AA+S   +G+YEV  LME+C GGGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHAAKSSFPNGSYEVFLLMEYCAGGGLIDF 120

Query: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180
           MNTRLQNRL+EFE+LNIM+QVTQGI AMH+L PPLIHRDIKIENVLIS  G+YKVCDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISHTGQYKVCDFGS 180

Query: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240
           V G+IRPP+N +EF +VQ D++KNTTAQYR PEM+DLYRG PI+EKSDIWALGVFLYK+C
Sbjct: 181 VCGVIRPPQNPQEFAYVQHDVLKNTTAQYRSPEMIDLYRGHPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300
           YYTTPFE GGE AILH+R+Q+P  P+YS RLK LIR MLME P+QRPNVCQVLE+VS MQ
Sbjct: 241 YYTTPFEKGGELAILHSRFQFPAQPIYSDRLKGLIRRMLMENPDQRPNVCQVLEDVSRMQ 300

Query: 301 GIPCPLPNFYLQR 313
           GI CP+ NFYL R
Sbjct: 301 GIQCPVRNFYLLR 313

>YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protein
           serine/threonine kinase; regulates the organization and
           function of the actin cytoskeleton and reduces endocytic
           ability of cell through the phosphorylation of the
           Pan1p-Sla1p-End3p protein complex
          Length = 810

 Score =  506 bits (1303), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 228/313 (72%), Positives = 258/313 (82%), Gaps = 1/313 (0%)

Query: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60
           MN P I  Y+PGT L VG H   IIKYLTSGGFAQ+Y  +++PP+P +  N+ACLKRVIV
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANIACLKRVIV 60

Query: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120
           P K GLNTLRAEV+AM+LL+   HVV YIDS+AARS+ N   YEV  LMEFC  GGLIDF
Sbjct: 61  PHKQGLNTLRAEVDAMKLLRNNKHVVSYIDSHAARSV-NGIAYEVFVLMEFCERGGLIDF 119

Query: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180
           MNTRLQNRL+E E+L IM+Q  QGI AMH+L PPLIHRDIKIENVLIS +G YKVCDFGS
Sbjct: 120 MNTRLQNRLQESEILEIMSQTVQGITAMHALQPPLIHRDIKIENVLISHDGLYKVCDFGS 179

Query: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240
           VSG+IRPP+NT+EFN+VQ DI+ NTTAQYR PEM+DLYRG PI+EKSDIWALGVFLYKIC
Sbjct: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKIC 239

Query: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300
           YYTTPFE  GE  ILHARYQYP +P YS RLKNLIR+MLME P QRPN+CQVLEEVS +Q
Sbjct: 240 YYTTPFEKSGEAGILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRLQ 299

Query: 301 GIPCPLPNFYLQR 313
             PCP+ NFYL R
Sbjct: 300 NKPCPIRNFYLLR 312

>Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W
           (REAL)
          Length = 808

 Score =  504 bits (1299), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 230/321 (71%), Positives = 261/321 (81%), Gaps = 3/321 (0%)

Query: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60
           MN P I  Y+PGT L VG H   IIKYLTSGGFAQ+Y  +++PP+P    N+ACLKRVIV
Sbjct: 1   MNAPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYTNANIACLKRVIV 60

Query: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120
           P+K GLNTLRAEV+AM+LLK   HVV YIDS+AA+S+ N   YEV  LMEFC  GGLIDF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV-NGVAYEVFVLMEFCERGGLIDF 119

Query: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180
           MNTRLQNRL+E E+L IM+Q  QGI AMH+L PPLIHRDIKIENVLIS NG YKVCDFGS
Sbjct: 120 MNTRLQNRLRESEILEIMSQTVQGIAAMHALQPPLIHRDIKIENVLISHNGLYKVCDFGS 179

Query: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240
           VSG+IRPP+NT+EFN+VQ DI+ NTTAQYR PEM+DLYRG PI+EKSDIWALG+FLYKIC
Sbjct: 180 VSGVIRPPRNTQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGIFLYKIC 239

Query: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300
           YYTTPFE  GE  ILHARYQYP +P YS RLKNLIR+MLME P +RPN+CQVLEEVS +Q
Sbjct: 240 YYTTPFEKSGEAGILHARYQYPPFPQYSDRLKNLIRLMLMETPSKRPNICQVLEEVSRLQ 299

Query: 301 GIPCPLPNFYLQR--QQATQL 319
             PCP+ NFYL R   Q  QL
Sbjct: 300 IKPCPIRNFYLLRAMSQTAQL 320

>Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W
           (REAL)
          Length = 805

 Score =  503 bits (1294), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 227/313 (72%), Positives = 258/313 (82%), Gaps = 1/313 (0%)

Query: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60
           MN P I  Y+PGT L VG H   IIKYLTSGGFAQ+Y  +++PP+P +  N+ACLKRVIV
Sbjct: 1   MNTPQISLYEPGTILTVGSHHAKIIKYLTSGGFAQVYSAEISPPDPYSSANIACLKRVIV 60

Query: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120
           P+K GLNTLRAEV+AM+LLK   HVV YIDS+AA+S+ N   YEV  LME+C  GGLIDF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV-NGVAYEVFVLMEYCERGGLIDF 119

Query: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180
           MNTRL+NRL+E E+L+IM Q  QGI AMH+L PPLIHRDIKIENVLIS  G YKVCDFGS
Sbjct: 120 MNTRLKNRLQESEILDIMGQTVQGIAAMHALQPPLIHRDIKIENVLISHEGLYKVCDFGS 179

Query: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240
           VSG+IRPPKN +EFN+VQ DI+ NTTAQYR PEM+DLYRG PI+EKSDIWALGVFLYKIC
Sbjct: 180 VSGVIRPPKNPQEFNYVQHDILTNTTAQYRSPEMIDLYRGLPIDEKSDIWALGVFLYKIC 239

Query: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300
           YYTTPFE  GE AILHARYQYP +P YS RLKNLIR+MLME P QRPN+CQVLEEVS +Q
Sbjct: 240 YYTTPFEKTGEAAILHARYQYPSFPQYSDRLKNLIRLMLMEAPSQRPNICQVLEEVSRLQ 299

Query: 301 GIPCPLPNFYLQR 313
             PCP+ NFYL R
Sbjct: 300 NRPCPIRNFYLLR 312

>NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {ON} 
          Length = 661

 Score =  494 bits (1271), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 225/321 (70%), Positives = 260/321 (80%)

Query: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60
           MNQP I  Y PGT L VG H+V ++KYLTSGGFAQIY VQ++PP+     N+ACLKRVIV
Sbjct: 1   MNQPQIPLYQPGTLLTVGSHKVQVVKYLTSGGFAQIYTVQISPPDKFTNTNVACLKRVIV 60

Query: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120
           P+K  LNTLRAEV+ M+LL+   HVV YIDS+AA+   N+G+YEV  LME+C  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDTMKLLRNNAHVVSYIDSHAAKFNPNEGSYEVFLLMEYCDMGGLIDF 120

Query: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180
           MNTRLQ RL+E E+LNIM+QVTQGI AMH+L+PPL+HRDIKIENVL++S GEYKVCDFGS
Sbjct: 121 MNTRLQERLREDEILNIMSQVTQGIAAMHALHPPLLHRDIKIENVLLTSKGEYKVCDFGS 180

Query: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240
           V GIIRPP N +E ++VQ DIMKNTTAQYR PEM+DLYRG PI+EKSDIWALGVFLYK+C
Sbjct: 181 VCGIIRPPSNAQEVSYVQHDIMKNTTAQYRAPEMIDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300
           YYTTPFE  GE AILHA +Q+P YP YS RLK LI  MLME+P QRPN  QVLEEVSSMQ
Sbjct: 241 YYTTPFEKNGEAAILHATFQFPNYPQYSDRLKKLITYMLMEQPSQRPNSYQVLEEVSSMQ 300

Query: 301 GIPCPLPNFYLQRQQATQLMM 321
            + CP+PNFYL     TQ  M
Sbjct: 301 NVQCPIPNFYLMNNNVTQGQM 321

>ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 704

 Score =  494 bits (1271), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 222/313 (70%), Positives = 259/313 (82%)

Query: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60
           MN P I  Y PGT L+VG H   I+KY+ SGGFAQ+Y  ++ P +   G N  CLKRVI+
Sbjct: 1   MNHPEIPTYTPGTVLSVGTHHAKILKYIASGGFAQVYSAEMFPADTPTGTNKVCLKRVII 60

Query: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120
           PEK+GLN LRAEV AM+LLKG  HVV YIDS+AARS+  +GTYEV  LMEFC  GGLIDF
Sbjct: 61  PEKAGLNALRAEVNAMKLLKGSKHVVCYIDSHAARSLLQNGTYEVFLLMEFCTAGGLIDF 120

Query: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180
           MNTRLQNRLKE+E+LNIM+QVTQGI AMH+L PPLIHRDIKIENVLIS++GEYKVCDFGS
Sbjct: 121 MNTRLQNRLKEYEILNIMSQVTQGIAAMHALQPPLIHRDIKIENVLISADGEYKVCDFGS 180

Query: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240
           VSG IRPP+N +EF FVQ DI+KNTTAQYR PEM+DLYR Q I+EKSDIWALG+FLYK+C
Sbjct: 181 VSGPIRPPRNPQEFAFVQHDILKNTTAQYRSPEMIDLYRCQAIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300
           YYTTPFE GG++AILH+RYQ+  +P+YS RLKNLI  ML ++P QRPN+CQVLEEVS MQ
Sbjct: 241 YYTTPFEKGGDQAILHSRYQFLAHPIYSDRLKNLISWMLSQQPMQRPNICQVLEEVSRMQ 300

Query: 301 GIPCPLPNFYLQR 313
           G+  P+ NFYL R
Sbjct: 301 GVSSPMRNFYLLR 313

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 38/75 (50%), Gaps = 18/75 (24%)

Query: 581 TSTNNAMVFRENESSKASIKLRVQNLLK------------------TSNSGNNDNSLRRT 622
           T+ ++    + N  +K SI+ +VQ+LLK                  T+ S  ++N LR+T
Sbjct: 564 TTPDSLARIKSNPDTKESIQKKVQSLLKAAEDSPKNKSTSEIVNIRTTTSSFSENGLRKT 623

Query: 623 TSDTQNGSQSNNSLR 637
           TS+ +NG  +  S++
Sbjct: 624 TSNVENGKSTTRSIK 638

>Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON}
           (89266..91407) [2142 nt, 714 aa]
          Length = 713

 Score =  494 bits (1272), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 219/313 (69%), Positives = 262/313 (83%)

Query: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60
           MNQP I  Y  G  L VG+H  +I+KYLTSGG+AQ+YQ +++PP+   G ++ CLKR+IV
Sbjct: 1   MNQPDIPTYPQGISLQVGVHHATILKYLTSGGYAQVYQAKISPPDSRTGSDIVCLKRLIV 60

Query: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120
           P+K+ LNT RAEV+AM+LL+   HVV YIDSNAA+S  ++G YEVL LMEFC  GGLIDF
Sbjct: 61  PDKASLNTPRAEVDAMKLLRNFDHVVSYIDSNAAKSGLHNGAYEVLLLMEFCAEGGLIDF 120

Query: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180
           MNTRLQNRL+EFE+LNIM+QVTQG+ AMHSL PPL+HRDIKIENVLIS++GEYK+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVTQGVAAMHSLEPPLLHRDIKIENVLISNSGEYKLCDFGS 180

Query: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240
           V G+IRPP + +EFNFVQ DI+KNTTAQYR PEM+DL R  PI+EKSDIWALGVFLYK+C
Sbjct: 181 VCGVIRPPTSQQEFNFVQHDILKNTTAQYRAPEMIDLSRHLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300
           YYTTPFE  GE AILH+RY+Y  YP YS  LKNLIR+ML  +P QRPN+CQVLEEVS +Q
Sbjct: 241 YYTTPFEKAGEAAILHSRYEYLAYPHYSDNLKNLIRLMLANQPSQRPNICQVLEEVSRLQ 300

Query: 301 GIPCPLPNFYLQR 313
           GIPCP+ NFYL+R
Sbjct: 301 GIPCPIKNFYLER 313

>Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W
           (REAL)
          Length = 809

 Score =  497 bits (1280), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 224/313 (71%), Positives = 255/313 (81%), Gaps = 1/313 (0%)

Query: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60
           MN P I  YDPGT L VG H   IIKYLTSGGFAQ+Y  +++PP+P +  N ACLKRVIV
Sbjct: 1   MNAPQISLYDPGTVLTVGSHHAKIIKYLTSGGFAQVYTAEISPPDPYSNANTACLKRVIV 60

Query: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120
           P+K GLNTLRAEV+AM+LLK   HVV YIDS+AA+S+ N   YEV  LMEFC  GGLIDF
Sbjct: 61  PDKQGLNTLRAEVDAMKLLKNNKHVVSYIDSHAAKSV-NGIAYEVFVLMEFCERGGLIDF 119

Query: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180
           MNTRLQ+RL+E E+L IM+Q  QGI AMH L PPLIHRDIKIENVLIS +G YKVCDFGS
Sbjct: 120 MNTRLQSRLRESEILEIMSQTVQGIAAMHVLQPPLIHRDIKIENVLISHDGLYKVCDFGS 179

Query: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240
           VSG+IRPP+N++EFN+VQ DI+ NTTAQYR PEM+DLYR  PI+EKSDIWALGVFLYKIC
Sbjct: 180 VSGVIRPPRNSQEFNYVQHDILTNTTAQYRSPEMIDLYRNSPIDEKSDIWALGVFLYKIC 239

Query: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300
           YYTTPFE  GE AILH+RYQYP +P YS RLK LI +MLME P QRPN+CQVLEEVS +Q
Sbjct: 240 YYTTPFEKSGEAAILHSRYQYPSFPQYSDRLKGLIHLMLMEVPSQRPNICQVLEEVSRLQ 299

Query: 301 GIPCPLPNFYLQR 313
             PCP+ NFYL R
Sbjct: 300 NEPCPIRNFYLLR 312

>NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa]
           {ON} Anc_2.284
          Length = 723

 Score =  494 bits (1271), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 223/323 (69%), Positives = 259/323 (80%)

Query: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60
           MNQP+I  Y PGT L VG H   IIKYLTSGGFAQIY  +++P NP N    ACLKRVIV
Sbjct: 1   MNQPNIPTYPPGTLLTVGSHYCKIIKYLTSGGFAQIYTTEISPINPYNNSQTACLKRVIV 60

Query: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120
           P+K+GLNTLRAEV+AM+LLK   HVV YIDS+AARS    G YEV  LME+C GGGLIDF
Sbjct: 61  PDKAGLNTLRAEVDAMKLLKNNRHVVSYIDSHAARSTVLAGAYEVFLLMEYCKGGGLIDF 120

Query: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180
           MNTRLQNRL E E+LNI++Q  QG+ AMH+L P LIHRDIKIENVLIS+ GE+K+CDFGS
Sbjct: 121 MNTRLQNRLTEKEILNILSQTVQGVSAMHALQPALIHRDIKIENVLISAKGEFKICDFGS 180

Query: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240
           V   IRPP+N +E  +VQ D++KNTTAQYR PEMLDLYRG PINEKSDIWALGVFLYK+C
Sbjct: 181 VCSYIRPPRNPQELAYVQHDVLKNTTAQYRAPEMLDLYRGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300
           YYTTPFE GGE AILH+RYQYP +P+Y+ +LKNLIR  LME P +RPN+CQ+LEE+S +Q
Sbjct: 241 YYTTPFEKGGEAAILHSRYQYPAFPIYTDKLKNLIRATLMEDPSKRPNICQLLEEISRIQ 300

Query: 301 GIPCPLPNFYLQRQQATQLMMNN 323
           GIPCP+ NFYL R    Q  + N
Sbjct: 301 GIPCPINNFYLSRTINVQASLMN 323

>KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 777

 Score =  491 bits (1265), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 216/318 (67%), Positives = 263/318 (82%)

Query: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60
           MNQP I+ Y  GT L VG HQV ++KYL SGGFA +Y V+++PP+P+   N+ACLKRV+V
Sbjct: 1   MNQPQIEKYASGTILPVGSHQVKVLKYLASGGFAHVYSVEISPPDPVCPDNVACLKRVVV 60

Query: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120
           P+K+ LNTLRAEV++M+ L+G   +V YIDS+A +S  N G YEV  LME+C GGGLIDF
Sbjct: 61  PDKASLNTLRAEVDSMKALRGNKFIVSYIDSHATKSPVNVGMYEVYLLMEYCSGGGLIDF 120

Query: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180
           MNTRLQNRL+EFE+LNIM+QV+QG+ AMH+L PPLIHRDIKIENVL+S N E+K+CDFGS
Sbjct: 121 MNTRLQNRLQEFEILNIMSQVSQGVAAMHALQPPLIHRDIKIENVLLSKNHEFKLCDFGS 180

Query: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240
           VSG+IR P+NTEEFN+VQ DIMKNTTAQYRCPEM+DLYRG PI+EKSDIWALGVFLYK C
Sbjct: 181 VSGVIRAPRNTEEFNYVQYDIMKNTTAQYRCPEMIDLYRGLPIDEKSDIWALGVFLYKTC 240

Query: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300
           YYTTPFE  GE AIL +++++P YP YS R+KNLI +ML   P +RPN+CQV+EEVS +Q
Sbjct: 241 YYTTPFEKNGESAILASKFEFPAYPRYSDRVKNLISVMLRVDPLKRPNICQVVEEVSRIQ 300

Query: 301 GIPCPLPNFYLQRQQATQ 318
           GIPCP+ NFYL R    Q
Sbjct: 301 GIPCPIKNFYLLRMMDKQ 318

>KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {ON}
           Anc_2.284 YNL020C
          Length = 369

 Score =  474 bits (1221), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 220/322 (68%), Positives = 261/322 (81%), Gaps = 1/322 (0%)

Query: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60
           MNQP I  Y PGT L VG HQV IIKY+TSGGFAQIY V+++PP+     N+ACLKRVIV
Sbjct: 1   MNQPKIDTYHPGTILPVGSHQVRIIKYITSGGFAQIYTVEISPPDSFCDSNIACLKRVIV 60

Query: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120
           P+K  LNTLRAEV+AM+LL+   HVV YIDS+A++S  N+G+YEV  LME+C  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNKHVVSYIDSHASKSNFNNGSYEVFLLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180
           MNTRLQNRL E EVL+I +QV QGI AMH+L PPL+HRDIKIENVLIS + +YK+CDFGS
Sbjct: 121 MNTRLQNRLTESEVLSITSQVAQGIAAMHALQPPLLHRDIKIENVLISKSNQYKICDFGS 180

Query: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240
           VSGIIRPP N +E  +VQ D++KNTTAQYR PEM+D YRG PI+EKSDIWA+GVFLYK+C
Sbjct: 181 VSGIIRPPHNPQELQYVQHDVLKNTTAQYRSPEMIDFYRGLPIDEKSDIWAIGVFLYKLC 240

Query: 241 YYTTPFE-NGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSM 299
           YYTTPFE NGGE AIL ARY+YP +P+YS RLK+LI  MLME P QRPN+ QV+EE+S M
Sbjct: 241 YYTTPFEKNGGEAAILSARYEYPNFPIYSERLKHLIHAMLMENPHQRPNIYQVIEEISKM 300

Query: 300 QGIPCPLPNFYLQRQQATQLMM 321
           Q +PCP+ NFYL  QQ    M+
Sbjct: 301 QNVPCPIVNFYLVTQQQKHKMV 322

>ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL095W (PRK1) and
           YNL020C (ARK1)
          Length = 750

 Score =  488 bits (1255), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 221/315 (70%), Positives = 258/315 (81%), Gaps = 1/315 (0%)

Query: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60
           MNQ       PG  L VG H+V II+YLTSGGFAQIY  +V  P PI G +LACLKRV V
Sbjct: 1   MNQVPQDCLQPGIILTVGSHEVKIIQYLTSGGFAQIYSCEVLSPGPIQG-SLACLKRVHV 59

Query: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120
           P+K  LNTLRAEV+AM++LKG  HVV YIDS+AA+S  +DGTYEV  LME+C  GGLIDF
Sbjct: 60  PDKPSLNTLRAEVDAMKMLKGHRHVVSYIDSHAAKSPRHDGTYEVYLLMEYCLRGGLIDF 119

Query: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180
           MN+RLQ RL EFEVL IM+ V QGI+AMH+L PPLIHRDIKIENVLIS +G++KVCDFGS
Sbjct: 120 MNSRLQTRLSEFEVLKIMSHVAQGIMAMHALVPPLIHRDIKIENVLISGDGDFKVCDFGS 179

Query: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240
           VSG+IRPPKN  EFN+VQ DI+KNTTAQYR PEM+DLYR  P++EKSDIWALGVFLYK+C
Sbjct: 180 VSGVIRPPKNAYEFNYVQHDILKNTTAQYRAPEMIDLYRALPVDEKSDIWALGVFLYKVC 239

Query: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300
           Y+TTPFE  GE AIL A++Q+P YP Y+ RLKNLI +ML E P QRPN+CQVLEEVS +Q
Sbjct: 240 YFTTPFEKVGENAILQAKFQFPSYPQYTDRLKNLISVMLSEHPVQRPNICQVLEEVSRIQ 299

Query: 301 GIPCPLPNFYLQRQQ 315
           G+PCPLPNFYL+R +
Sbjct: 300 GVPCPLPNFYLERMK 314

>Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {ON}
           YIL095W (PRK1) - probable serine/threonine-protein
           kinase [contig 27] FULL
          Length = 791

 Score =  486 bits (1250), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 219/313 (69%), Positives = 255/313 (81%)

Query: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60
           MNQP    Y  GT L VG HQ  IIKYLTSGGFA IY  +++P +P +  N+ACLKRV+V
Sbjct: 1   MNQPSSGIYTQGTALTVGSHQARIIKYLTSGGFAHIYSAEISPADPNSIGNVACLKRVLV 60

Query: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120
           P+K  LN LRAEV+AM+LL+G  HVV YIDS+AA+S + DG+YEV  LME+C  GGLIDF
Sbjct: 61  PDKQSLNVLRAEVDAMKLLRGNKHVVSYIDSHAAKSGAQDGSYEVFLLMEYCSAGGLIDF 120

Query: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180
           MNTRLQNRL E EVL IM+ +TQGI AMH+L PPLIHRDIKIENVLIS +  +KVCDFGS
Sbjct: 121 MNTRLQNRLTENEVLKIMSDITQGIAAMHALLPPLIHRDIKIENVLISDDKTFKVCDFGS 180

Query: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240
           V G+IRPPKN +EF++VQ DI+KNTTAQYR PEM+DLYRG PINEKSDIWALGVFLYK+C
Sbjct: 181 VCGVIRPPKNAQEFSYVQNDILKNTTAQYRSPEMIDLYRGHPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300
           YYTTPFE  G+ AILH+R+Q+P YP YS RLKNLI +ML E P QRPN+CQVLEEVS +Q
Sbjct: 241 YYTTPFEKVGDAAILHSRFQFPAYPQYSDRLKNLISVMLSENPNQRPNICQVLEEVSRIQ 300

Query: 301 GIPCPLPNFYLQR 313
            +PCPL NFYL R
Sbjct: 301 NVPCPLRNFYLLR 313

>NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {ON}
           Anc_2.284
          Length = 756

 Score =  484 bits (1247), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 218/315 (69%), Positives = 261/315 (82%)

Query: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60
           MNQP+I  Y  GT L VG H+  I KYLTSGGFAQIY V++ P +  +  N+ACLKRVIV
Sbjct: 1   MNQPNIPLYPNGTLLTVGTHRALIKKYLTSGGFAQIYAVEITPVDTYSKSNVACLKRVIV 60

Query: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120
           P KSGLNTLRAEV+AM+LLK   HVV YIDSNA +S  N+G+YEVL LME+C GGGLIDF
Sbjct: 61  PTKSGLNTLRAEVDAMKLLKNNRHVVSYIDSNAVKSAFNNGSYEVLLLMEYCEGGGLIDF 120

Query: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180
           MN+RLQNRL E E+LNI++Q  QG+  MH+L P L+HRDIKIENVL S NGE+K+CDFGS
Sbjct: 121 MNSRLQNRLSEAEILNILSQTAQGVANMHALQPVLLHRDIKIENVLRSGNGEFKLCDFGS 180

Query: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240
           V G IRPP+N +E ++VQ DI+KNTTAQYRCPEMLDLYRG PI+EKSDIWALGVFLYK+C
Sbjct: 181 VCGYIRPPRNQQELSYVQHDILKNTTAQYRCPEMLDLYRGLPIDEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300
           YYTTPFE  GE AILH+++QYP +P+YS RLKNLIR+ML E P +RPN+C++LEE+SS+Q
Sbjct: 241 YYTTPFEKTGENAILHSKFQYPAFPIYSDRLKNLIRVMLSENPTKRPNICELLEEISSIQ 300

Query: 301 GIPCPLPNFYLQRQQ 315
           G+PCP+ NFYL R Q
Sbjct: 301 GVPCPIQNFYLIRAQ 315

>CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095w PRK1
          Length = 688

 Score =  482 bits (1241), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 221/313 (70%), Positives = 253/313 (80%)

Query: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60
           MNQP +   + GT+L VG H V I+KYLTSGGFAQIY V++      NG N+ACLKRV V
Sbjct: 1   MNQPELDRINVGTQLTVGTHSVKILKYLTSGGFAQIYAVEILSMGLFNGSNVACLKRVKV 60

Query: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120
           P+K  LN LRAEV+AM+LL    HVV YIDS+A RS +NDGTYEV  LME+C GGGLIDF
Sbjct: 61  PDKLSLNILRAEVDAMKLLANNKHVVSYIDSHATRSPTNDGTYEVFLLMEYCEGGGLIDF 120

Query: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180
           MNTRLQNRL E E+L+IM+Q TQGI  MH+L PPL+HRDIKIENVL+S  G YKVCDFGS
Sbjct: 121 MNTRLQNRLTEPEILDIMSQTTQGIAVMHALVPPLLHRDIKIENVLLSKGGIYKVCDFGS 180

Query: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240
           VSG+IRPP+N +E  +VQ DIMKNTTAQYRCPEMLDLYRG PI+EK+DIWALGVFLYK+C
Sbjct: 181 VSGVIRPPRNQQELLYVQHDIMKNTTAQYRCPEMLDLYRGLPIDEKADIWALGVFLYKLC 240

Query: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300
           YYTTPFE  GE AILHAR+Q+P +P YS RLKNLI+ ML E P  RPNVCQVLEEVS MQ
Sbjct: 241 YYTTPFEKLGEPAILHARFQFPSFPNYSDRLKNLIKSMLREHPSDRPNVCQVLEEVSRMQ 300

Query: 301 GIPCPLPNFYLQR 313
            +PCP+ NFYL R
Sbjct: 301 NVPCPIRNFYLLR 313

>SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {ON}
           similar to uniprot|P40494 Saccharomyces cerevisiae
           YIL095W PRK1 Protein serine/threonine kinase regulates
           the organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p-Sla1p-End3p
           protein complex
          Length = 791

 Score =  484 bits (1247), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 214/314 (68%), Positives = 261/314 (83%), Gaps = 1/314 (0%)

Query: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60
           M+QP ++ Y  GT L VG H+  IIKYLTSGGFA IY  +++PP+P N  ++ACLKRV+V
Sbjct: 1   MSQPPLETYPSGTVLTVGSHKARIIKYLTSGGFAHIYSAEISPPDP-NSSSIACLKRVLV 59

Query: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120
           P+K  LN+LRAEV+AM+LLK    VV YIDS+AA+S  N+G+YEV  LME+C  GGLIDF
Sbjct: 60  PDKPSLNSLRAEVDAMKLLKAHKFVVSYIDSHAAKSSLNNGSYEVFLLMEYCARGGLIDF 119

Query: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180
           MNTRLQNRLKEFEVL IM+QV+QG+ AMH+L PPLIHRDIKIENVLIS +G +KVCDFGS
Sbjct: 120 MNTRLQNRLKEFEVLKIMSQVSQGVAAMHALQPPLIHRDIKIENVLISEDGNFKVCDFGS 179

Query: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240
           V G+IRPPKN +E N+VQ DI+KNTTAQYR PEM+DLYRG P++EKSDIWALGVFLYK+C
Sbjct: 180 VCGVIRPPKNPQELNYVQHDILKNTTAQYRSPEMIDLYRGLPVDEKSDIWALGVFLYKLC 239

Query: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300
           YYTTPFE  GE AILH+++Q+P YP YS +LKNLI  +L E P QRPN+CQ+L EVS +Q
Sbjct: 240 YYTTPFEKAGEVAILHSKFQFPAYPQYSDQLKNLISALLRENPMQRPNICQLLAEVSRIQ 299

Query: 301 GIPCPLPNFYLQRQ 314
           G+PCP+ NFYL+R+
Sbjct: 300 GVPCPVKNFYLERK 313

>KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {ON}
           Anc_2.284 YNL020C
          Length = 780

 Score =  483 bits (1243), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 220/314 (70%), Positives = 253/314 (80%), Gaps = 1/314 (0%)

Query: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60
           MN P I+ +  G  L VG H   +IKYLTSGG+AQ+Y+V+++P +P    N+ACLKRVIV
Sbjct: 1   MNHPQIETFPSGQILTVGSHHAKVIKYLTSGGYAQVYKVEISPSDPYINSNIACLKRVIV 60

Query: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120
           P+K  LNTLRAEV+AM+LLK   HVV YIDS+A++S   +G YEV  LMEFC  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLKNNRHVVSYIDSHASKSAIYNGAYEVFVLMEFCERGGLIDF 120

Query: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180
           MN+RLQ+RL E E+L IM+  +QGI AMH L P L+HRDIKIENVLIS N EYKVCDFGS
Sbjct: 121 MNSRLQHRLTEAEILTIMSHTSQGIAAMHRLQPALLHRDIKIENVLISQNNEYKVCDFGS 180

Query: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240
           V GI+RPPKN +EFNFV  DIMKNTTAQYR PEMLDL +G PINEKSDIWALGVFLYK+C
Sbjct: 181 VCGIVRPPKNQQEFNFVYHDIMKNTTAQYRSPEMLDLSKGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFE-NGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSM 299
           YYTTPFE NGGE AIL AR+QYP YPMYS RLKNLIR+ML + P  RPNVCQVLEEVS +
Sbjct: 241 YYTTPFEKNGGEAAILQARFQYPSYPMYSDRLKNLIRVMLSKNPSDRPNVCQVLEEVSRL 300

Query: 300 QGIPCPLPNFYLQR 313
           QGIPCP+ NFYL R
Sbjct: 301 QGIPCPIRNFYLLR 314

>TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.284
           YNL020C
          Length = 697

 Score =  476 bits (1226), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 217/317 (68%), Positives = 257/317 (81%), Gaps = 4/317 (1%)

Query: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60
           MNQP I  Y PG  L VG HQ  I+KYLTSGGFAQ+YQV+++P +  +G N+ACLKRVIV
Sbjct: 1   MNQPEIPLYTPGIILPVGSHQAKILKYLTSGGFAQVYQVEISPYDIHSGSNIACLKRVIV 60

Query: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISN----DGTYEVLQLMEFCPGGG 116
           P+K+ LN  RAEVEAM+LL+   +VV YIDS+AA+S       +G+YEV  LME+C G G
Sbjct: 61  PDKTSLNVPRAEVEAMKLLRNNKYVVSYIDSHAAKSRPAPGVPNGSYEVFLLMEYCSGKG 120

Query: 117 LIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVC 176
           LIDFMNTRLQNRLKEFE+LNIM+ V+QG+ AMH+L PPL+HRDIKIENVLIS+  E+K+C
Sbjct: 121 LIDFMNTRLQNRLKEFEILNIMSHVSQGVAAMHALQPPLLHRDIKIENVLISNKNEFKLC 180

Query: 177 DFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFL 236
           DFGSV G+IRPP N  E +FVQ DI+KNTTAQYR PEML L +  PINEKSDIWALGVFL
Sbjct: 181 DFGSVCGVIRPPTNQTELDFVQHDILKNTTAQYRSPEMLSLSKSIPINEKSDIWALGVFL 240

Query: 237 YKICYYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEV 296
           YK+CYYTTPFE  GE AILH+RYQYP YP YS  LKNLIR+MLM  P +RPN+CQV+EEV
Sbjct: 241 YKVCYYTTPFEKEGENAILHSRYQYPAYPQYSDNLKNLIRVMLMVDPSKRPNICQVVEEV 300

Query: 297 SSMQGIPCPLPNFYLQR 313
           S +QG+PCPL NFYL+R
Sbjct: 301 SRLQGVPCPLKNFYLER 317

>KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} similar
           to uniprot|P40494 Saccharomyces cerevisiae YIL095W PRK1
           Protein serine/threonine kinase regulates the
           organization and function of the actin cytoskeleton
           through the phosphorylation of the Pan1p- Sla1p-End3p
           protein complex
          Length = 790

 Score =  478 bits (1229), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 216/313 (69%), Positives = 252/313 (80%)

Query: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60
           MNQ     Y PGT+L VG H+  IIKYLTSGGFA IY  ++ P +  +   +ACLKRV+V
Sbjct: 1   MNQSLNDIYQPGTELTVGSHRARIIKYLTSGGFAHIYTAEICPADLSSPAKIACLKRVLV 60

Query: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120
           P+K  LN LRAEV+AM+LL+G  HVV YIDS+AA+S  +DG+YEV  LME+C GGGLIDF
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRGNQHVVSYIDSHAAKSGVHDGSYEVFLLMEYCSGGGLIDF 120

Query: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180
           MNTRLQNRL+E EVL I + +TQGI AMH+L PPLIHRDIKIENVLIS +  +KVCDFGS
Sbjct: 121 MNTRLQNRLQEGEVLKITSDITQGIAAMHALQPPLIHRDIKIENVLISDDRTFKVCDFGS 180

Query: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240
           V G+IRPPKN +EFN+VQ DI+KNTTAQYR PEM+DLYRG PINEKSDIWALGVFLYK+C
Sbjct: 181 VCGVIRPPKNPQEFNYVQHDILKNTTAQYRAPEMIDLYRGYPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300
           YYTTPFE  GE AILH+R+Q+P YP YS  LK+LI  ML E P QRPN+CQVLEEVS +Q
Sbjct: 241 YYTTPFEKVGEAAILHSRFQFPSYPQYSDSLKHLISFMLSENPTQRPNICQVLEEVSRIQ 300

Query: 301 GIPCPLPNFYLQR 313
           G PCPL NFY+ R
Sbjct: 301 GTPCPLRNFYVTR 313

>NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284
          Length = 621

 Score =  468 bits (1204), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 209/314 (66%), Positives = 257/314 (81%)

Query: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60
           MNQP +  Y PGT L+VG HQ  IIKYLTSGGFAQ+Y  +++P +P    ++ CLKRVIV
Sbjct: 1   MNQPQVAIYHPGTLLSVGSHQARIIKYLTSGGFAQVYTAEISPIDPFINSSIVCLKRVIV 60

Query: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120
           P+K  LNTLRAEV+AM+LL+   HVV YIDS+AA+  +N G+YEV  LME+C  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMKLLRNNTHVVSYIDSHAAKFDTNIGSYEVFLLMEYCDRGGLIDF 120

Query: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180
           MNTRLQNRL E E+L+IM+QV+QG+ AMH+L PPL+HRDIKIENVL++S G YK+CDFGS
Sbjct: 121 MNTRLQNRLHENEILDIMSQVSQGVAAMHALQPPLLHRDIKIENVLLTSRGHYKLCDFGS 180

Query: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240
           V GIIRPP N +EF +VQ DIMKNTTAQYR PEM++L +G PINEKSDIWALGVFLYK+C
Sbjct: 181 VCGIIRPPTNPQEFTYVQHDIMKNTTAQYRSPEMINLGKGLPINEKSDIWALGVFLYKLC 240

Query: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300
           YYTTPFE  GE AILHA +Q+P +P YS R+K+LIR+ L  +P QRPN+ Q+LEEVS +Q
Sbjct: 241 YYTTPFEKTGENAILHASFQFPNFPHYSDRMKSLIRITLNVQPSQRPNIYQLLEEVSKIQ 300

Query: 301 GIPCPLPNFYLQRQ 314
            +PCP+P+FYLQR+
Sbjct: 301 NVPCPIPDFYLQRK 314

>YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON}
           ARK1Serine/threonine protein kinase involved in
           regulation of the cortical actin cytoskeleton; involved
           in control of endocytosis
          Length = 638

 Score =  464 bits (1195), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 205/306 (66%), Positives = 256/306 (83%)

Query: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60
           MNQP I  Y+ GT+L VG HQV IIKYLTSGGFAQ+Y   +NPP+P +  ++ACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALINPPDPHSNSSVACLKRVIV 60

Query: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120
           P+K  LNTLRAEV+AM+LLK   +VV YIDS+AA+++ ++G+YEV  LME+C  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180
           MNTRLQNRL EFE+L IM+QVTQG+ AMH+L PPLIHRDIKIENVLIS+N EYK+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240
           V GIIRPP+N++E ++VQQDI+KNTTAQYR PEM+D +RG PI+EKSDIWALG+FLYK+C
Sbjct: 181 VCGIIRPPRNSQELSYVQQDILKNTTAQYRSPEMIDTFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300
           YYTTPFE GG+ AIL  ++++P YP YS +LK LIR +L++ P  RPNV Q+L+ +S MQ
Sbjct: 241 YYTTPFEKGGDLAILSGKFEFPLYPNYSEQLKGLIRDILVQDPRHRPNVYQLLKRISIMQ 300

Query: 301 GIPCPL 306
            +PCP+
Sbjct: 301 NVPCPI 306

>Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {ON}
           YNL020C (REAL)
          Length = 639

 Score =  462 bits (1189), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 208/324 (64%), Positives = 264/324 (81%), Gaps = 2/324 (0%)

Query: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60
           MNQP I  Y+ GT+L VG HQV I+KYLTSGGFAQ+Y   ++PP+P +  N+ACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIVKYLTSGGFAQVYSALISPPDPHSHSNIACLKRVIV 60

Query: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120
           P+K  LNTLRAEV+AM+LL+   +VV YIDS+AA+++ ++G+YEV  LME+C  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLRNNRYVVSYIDSHAAKAMLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180
           MNTRLQNRL EFE+L IM+QVTQG+ AMH+L PPLIHRDIKIENVLIS+N EYK+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIMSQVTQGVAAMHALQPPLIHRDIKIENVLISANNEYKLCDFGS 180

Query: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240
           V G+IRPP+N +E ++VQQDI KNTTAQYR PEM+D++RG PI+EKSDIWALG+FLYK+C
Sbjct: 181 VCGVIRPPRNPQELSYVQQDIFKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300
           YYTTPFE GGE AIL   +++P YP YS +L++LIR +L++ P QRPNV Q+L+ +S MQ
Sbjct: 241 YYTTPFEKGGEPAILSGHFEFPPYPDYSEQLRDLIRDILVQNPCQRPNVYQLLKRISIMQ 300

Query: 301 GIPCPLPNFYLQRQQATQLMMNNT 324
            +PCP+ +  +Q  QA    +N T
Sbjct: 301 NVPCPISD--IQVPQAPDSHLNLT 322

>Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {ON}
           YNL020C (REAL)
          Length = 637

 Score =  461 bits (1185), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 205/306 (66%), Positives = 256/306 (83%)

Query: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60
           MNQP I  Y+ GT+L VG HQV IIKYLTSGGFAQ+Y V ++PP+P    N+ACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTRLTVGSHQVEIIKYLTSGGFAQVYSVLISPPDPHTNTNVACLKRVIV 60

Query: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120
           P+K  LNTLRAEV+AM+LLK   +VV YIDS+AA++I  +G+YEV  LME+C  GGLIDF
Sbjct: 61  PDKPSLNTLRAEVDAMRLLKNNRYVVSYIDSHAAKAILQNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180
           MNTRLQNRL EFE+L I++QVTQG+ AMH+L PPLIHRDIKIENVLIS+N EYK+CDFGS
Sbjct: 121 MNTRLQNRLHEFEILQIISQVTQGVAAMHALQPPLIHRDIKIENVLISTNNEYKLCDFGS 180

Query: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240
           V GIIR P+N++E ++VQQDI+KNTTAQYR PEM+D++RG PI+EKSDIWALG+FLYK+C
Sbjct: 181 VCGIIRLPRNSQELSYVQQDILKNTTAQYRSPEMIDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300
           YYTTPFE GGE AIL  ++++P YP YS +LK+LIR +L++ P  RP+V Q+L+ +S MQ
Sbjct: 241 YYTTPFEKGGEPAILSGKFEFPLYPNYSEQLKSLIRDILVQNPCHRPSVFQLLKRISIMQ 300

Query: 301 GIPCPL 306
            +PCP+
Sbjct: 301 NVPCPI 306

>Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar to
           Ashbya gossypii ADL217W
          Length = 748

 Score =  464 bits (1193), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 214/319 (67%), Positives = 257/319 (80%), Gaps = 1/319 (0%)

Query: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60
           MNQ    ++ PGT L VG H+V ++KYLTSGGFAQIY  +V  P+     ++ACLKRV V
Sbjct: 1   MNQLPQDSFQPGTVLTVGSHKVKVVKYLTSGGFAQIYCCEVISPDS-KVKDVACLKRVHV 59

Query: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120
           P+K  LNTLRAEV+AM+LL+G  H+V YIDS+A++S+ N+G+YEV+ LME+C  GGLI F
Sbjct: 60  PDKQSLNTLRAEVDAMKLLRGNKHIVSYIDSHASKSVLNNGSYEVVLLMEYCSRGGLISF 119

Query: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180
           MNTRLQ+RLKEFEVL IMNQV QGI+AMH+L PPLIHRDIKIENVLI+ NG+ KVCDFGS
Sbjct: 120 MNTRLQDRLKEFEVLRIMNQVVQGILAMHALQPPLIHRDIKIENVLIAENGDCKVCDFGS 179

Query: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240
           V G+IRPPKNT E ++VQ DI+KNTTAQYR PEM+DLYRG  ++EKSDIWALGVFLYK+C
Sbjct: 180 VCGVIRPPKNTYELSYVQHDILKNTTAQYRAPEMIDLYRGFSVDEKSDIWALGVFLYKLC 239

Query: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300
           YYTTPFE  GE AIL A +Q+P YP YS+RLKNLI +ML E P  RPN CQVLEEV  +Q
Sbjct: 240 YYTTPFEKTGEVAILKANFQFPSYPQYSNRLKNLITVMLAENPIHRPNSCQVLEEVCRIQ 299

Query: 301 GIPCPLPNFYLQRQQATQL 319
           G PCP+ NFYL+R    Q+
Sbjct: 300 GQPCPVKNFYLERSLKQQI 318

>KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {ON}
           Anc_2.284 YNL020C
          Length = 592

 Score =  443 bits (1140), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 208/335 (62%), Positives = 255/335 (76%), Gaps = 8/335 (2%)

Query: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60
           MNQP+I  Y  GT L VG HQV IIKYLT+GGFAQIYQ  ++P +P +G N+ACLKRVIV
Sbjct: 1   MNQPNISTYPQGTTLTVGSHQVQIIKYLTAGGFAQIYQTTISPIDPFSGTNIACLKRVIV 60

Query: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120
           P+K  LN LRAEV+AM+LL+    VV YIDS+AA+S   +GTYEV  LME+C  GGLI+F
Sbjct: 61  PDKPSLNVLRAEVDAMKLLRNNRCVVSYIDSHAAKSSFQNGTYEVFLLMEYCENGGLINF 120

Query: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180
           +N+RLQNRLKE EV+NIM  V+QG+ AMH+L PPL+HRDIKIENVL+S N E+K+CDFGS
Sbjct: 121 LNSRLQNRLKESEVVNIMWSVSQGVAAMHALQPPLVHRDIKIENVLLSKNNEFKLCDFGS 180

Query: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240
           VSG IRPP N +E   VQ DIM+NTTAQYR PEM+D+ RG PI+EKSDIWALGVFLYKIC
Sbjct: 181 VSGPIRPPSNPQELALVQNDIMRNTTAQYRSPEMIDMSRGFPIDEKSDIWALGVFLYKIC 240

Query: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300
           YYTTPFE  GE  IL +RY++P +P YS RL++LI  +L  +P  RPN+  V++E+S M+
Sbjct: 241 YYTTPFEKSGEAGILTSRYEFPAFPAYSDRLRHLISKLLAVQPNHRPNIYDVVKELSDMK 300

Query: 301 GIPCPLPNFYLQRQ--------QATQLMMNNTNGS 327
            I CP+ NFYL+          Q    +MNNTN S
Sbjct: 301 NISCPIINFYLKPNMTDASNNIQHLHSIMNNTNTS 335

>Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {ON}
           YNL020C (REAL)
          Length = 632

 Score =  443 bits (1140), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 197/306 (64%), Positives = 253/306 (82%)

Query: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60
           MNQP I  Y+ GT+L VG HQV IIKYLTSGGFAQ+Y   ++PP+P    N+ACLKRVIV
Sbjct: 1   MNQPQIGTYNVGTQLTVGSHQVEIIKYLTSGGFAQVYSALISPPDPHTNSNVACLKRVIV 60

Query: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120
           P+K+ LNTLRAEV+AM+LL+   +VV YIDS+AA++  ++G+YEV  LME+C  GGLIDF
Sbjct: 61  PDKTSLNTLRAEVDAMKLLRNNRYVVSYIDSHAAKATLHNGSYEVFVLMEYCERGGLIDF 120

Query: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180
           MNTRLQNRL E E+L IM QVTQG+ AMH+L PPLIHRDIKIENVLIS+  EYK+CDFGS
Sbjct: 121 MNTRLQNRLHESEILQIMCQVTQGVAAMHALQPPLIHRDIKIENVLISAKNEYKLCDFGS 180

Query: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240
           V G+IRPP+N +E ++V+QD++KNTTAQYR PEM+D++RG PI+EKSDIWALG+FLYK+C
Sbjct: 181 VCGVIRPPRNPQELSYVEQDVLKNTTAQYRSPEMVDIFRGLPIDEKSDIWALGIFLYKLC 240

Query: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300
           YYTTPFE GGE AIL+ ++++  YP YS +L+NLI  +L++ P QRPNV Q+L+++++MQ
Sbjct: 241 YYTTPFEKGGEPAILNGQFEFLPYPNYSEQLRNLICKLLVQNPSQRPNVFQLLKQITNMQ 300

Query: 301 GIPCPL 306
             P P+
Sbjct: 301 NAPYPI 306

>Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa]
           {ON} complement(102096..104201) [2106 nt, 702 aa]
          Length = 701

 Score =  432 bits (1110), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 193/321 (60%), Positives = 245/321 (76%)

Query: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60
           MNQ  +  Y P T + VG H   I+KYL SGG+AQ+Y   V P +     N+ACLKRV+V
Sbjct: 1   MNQDQLPLYVPDTVVTVGSHTAKIVKYLASGGYAQVYSAYVTPVDYSPATNIACLKRVVV 60

Query: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120
           P+K  LN LRAEV+A+++L+ K +VV YIDS+A++   + G+YEV  LME+C GG LIDF
Sbjct: 61  PDKKSLNALRAEVDALKVLRNKKYVVSYIDSHASKHSGHTGSYEVFVLMEYCSGGSLIDF 120

Query: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180
           +NTRL+NRL+E E+L+IM QV  G+  MH L P LIHRDIKIEN+LIS NGEYKVCDFGS
Sbjct: 121 LNTRLKNRLREQEILHIMTQVAVGVAQMHELQPSLIHRDIKIENILISENGEYKVCDFGS 180

Query: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240
           V G+IRPP++ EE  ++Q DIMKNTTAQYR PEMLDL +G  INEKSDIWALGVFL+K+C
Sbjct: 181 VCGVIRPPRSYEEMKYIQHDIMKNTTAQYRSPEMLDLTKGYQINEKSDIWALGVFLFKLC 240

Query: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300
           YYTTPFE  GE+AIL +++QYP YP+YS  LKN+IR++L   P +RPN+CQ++EE+S +Q
Sbjct: 241 YYTTPFEKEGEKAILKSQFQYPAYPVYSDSLKNVIRVLLSVDPFKRPNICQLIEELSRLQ 300

Query: 301 GIPCPLPNFYLQRQQATQLMM 321
           GI  P+ NFYL R   T  +M
Sbjct: 301 GIVPPMKNFYLSRALETSSLM 321

>TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON}
           Anc_2.284 YNL020C
          Length = 1443

 Score =  442 bits (1136), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 203/329 (61%), Positives = 250/329 (75%), Gaps = 3/329 (0%)

Query: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQV-NPPNPINGM-NLACLKRV 58
           MNQP I  Y+ G  L +G HQV I KYL  GGFAQ+Y V+V +  N  N +  +ACLKRV
Sbjct: 1   MNQPEIPKYEKGRVLPIGTHQVIIEKYLACGGFAQVYSVRVIDSSNARNELGTMACLKRV 60

Query: 59  IVPEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLI 118
           IVP+KSGLNTLRAEV+AM+LLKG  ++V YIDS+A RS    G YEV  LME+C  GG+I
Sbjct: 61  IVPDKSGLNTLRAEVDAMKLLKGNKYIVSYIDSHAQRSELKQGEYEVFLLMEYCSRGGVI 120

Query: 119 DFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDF 178
           DF+NTRL +RL+EFE+L IM+ V QG+ AMH L PPLIHRDIKIENVLIS NG+YK+CDF
Sbjct: 121 DFLNTRLYHRLQEFEILKIMSDVCQGVAAMHYLQPPLIHRDIKIENVLISENGDYKICDF 180

Query: 179 GSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYK 238
           GS   ++RPPK  +E  F+  DIM NTTAQYR PEM+D Y G PI+EKSDIWALGVFLYK
Sbjct: 181 GSACSVLRPPKTPQEAAFIHHDIMINTTAQYRSPEMIDKYSGYPIDEKSDIWALGVFLYK 240

Query: 239 ICYYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSS 298
           +CYYTTPFE  GE AIL+ ++Q+P YP YS  ++N+I +ML + P +RPN+CQVLE+VS 
Sbjct: 241 LCYYTTPFEKEGENAILNVKFQFPSYPQYSDHIRNIITIMLNKDPIKRPNICQVLEQVSK 300

Query: 299 MQGIPCPLPNFYLQRQQATQLMMNNTNGS 327
           +QG+PCP+ NF L R +  Q   NN+N S
Sbjct: 301 LQGVPCPIENFMLTRIKL-QNSRNNSNKS 328

>CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} similar
           to uniprot|P53974 Saccharomyces cerevisiae YNL020c ARK1
           or uniprot|P40494 Saccharomyces cerevisiae YIL095w PRK1
          Length = 622

 Score =  420 bits (1079), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 193/324 (59%), Positives = 241/324 (74%)

Query: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60
           MN PHI  Y+PGT + VG H V I+KYLTSGG+AQIY  Q+ P +   G N+A LKRVIV
Sbjct: 1   MNTPHIPKYEPGTTVTVGSHSVHILKYLTSGGYAQIYSAQIMPADQFLGTNMAVLKRVIV 60

Query: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120
           P+KS LNTLRAEV+AM+ LK   ++V YIDS+AA+S   DGTYEV  +ME+C  GGLIDF
Sbjct: 61  PDKSHLNTLRAEVDAMKRLKHHKYIVSYIDSHAAKSQYMDGTYEVFLIMEYCSRGGLIDF 120

Query: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180
           MNTRLQNRL E E+L I   ++QG+ AMH+L PPLIHRDIKIENVLIS++ +YK+CDFGS
Sbjct: 121 MNTRLQNRLTETEILTIQLHISQGVAAMHTLQPPLIHRDIKIENVLISNDHKYKLCDFGS 180

Query: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240
           VSG IRPPK  EE  +V+ DIM +TTAQYR PEMLDL +G  +N+KSDIWALGVFLYK+C
Sbjct: 181 VSGYIRPPKTPEELAYVRHDIMMSTTAQYRAPEMLDLTKGFSVNDKSDIWALGVFLYKLC 240

Query: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300
           YYTTPFE  GE  IL+   ++P YP YS  +K LI  ML + P  RPN+ Q+++ VS + 
Sbjct: 241 YYTTPFEQTGEAGILNGGVEFPPYPHYSDAVKQLIMSMLAKNPLHRPNIFQIIQTVSKLL 300

Query: 301 GIPCPLPNFYLQRQQATQLMMNNT 324
            + CP+PN ++    +  +  NNT
Sbjct: 301 NVNCPIPNIHVPTDISIAVSNNNT 324

>KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {ON}
           Anc_2.284 YNL020C
          Length = 788

 Score =  413 bits (1061), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 200/327 (61%), Positives = 242/327 (74%), Gaps = 11/327 (3%)

Query: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60
           MNQP I NY PG  + VG HQ  I+KYLTSGGFAQIY V+++P +     N+ACLKRVIV
Sbjct: 1   MNQPVIPNYPPGFVIKVGSHQAKILKYLTSGGFAQIYSVEISPKDEYTNSNIACLKRVIV 60

Query: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120
           P KSGLN LR EV+AM+LLK   HVV YIDSNAA+S   +G+YEV  LME+C  G L+DF
Sbjct: 61  PNKSGLNVLRTEVDAMKLLKNNRHVVSYIDSNAAKSEFGNGSYEVFLLMEYCERGSLLDF 120

Query: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180
           MNT+L+ RL+E EVLNIMNQV QGI AMH L PPLIHRDIKIENVLIS +G +KVCDFGS
Sbjct: 121 MNTKLRERLQEQEVLNIMNQVCQGIAAMHKLLPPLIHRDIKIENVLISGDGLFKVCDFGS 180

Query: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYK-- 238
           V GIIRPP+N +E  +VQ D+MKNTTAQYR PEM+DL +G PI  K  I  LG +     
Sbjct: 181 VCGIIRPPRNPQELQYVQHDVMKNTTAQYRSPEMIDLVKGFPIERK--IRHLGSWCVALQ 238

Query: 239 --ICYYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEV 296
             + +YT  F    E AIL+ RYQYP YP+YS RLKN++R++L   P +RPN+CQ+LEE+
Sbjct: 239 IMLLHYT--FREDREVAILNGRYQYPAYPIYSDRLKNVVRVLLSPHPVKRPNICQLLEEI 296

Query: 297 SSMQGIPCPLPNFYLQR---QQATQLM 320
           S +Q IPCP+ NFYL+R   Q A  +M
Sbjct: 297 SKIQNIPCPIDNFYLERSRHQGAVSVM 323

>TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {ON}
           Anc_2.284 YNL020C
          Length = 707

 Score =  400 bits (1028), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 186/331 (56%), Positives = 239/331 (72%), Gaps = 1/331 (0%)

Query: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIV 60
           M+Q     Y  GTKL V  H+V I  YLTSGGFAQ+Y  ++   +      L CLKRVIV
Sbjct: 1   MSQIFEDKYKKGTKLQVASHEVIIENYLTSGGFAQVYTARITSEHKNLYPELTCLKRVIV 60

Query: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120
           P K  LN LRAEV+AM++LK   ++V YIDS+A R  +++ +Y VL LME+C G GL+DF
Sbjct: 61  PNKQSLNILRAEVDAMKILKNNKYIVSYIDSHANRLQNSEDSYVVLLLMEYCSGAGLLDF 120

Query: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180
           MN RL+ RLKE E+L IM  V+QG+  MH L PPL+HRDIKIENVL+S +G +K+CDFGS
Sbjct: 121 MNLRLKERLKEEEILKIMTDVSQGVYHMHQLQPPLLHRDIKIENVLLSGDGNFKLCDFGS 180

Query: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240
           VSG++R P ++EEF ++Q DI+KNTTAQYR PEM++L  G PINEKSDIWALG+ LYK+C
Sbjct: 181 VSGVLRSPTSSEEFVYLQNDILKNTTAQYRSPEMVNLALGFPINEKSDIWALGILLYKLC 240

Query: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300
           YYTTPFE  G RAI+  ++ YP YP Y+  LKN+IR++L   P QRPN+CQ+LEE+  +Q
Sbjct: 241 YYTTPFEEHGSRAIMEGKFTYPAYPQYTDSLKNIIRVLLSTNPIQRPNICQLLEELFRIQ 300

Query: 301 GIPCPLPNFYLQRQQATQLMMNNTNGSIYPI 331
               PLPNFY+QR  ++ L M+ T     PI
Sbjct: 301 HKSSPLPNFYVQRAMSS-LQMDTTQPHRIPI 330

>Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON}
           (72364..75669) [3306 nt, 1102 aa]
          Length = 1101

 Score =  323 bits (828), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 159/317 (50%), Positives = 209/317 (65%), Gaps = 11/317 (3%)

Query: 6   IKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQV----------NPPNPINGMNLACL 55
           ++ +  G+ + VG  +V I+KYLT GGFAQIY V+           N   P+   +LACL
Sbjct: 22  VEKFANGSTVVVGNKKVEIVKYLTEGGFAQIYIVKFLENSNEFDSNNSNIPLKIGDLACL 81

Query: 56  KRVIVPEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGG 115
           KRV+V +++GLN +R EVE M+LLKG P++V Y DSNA+R       +EVL LME CP  
Sbjct: 82  KRVLVQDENGLNEMRNEVEVMKLLKGAPNIVQYFDSNASRRKDGTNGFEVLLLMELCPNK 141

Query: 116 GLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKV 175
            L+DFMN RL  +L E E+L IM+ VT  +  MH+L+PPLIHRDIKIENVL+ S   +K+
Sbjct: 142 SLLDFMNQRLTTKLSEKEILTIMHDVTLAVAQMHTLSPPLIHRDIKIENVLVDSQNGFKL 201

Query: 176 CDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVF 235
            DFGS S         ++   + QDI  +TT QYR PEM+DLY+  PI+EKSDIWALG+F
Sbjct: 202 ADFGSTSKCFPAVSAHQDIAILSQDIFMHTTPQYRSPEMIDLYKCLPIDEKSDIWALGIF 261

Query: 236 LYKICYYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEE 295
           LYK+ +Y TPFE  G+ AILH++Y +PQ   YSSRL NLI +ML E P  RPN+ QVL E
Sbjct: 262 LYKLLFYITPFEMTGQFAILHSKYDFPQT-NYSSRLINLIIIMLSENPNLRPNIYQVLHE 320

Query: 296 VSSMQGIPCPLPNFYLQ 312
           + S+ G    + + Y Q
Sbjct: 321 ICSISGTRLEITDKYGQ 337

>KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {ON}
           Anc_3.273 YBR059C
          Length = 912

 Score =  316 bits (809), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 164/323 (50%), Positives = 207/323 (64%), Gaps = 22/323 (6%)

Query: 9   YDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQV--------NPPN-------------PI 47
           ++PG  + VG H+V IIKYL  GGFAQIY V          N P+              +
Sbjct: 19  FNPGAVVAVGRHKVEIIKYLAEGGFAQIYSVNFIEYLNEFSNEPDSTEDSNIDEFQQFKL 78

Query: 48  NGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQ 107
              NLACLKRV+VP+++GLN LR EV  M+ LKG P++V Y DSNA+R    +  +EVL 
Sbjct: 79  EPGNLACLKRVMVPDENGLNELRNEVNVMRKLKGTPNIVQYYDSNASRRHDGNPGFEVLL 138

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLI 167
           LME CP   L+D+MN RL  +L E E+L IM  VT GI  MH L  PLIHRDIKIENVL+
Sbjct: 139 LMELCPNNSLLDYMNQRLTTKLSEKEILKIMYDVTLGISQMHYLQKPLIHRDIKIENVLV 198

Query: 168 SSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKS 227
            S+  +K+CDFGS S       + +E   + Q+I  +TT QYR PEM+DLYR  PI+EKS
Sbjct: 199 DSSNNFKLCDFGSTSACFPIVTSHQEIAVLTQNIYVHTTPQYRSPEMIDLYRNLPIDEKS 258

Query: 228 DIWALGVFLYKICYYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRP 287
           DIWALGVFLYK+ +YTTPFE  G+ AILH++Y+ P    YSSRL NLI +ML E P  RP
Sbjct: 259 DIWALGVFLYKLLFYTTPFEMTGQFAILHSKYEIPPN-NYSSRLINLIIIMLAENPNLRP 317

Query: 288 NVCQVLEEVSSMQGIPCPLPNFY 310
           N+ QV+ +V    GI  P+ + Y
Sbjct: 318 NIYQVMHQVCITIGIEPPIKDKY 340

>Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)
           [2517 nt, 839 aa]
          Length = 838

 Score =  314 bits (804), Expect = 8e-95,   Method: Compositional matrix adjust.
 Identities = 160/318 (50%), Positives = 208/318 (65%), Gaps = 18/318 (5%)

Query: 6   IKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQ-------VNPPNPINGMNLA----- 53
           + +Y PGT + VGIH+V ++KYL  GGFA+IY V+       V+P    NG  +      
Sbjct: 26  LDSYVPGTIVIVGIHKVEVVKYLAEGGFAKIYVVKFLEYLSTVDP----NGKEVLQNGDQ 81

Query: 54  -CLKRVIVPEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFC 112
            CLKRV+V + +GLN +R EVE M+ LKG P VV Y DSNA+R I     YEVL LME C
Sbjct: 82  LCLKRVLVQDDNGLNEMRNEVEVMRKLKGAPCVVQYYDSNASRRIDGAPGYEVLLLMELC 141

Query: 113 PGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGE 172
               L+D+MN RL  +L E E+L IM  VT  +  MH L  PLIHRDIKIENVL+ S   
Sbjct: 142 SNNSLLDYMNQRLATKLSEDEILKIMFDVTLAVAQMHYLPSPLIHRDIKIENVLVDSKNN 201

Query: 173 YKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWAL 232
           +K+CDFGS S  +    + ++   + Q+I  +TT QYR PEM+DLYR  P+NEKSDIWAL
Sbjct: 202 FKLCDFGSTSTCLPIVSSHQDIAILTQNIYVHTTPQYRSPEMIDLYRCLPVNEKSDIWAL 261

Query: 233 GVFLYKICYYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQV 292
           GVFLYK+ +YTTPFE  G+ AILH++Y++P    YSS+L NLI +ML E P  RPN+ QV
Sbjct: 262 GVFLYKLMFYTTPFERTGQFAILHSKYEFP-LNNYSSKLINLIIVMLAENPNLRPNIYQV 320

Query: 293 LEEVSSMQGIPCPLPNFY 310
           L ++  + GI  P+ + Y
Sbjct: 321 LNQICYISGIKNPMDDAY 338

>KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa]
           {ON} Anc_3.273 YBR059C
          Length = 1091

 Score =  318 bits (815), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 159/322 (49%), Positives = 215/322 (66%), Gaps = 20/322 (6%)

Query: 6   IKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQV----NPPNPINGMN---------- 51
           I+ +  G  + VG H V I+KYLT GGFAQIY V++    N  + I+  N          
Sbjct: 26  IEKFSAGESVAVGSHGVEIVKYLTEGGFAQIYLVKLTEYLNEFDAIDIQNQRQQQELKIG 85

Query: 52  -LACLKRVIVPEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLME 110
            L CLKRV+V +++GL+ ++ EV  M+ L+GKP+VV Y DSNA R+   +G +EV  LME
Sbjct: 86  DLVCLKRVMVYDEAGLSEMKNEVNVMKQLRGKPNVVQYYDSNATRNRGANGGFEVFLLME 145

Query: 111 FCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSN 170
           +CP   L+D+MN RL  +L E E+LNIM  +T G+  +H L+ PLIHRDIKIENVL+  N
Sbjct: 146 YCPNKSLLDYMNQRLTTKLTESEILNIMYDITLGVSQLHFLDNPLIHRDIKIENVLVDHN 205

Query: 171 GEYKVCDFGSVSGIIRPPKNT--EEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSD 228
             +K+CDFGS +  I PP  T  ++ + +  DI  +TT QYR PEM+DL+R  P+NEK+D
Sbjct: 206 NRFKLCDFGSTN--ICPPIATTNQDISVLTHDIYVHTTPQYRSPEMIDLFRCLPVNEKAD 263

Query: 229 IWALGVFLYKICYYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPN 288
           IWALGVFLYK+ +YTTPFE  G+ AILH++Y+ PQ   YS RL NLI +ML E P  RPN
Sbjct: 264 IWALGVFLYKLLFYTTPFELTGQFAILHSKYEIPQS-HYSERLLNLIVVMLAENPNLRPN 322

Query: 289 VCQVLEEVSSMQGIPCPLPNFY 310
           + QVL E+ S+  +  P+P+ Y
Sbjct: 323 IYQVLSEICSILNVEVPIPDIY 344

>CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa]
           {ON} similar to uniprot|P38080 Saccharomyces cerevisiae
           YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 1027

 Score =  315 bits (807), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 155/320 (48%), Positives = 210/320 (65%), Gaps = 11/320 (3%)

Query: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQ----------VNPPNPINGM 50
           +N P+ + Y  G  ++VG H+V I+ YL  GGFAQIY V+          +   + I   
Sbjct: 12  LNSPNEEKYPNGQMISVGAHRVEIVSYLAEGGFAQIYVVKFVEYLNEFESLGSKSAITVG 71

Query: 51  NLACLKRVIVPEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLME 110
           ++ACLKRVIV ++ GLN +R EVE M+ LK  P++V Y DSNA+R       +EVL LME
Sbjct: 72  DIACLKRVIVNDEMGLNEMRNEVEVMKKLKSSPNIVQYFDSNASRRTDGKPGFEVLLLME 131

Query: 111 FCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSN 170
            CP   L+D+MN RL+ +L E E+L IM  V+ GI  MH L+ PLIHRDIKIENVL+ +N
Sbjct: 132 LCPNKSLLDYMNQRLKTKLSESEILKIMYDVSIGISNMHYLDQPLIHRDIKIENVLVDAN 191

Query: 171 GEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIW 230
             +K+CD GS S    P  + ++   + Q+I  +TT QYR PEM+DLYR  PINEKSDIW
Sbjct: 192 NNFKLCDMGSTSQCSPPMMSNQDIAMMTQNIYVHTTPQYRAPEMIDLYRYLPINEKSDIW 251

Query: 231 ALGVFLYKICYYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVC 290
           ALG+FLYK+ +YTTPFE  G+ AILH++Y +P    YSS++ NLI +ML E P  RPN+ 
Sbjct: 252 ALGIFLYKLLFYTTPFEITGQMAILHSKYDFPPN-KYSSKIINLIIIMLAENPNLRPNIF 310

Query: 291 QVLEEVSSMQGIPCPLPNFY 310
           QV+  + S+  +P P+ + Y
Sbjct: 311 QVVYHICSIMNLPVPIEDRY 330

>TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1061

 Score =  315 bits (806), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 160/317 (50%), Positives = 204/317 (64%), Gaps = 15/317 (4%)

Query: 8   NYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQ--------VNPPN------PINGMNLA 53
           NY  GT + VG H+V +IKY+  GGFAQIY V+         + P       P+   ++A
Sbjct: 98  NYPAGTPVAVGSHKVEVIKYIAEGGFAQIYTVKFIERLNEFASLPGGNQNQKPLQPGDIA 157

Query: 54  CLKRVIVPEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCP 113
           CLKRV+V + +GLN +R EV  MQ L+G P VV Y DSNA+    +   YEVL LMEFCP
Sbjct: 158 CLKRVLVNDDNGLNEMRNEVNVMQKLQGAPCVVQYYDSNASHRSDSAPGYEVLLLMEFCP 217

Query: 114 GGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEY 173
              L+D+MN RL  RL E E++ IM   T GI  +H L  PLIHRDIKIENVL+     +
Sbjct: 218 NNSLLDYMNDRLATRLSEKEIMKIMYDTTLGIAQLHYLKTPLIHRDIKIENVLVDQENNF 277

Query: 174 KVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALG 233
           K+CDFGS S       N  +     Q+I  NTT QYR PEM+DLYR QPI+EKSDIWALG
Sbjct: 278 KLCDFGSTSICFPIVTNHRDIAIFTQNIYVNTTPQYRSPEMIDLYRYQPIDEKSDIWALG 337

Query: 234 VFLYKICYYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVL 293
           VFLYK+ ++TTPFE  G+ AILH++Y++P+   YSS+L NLI +ML E P  RPN+ QVL
Sbjct: 338 VFLYKLLFFTTPFERTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPSVRPNIYQVL 396

Query: 294 EEVSSMQGIPCPLPNFY 310
           + + S+ G   PL + Y
Sbjct: 397 QYLCSINGWKVPLNDKY 413

>SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 858

 Score =  308 bits (788), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 154/315 (48%), Positives = 201/315 (63%), Gaps = 9/315 (2%)

Query: 4   PHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQV--------NPPNPINGMNLACL 55
           P ++   PGT + VG H+V I+KYL  GGFA IY V+          P + +   +LACL
Sbjct: 27  PTLEKLAPGTLIIVGSHKVEIVKYLAEGGFAHIYVVKFVEFSNELETPSSSLKEGDLACL 86

Query: 56  KRVIVPEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGG 115
           KRV+V +++GLN LR EVE M+ LK   ++V Y DSNA+R       YEVL LME CP  
Sbjct: 87  KRVLVTDENGLNELRNEVEVMKQLKNSDNIVQYYDSNASRRRDGSPGYEVLLLMELCPNK 146

Query: 116 GLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKV 175
            L+D+MN RL  +L E EVL IM  VT+ +  MH L  PLIHRDIKIENVL+ S   +K+
Sbjct: 147 SLLDYMNQRLATKLSEKEVLKIMYDVTKAVAQMHFLPTPLIHRDIKIENVLVDSENNFKL 206

Query: 176 CDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVF 235
           CDFGS S         ++   +  +I  +TT QYR PEM+DLYR  PI+EKSDIWALG+F
Sbjct: 207 CDFGSTSSCFPIMTTHQDIALLTNNIYVHTTPQYRAPEMIDLYRCLPIDEKSDIWALGIF 266

Query: 236 LYKICYYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEE 295
           LYK+ +YTTPFE  G+ AILH++Y  P    YSS+L NLI +ML E P  RPN+ QV+ +
Sbjct: 267 LYKLLFYTTPFELTGQFAILHSKYDIPAN-NYSSKLINLIIIMLAENPNLRPNIYQVIYQ 325

Query: 296 VSSMQGIPCPLPNFY 310
           V ++  +  P  + Y
Sbjct: 326 VCAIMKVDVPFEDKY 340

>NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]
           {ON} Anc_3.273
          Length = 1095

 Score =  311 bits (797), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 155/320 (48%), Positives = 213/320 (66%), Gaps = 11/320 (3%)

Query: 3   QPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQV---------NPPNPINGM-NL 52
           +P+ + Y PGT++ VG H+V IIKY+  GGFAQIY V+          N   P   M ++
Sbjct: 16  KPNNERYTPGTQVAVGAHKVEIIKYIAEGGFAQIYAVKFIEFLNEFENNRMKPKLQMGDV 75

Query: 53  ACLKRVIVPEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFC 112
           ACLKRV+V +++GLN +R EVE M+ L+G P++V Y DSNA+R  +    +EVL LME C
Sbjct: 76  ACLKRVLVQDENGLNEMRNEVEVMKQLQGAPNIVQYYDSNASRRHNGFPGFEVLLLMELC 135

Query: 113 PGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGE 172
           P   L+D+MN RL  +L E E+L IM  VT  +  MH L  PL+HRDIKIENVL+ +   
Sbjct: 136 PNKSLLDYMNQRLATKLTEKEILKIMYDVTYAVSQMHYLPTPLLHRDIKIENVLVDAQNN 195

Query: 173 YKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWAL 232
           +K+CDFGS S         ++   + Q+I  +TT QYR PEM+DLYR  PI+EKSDIWAL
Sbjct: 196 FKLCDFGSTSTKFPMVTTHQDIAVLTQNIYVHTTPQYRSPEMIDLYRCLPIDEKSDIWAL 255

Query: 233 GVFLYKICYYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQV 292
           G+FLYK+ ++TTPFE  G+ AILH++Y++P+   YSS+L NLI +ML E P  RPN+ QV
Sbjct: 256 GIFLYKLLFFTTPFELTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPNLRPNIYQV 314

Query: 293 LEEVSSMQGIPCPLPNFYLQ 312
           L  + S+ G+  P+ + Y +
Sbjct: 315 LHNICSISGMKVPIEDQYAE 334

>Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {ON}
           YBR059C (REAL)
          Length = 1108

 Score =  308 bits (788), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 153/321 (47%), Positives = 204/321 (63%), Gaps = 10/321 (3%)

Query: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQV---------NPPNPINGMN 51
           M  P ++ + PG  + VG H+V +I YL  GGFAQIY V+              P+   +
Sbjct: 14  MGHPAVERFTPGHIVCVGTHKVEVINYLAEGGFAQIYMVKFVEYLNEFDNAASVPLKIGD 73

Query: 52  LACLKRVIVPEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEF 111
           +ACLKRV+V +++GLN +R EVE M+ LKG P+VV Y DSNA+R       +EVL LME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNG 171
           CP   L+D+MN RL  +L E E++ IM  V   I  MH L  PLIHRDIKIENVL+ +N 
Sbjct: 134 CPNKSLLDYMNQRLSTKLTESEIVKIMYDVVLSISQMHYLPVPLIHRDIKIENVLVDANN 193

Query: 172 EYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWA 231
            +K+ DFGS S         ++   + Q+I  +TT QYR PEM+DLYR  PINEKSDIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKICYYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQ 291
           LG+FLYK+ ++TTPFE  G+ AILH++Y++P    YSS+L NLI +ML E P  RPN+ Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 VLEEVSSMQGIPCPLPNFYLQ 312
           VL  +  +  I  P+ + Y +
Sbjct: 313 VLYHLCEILNIEVPIEDKYTE 333

>NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON}
           Anc_3.273
          Length = 1157

 Score =  308 bits (789), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 153/328 (46%), Positives = 209/328 (63%), Gaps = 25/328 (7%)

Query: 9   YDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQV----------------------NPPNP 46
           +  GT++ VG H+V IIKY+  GGFAQIY V+                         PNP
Sbjct: 24  FPAGTQVAVGSHKVEIIKYIAEGGFAQIYAVKYVESLNEFEDSNTDENAHLSGDRQAPNP 83

Query: 47  --INGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYE 104
             +   ++ACLKRV+V +++GLN +R EVE M+ LKG P+VV Y DSNA+R  +    +E
Sbjct: 84  MILKLGDIACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNVVQYFDSNASRRHNGASGFE 143

Query: 105 VLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIEN 164
           VL LME CP   L+D+MN RL  +L E E+L IM  +T  +  MH L  PL+HRDIKIEN
Sbjct: 144 VLLLMELCPNKSLLDYMNQRLTTKLTEHEILKIMYDITFAVSHMHYLKIPLLHRDIKIEN 203

Query: 165 VLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPIN 224
           VL+ +   +K+CDFGS S  +      ++   + Q+I  +TT QYR PEM+DLYR  PI+
Sbjct: 204 VLVDAQNNFKLCDFGSTSTRLPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPID 263

Query: 225 EKSDIWALGVFLYKICYYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPE 284
           EKSDIWALG+FLYK+ ++ TPFE  G+ AILH++Y++P+   YSS+L NLI +ML E P 
Sbjct: 264 EKSDIWALGIFLYKLLFFITPFEMTGQFAILHSKYEFPKN-NYSSKLINLIIIMLAENPN 322

Query: 285 QRPNVCQVLEEVSSMQGIPCPLPNFYLQ 312
            RPN+ QVL+ + SM  +  P+ + Y Q
Sbjct: 323 LRPNIYQVLDNICSMMNVEVPIEDIYEQ 350

>ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 1115

 Score =  306 bits (785), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 151/319 (47%), Positives = 203/319 (63%), Gaps = 10/319 (3%)

Query: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQV---------NPPNPINGMN 51
           + +P +  Y PGT + VG  QV II ++  GGFAQIY V+              P+   +
Sbjct: 14  VTKPVVDGYAPGTVVAVGNQQVEIISFIAEGGFAQIYSVKYIKFLGEFNNGSKAPLQPGD 73

Query: 52  LACLKRVIVPEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEF 111
           +ACLKRV+VP+++GL+ +R EVE M+ L+G   ++ Y DSNA+R  S    YEVL LME 
Sbjct: 74  IACLKRVLVPDENGLSEMRNEVEVMKQLRGAKAIIQYYDSNASRRTSGQVGYEVLLLMEL 133

Query: 112 CPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNG 171
           CP   L+D+MN RL  RL E E+L +M   T  I  MH L  PLIHRDIKIENVL+ +  
Sbjct: 134 CPNNSLLDYMNQRLATRLTEKEILKVMYDTTLAISQMHYLPIPLIHRDIKIENVLVDAQN 193

Query: 172 EYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWA 231
            +K+CDFGS S         ++   + Q+I  NTT QYR PEM+DLYR  PINEKSDIWA
Sbjct: 194 NFKLCDFGSTSTCFPLVTTHQDIAILTQNIYVNTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKICYYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQ 291
           LG+FLYK+ ++ TPFE  G+ +ILH++Y++P    YSS+L NLI +ML E P  RPN+ Q
Sbjct: 254 LGIFLYKLLFFITPFEMTGQFSILHSKYEFPAN-KYSSKLINLIIIMLAENPYVRPNIYQ 312

Query: 292 VLEEVSSMQGIPCPLPNFY 310
           V+  + S+ G   P+ + Y
Sbjct: 313 VMHHICSVIGCEVPIEDKY 331

>TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {ON}
           Anc_3.273 YBR059C
          Length = 788

 Score =  300 bits (768), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 154/341 (45%), Positives = 206/341 (60%), Gaps = 16/341 (4%)

Query: 6   IKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIY---------QVQVNPPNPINGMNLACLK 56
           I  Y PG  + VGIH+V IIKYL  GGFA+IY         Q+ +N    +   +L CLK
Sbjct: 96  IDTYVPGHIVEVGIHKVEIIKYLAEGGFAKIYVAKFLQYIKQIDINKIQVLQPGDLICLK 155

Query: 57  RVIVPEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGG 116
           RV+V + +GLN +R EV  M+ L G P++V   DSNA+R       YEVL LME C    
Sbjct: 156 RVLVTDDNGLNEMRNEVSVMKKLIGAPNIVQLYDSNASRRTDGIAGYEVLLLMELCSNKS 215

Query: 117 LIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVC 176
           L+D+MN RL  +L E E+L IM  VT  +  MH L  PLIHRDIKIENVL+ S   +K+C
Sbjct: 216 LLDYMNQRLAVKLTEPEILKIMFDVTLAVAQMHYLPIPLIHRDIKIENVLVDSQNNFKLC 275

Query: 177 DFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFL 236
           DFGS S  +       +   + Q++  +TT QYR PEM+D+YR   INEKSDIWALG+FL
Sbjct: 276 DFGSTSTCMPIATTHRDMAALTQNLYVHTTPQYRSPEMIDVYRCIHINEKSDIWALGIFL 335

Query: 237 YKICYYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEV 296
           YK+ +Y TPFE  G+ AILH++Y++PQ+  YS +L NLI +ML E P  RPN+ QVL  +
Sbjct: 336 YKLLFYITPFERTGQFAILHSKYEFPQHS-YSMKLINLIIIMLAENPNLRPNIYQVLAYI 394

Query: 297 SSMQGIPCPLPNFY------LQRQQATQLMMNNTNGSIYPI 331
             +  I  P+ + Y       Q+    Q  + N+   +Y +
Sbjct: 395 CKIINIKTPIDDIYGLGPYDFQKYTNYQTALQNSQNQMYQV 435

>KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some
           similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059C AKL1 Serine-threonine protein kinase
           member (with Ark1p and Prk1p) of the Ark kinase family
          Length = 814

 Score =  300 bits (769), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 149/310 (48%), Positives = 200/310 (64%), Gaps = 11/310 (3%)

Query: 11  PGTKLNVGIHQVSIIKYLTSGGFAQIYQVQ----VNPPNP------INGMNLACLKRVIV 60
           P T++ VG H+  I+++L  GGFA IY+V+     N  +       +   ++ACLKRVIV
Sbjct: 31  PNTQVVVGTHRCEILEHLAEGGFANIYKVKFLELTNEMDAGIDSKLLKAGDIACLKRVIV 90

Query: 61  PEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDF 120
           P+++GLN LR EVE M+ L+G P++V Y DSNA+R       +E+L LME CP   L+D+
Sbjct: 91  PDENGLNELRNEVETMKQLRGSPNIVQYYDSNASRHPDGSPGFEILLLMELCPKKSLLDY 150

Query: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180
           MN +L  +L E E+L IM  V+  I  MH L  PLIHRDIKIENVL+  +  +K+CDFGS
Sbjct: 151 MNNKLATKLTEAEILKIMYDVSNAIAQMHYLPTPLIHRDIKIENVLVDKDDNFKLCDFGS 210

Query: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKIC 240
            S         ++   +  +I  +TT QYR PEM+DLYR  PINEKSDIWALG+FLYK+ 
Sbjct: 211 TSMCFPIVSTHQDIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLL 270

Query: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300
           +YTTPFE  G+ AILH++Y+ PQ   YSS+L NLI +ML E P  RPN+ QV+  V S+ 
Sbjct: 271 FYTTPFELTGQFAILHSKYEIPQN-GYSSKLINLIIIMLAENPSLRPNIYQVMHHVCSIL 329

Query: 301 GIPCPLPNFY 310
               P  + Y
Sbjct: 330 KCDVPFTDKY 339

>Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {ON}
           YBR059C (REAL)
          Length = 1090

 Score =  305 bits (780), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 152/321 (47%), Positives = 202/321 (62%), Gaps = 10/321 (3%)

Query: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQV---------NPPNPINGMN 51
           M  P ++ Y PG  + VG H+V I+ YL  GGFAQIY V+              P+   +
Sbjct: 14  MGHPAVERYTPGDIVCVGTHKVEIVNYLAEGGFAQIYVVKFLEYLNEFDNAASVPLKIGD 73

Query: 52  LACLKRVIVPEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEF 111
           LACLKRV+V +++GLN +R EVE M+ LKG  +VV Y DSNA+R       +EVL LME 
Sbjct: 74  LACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNG 171
           CP   L+D+MN RL  +L E E++ IM  V   I  MH L  PLIHRDIKIENVL+ +  
Sbjct: 134 CPNKSLLDYMNQRLSTKLTETEIVKIMYDVALSISQMHYLPVPLIHRDIKIENVLVDAKD 193

Query: 172 EYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWA 231
            +K+ DFGS S         ++   + Q+I  +TT QYR PEM+DLYR  PINEKSDIWA
Sbjct: 194 SFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKICYYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQ 291
           LG+FLYK+ ++TTPFE  G+ AILH++Y++P    YSS+L NLI +ML E P  RPN+ Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 VLEEVSSMQGIPCPLPNFYLQ 312
           VL  +  +  +  P+ + Y +
Sbjct: 313 VLCHLCDILNVEVPIEDKYAE 333

>TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3.273
           YBR059C
          Length = 1049

 Score =  303 bits (777), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 149/316 (47%), Positives = 204/316 (64%), Gaps = 10/316 (3%)

Query: 4   PHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQV---------NPPNPINGMNLAC 54
           P ++ + PG  + VG H+V ++ YL  GGFAQIY V+              P+   ++AC
Sbjct: 17  PTMERFLPGAVVAVGTHRVEVVNYLAEGGFAQIYVVKFLEYLNEFENKSKVPMKVGDVAC 76

Query: 55  LKRVIVPEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPG 114
           LKRV+V +++GL+ +R EVE M+ L G  ++V Y DSNA R  + +  +EVL LME CP 
Sbjct: 77  LKRVLVQDENGLSEMRNEVEVMKQLMGAQNIVQYYDSNACRRHNGNAGFEVLLLMELCPN 136

Query: 115 GGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYK 174
             L+D+MN RL  +L E E+L IM  V+  +  MH L  PLIHRDIKIENVL+ +   +K
Sbjct: 137 KSLLDYMNQRLATKLTEKEILKIMYDVSLAVSQMHYLKNPLIHRDIKIENVLVDAQNSFK 196

Query: 175 VCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGV 234
           +CDFGS S         +E   + Q+I  +TT QYRCPEM+DLYR  PINEKSDIWALG+
Sbjct: 197 LCDFGSTSQCFPVVTTHQEIAILTQNIYVHTTPQYRCPEMIDLYRCLPINEKSDIWALGI 256

Query: 235 FLYKICYYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLE 294
           FLYK+ ++ TPFE  G+ AILH++Y++P    YSS+L NLI +ML E P  RPN+ QVL 
Sbjct: 257 FLYKLLFFITPFEMTGQFAILHSKYEFPPN-HYSSQLINLIIIMLAENPFVRPNIYQVLN 315

Query: 295 EVSSMQGIPCPLPNFY 310
            + +M G+  P+ + Y
Sbjct: 316 HICTMIGVEVPIEDKY 331

>YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON}
           AKL1Ser-Thr protein kinase, member (with Ark1p and
           Prk1p) of the Ark kinase family; involved in endocytosis
           and actin cytoskeleton organization
          Length = 1108

 Score =  303 bits (776), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 150/321 (46%), Positives = 202/321 (62%), Gaps = 10/321 (3%)

Query: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQV---------NPPNPINGMN 51
           M  P ++ Y PG  + VG H+V ++ YL  GGFAQIY V+              P+   +
Sbjct: 14  MGHPAVERYTPGHIVCVGTHKVEVVNYLAEGGFAQIYVVKFLEYLNEFDNTASVPLKIGD 73

Query: 52  LACLKRVIVPEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEF 111
           +ACLKRV+V +++GLN +R EVE M+ LKG P++V Y DSNA+R       +EVL LME 
Sbjct: 74  VACLKRVLVQDENGLNEMRNEVEVMKKLKGAPNIVQYFDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNG 171
           CP   L+D+MN RL  +L E E++ IM  V   I  MH L   LIHRDIKIENVL+ +  
Sbjct: 134 CPNKSLLDYMNQRLSTKLTEAEIVKIMYDVALSISQMHYLPVSLIHRDIKIENVLVDAKN 193

Query: 172 EYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWA 231
            +K+ DFGS S         ++   + Q+I  +TT QYR PEM+DLYR  PINEKSDIWA
Sbjct: 194 NFKLADFGSTSTCFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKICYYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQ 291
           LGVFLYK+ ++TTPFE  G+ AILH++Y++P    YSS+L NLI +ML E P  RPN+ Q
Sbjct: 254 LGVFLYKLLFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 VLEEVSSMQGIPCPLPNFYLQ 312
           VL  +  +  +  P+ + Y +
Sbjct: 313 VLYHLCEILNVEVPIEDKYAE 333

>Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {ON}
           similar to Ashbya gossypii AGR027C
          Length = 894

 Score =  299 bits (765), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 155/309 (50%), Positives = 201/309 (65%), Gaps = 9/309 (2%)

Query: 12  GTKLNVGIHQVSIIKYLTSGGFAQIYQVQ-VNPPNPINGM-------NLACLKRVIVPEK 63
           G+ L VG+H+V II+YL  GGFA IY+V  +   N ++         ++ACLKRV V ++
Sbjct: 31  GSILLVGVHRVEIIEYLAEGGFAHIYKVSFIEYTNELDRHHSVLQRGDIACLKRVQVNDE 90

Query: 64  SGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNT 123
           +GLN LR EVE M+ LKG  +VV Y DSNA+R       +EVL LME C  G L+D+MN 
Sbjct: 91  NGLNELRNEVEVMKKLKGCGNVVQYYDSNASRHTDGTPGFEVLLLMELCSNGSLLDYMNQ 150

Query: 124 RLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSG 183
           RL  +L E EVL IM  +T+GI  MH L  PLIHRDIKIENVL+ S   +K+CDFGS S 
Sbjct: 151 RLATKLSEREVLKIMYDITKGISHMHFLRTPLIHRDIKIENVLVDSANNFKLCDFGSTST 210

Query: 184 IIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYT 243
            +      +E   +  +I  +TT QYR PEM+DLYR   INEKSDIWALG+FLYK+ +YT
Sbjct: 211 CLPAVSTHQEIAMLTNNIYVHTTPQYRSPEMIDLYRCLAINEKSDIWALGIFLYKLLFYT 270

Query: 244 TPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQGIP 303
           TPFE  G+ AILH++Y  PQ   +SS+L NLI +ML E P  RPN+ Q+L  + S+    
Sbjct: 271 TPFELTGQFAILHSKYDIPQN-NFSSKLINLIIVMLAENPYIRPNIYQILYHICSIMECD 329

Query: 304 CPLPNFYLQ 312
            P+ + Y Q
Sbjct: 330 VPIEDHYGQ 338

>KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.273
           YBR059C
          Length = 913

 Score =  299 bits (765), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 149/324 (45%), Positives = 205/324 (63%), Gaps = 20/324 (6%)

Query: 6   IKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQV-------------NPPNPINGMNL 52
           ++ Y PG  + VG H+V I++Y+  GGFAQIY V+                 + +   +L
Sbjct: 15  VEKYQPGKVIVVGSHRVEILQYIAEGGFAQIYSVKFLEYANEFDREESPGSKDQLQVGDL 74

Query: 53  ACLKRVIVPEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAAR------SISNDGTYEVL 106
           ACLKRVIV +++GLN LR EV  M+ L G P++V Y DSNA+R      S   +  +EVL
Sbjct: 75  ACLKRVIVQDQNGLNELRNEVNVMKKLVGAPNIVQYYDSNASRLRNGTDSQPQENKFEVL 134

Query: 107 QLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVL 166
            LME CP   L+D+MN RL  +L E E+L +M  V+  I  MH L  PLIHRDIKIENVL
Sbjct: 135 LLMELCPNKSLLDYMNLRLATKLSEQEILEVMYDVSLAIAQMHYLRKPLIHRDIKIENVL 194

Query: 167 ISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEK 226
           +     +K+CDFGS S          +  ++ Q+I  +TT QYR PEM+DLYR  PI+EK
Sbjct: 195 VDQKNRFKLCDFGSTSTCFPMVVTHRDIAYLTQNIYVHTTPQYRSPEMIDLYRCLPIDEK 254

Query: 227 SDIWALGVFLYKICYYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQR 286
           SDIWALG+FLYK+ ++TTPFE  G+ AILH+++++PQ   YS +L NLI +ML E P  R
Sbjct: 255 SDIWALGIFLYKLLFFTTPFERTGQFAILHSKFEFPQN-NYSFKLINLIIVMLSENPNLR 313

Query: 287 PNVCQVLEEVSSMQGIPCPLPNFY 310
           PN+ QVL ++  ++ +P P+ + Y
Sbjct: 314 PNIYQVLHQICQLKQVPIPIADKY 337

>Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059C
           (AKL1) - Serine-threonine protein kinase [contig 32]
           FULL
          Length = 935

 Score =  298 bits (764), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 149/316 (47%), Positives = 204/316 (64%), Gaps = 10/316 (3%)

Query: 4   PHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQV---------NPPNPINGMNLAC 54
           P ++    G+++ VG H+V I+KYL  GGFA IY V+           P   +   +LAC
Sbjct: 66  PVLEQLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVRFIEYANELEQVPTIKLEVGDLAC 125

Query: 55  LKRVIVPEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPG 114
           LKRV+V +++GLN +R EV  M+ L G P++V Y DS+A+R+      +EV  LME CP 
Sbjct: 126 LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRARDGSSGFEVTLLMELCPN 185

Query: 115 GGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYK 174
             L+D+MN RL  +L E E+L IM  VT+ +  MH L  PLIHRD+KIENVL+ +N  +K
Sbjct: 186 NSLLDYMNQRLATKLSEQEILKIMFDVTRALAQMHYLPVPLIHRDVKIENVLVDANHNFK 245

Query: 175 VCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGV 234
           +CDFGS S         +E   +  +I  +TT QYR PEM+DLYR  PINEKSDIWALG+
Sbjct: 246 LCDFGSTSTCFPVANTHQEIAVLTNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGI 305

Query: 235 FLYKICYYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLE 294
           FLYK+ +YTTPFE  G+ AILH++Y++P    YSS+L NLI +ML E P  RPN+ QV++
Sbjct: 306 FLYKLLFYTTPFELTGQFAILHSKYEFP-VNNYSSKLINLIIIMLAENPNLRPNIYQVMD 364

Query: 295 EVSSMQGIPCPLPNFY 310
            + S+  +  PL + Y
Sbjct: 365 NLCSILKVKNPLEDKY 380

>Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {ON}
           YBR059C (REAL)
          Length = 1107

 Score =  301 bits (772), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 151/319 (47%), Positives = 200/319 (62%), Gaps = 10/319 (3%)

Query: 1   MNQPHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQV---------NPPNPINGMN 51
           M  P ++ Y PG  + VG H+V I+ YL  GGFAQIY V+              P+   +
Sbjct: 14  MGHPAVERYTPGKIVCVGTHKVEIVNYLAEGGFAQIYAVKFLEYLNEFDNTASLPLKIGD 73

Query: 52  LACLKRVIVPEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEF 111
           +ACLKRV+V +++GLN +R EVE M+ LKG  +VV Y DSNA+R       +EVL LME 
Sbjct: 74  VACLKRVLVHDENGLNEMRNEVEVMKKLKGAANVVQYYDSNASRRRDGVQGFEVLLLMEL 133

Query: 112 CPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNG 171
           CP   L+D+MN RL  +L E E++ IM  V   I  MH L  PLIHRDIKIENVL+ +  
Sbjct: 134 CPNKSLLDYMNQRLSTKLSESEIVKIMYDVALSISEMHYLPVPLIHRDIKIENVLVDAEN 193

Query: 172 EYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWA 231
            +K+ DFGS S         ++   + Q+I  +TT QYR PEM+DLYR  PINEKSDIWA
Sbjct: 194 NFKLADFGSTSTSFPIVTTHQDIALLTQNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWA 253

Query: 232 LGVFLYKICYYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQ 291
           LG+FLYK+ ++TTPFE  G+ AILH++Y++P    YSS+L NLI +ML E P  RPN+ Q
Sbjct: 254 LGIFLYKLLFFTTPFEMTGQFAILHSKYEFP-VNKYSSKLINLIIIMLAENPNLRPNIYQ 312

Query: 292 VLEEVSSMQGIPCPLPNFY 310
           VL  +  +     P+ + Y
Sbjct: 313 VLYHICDILNAEVPIEDKY 331

>KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}
           Anc_3.273 YBR059C
          Length = 949

 Score =  299 bits (765), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 154/324 (47%), Positives = 205/324 (63%), Gaps = 22/324 (6%)

Query: 6   IKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQV-----NPPNPINGMNL-------- 52
           I+ ++ G  L VG H+V I+ YLT GGFAQIY V+         N  NG N+        
Sbjct: 28  IEKFEKGQNLAVGTHKVEIVDYLTEGGFAQIYVVKFIEVLNEFDNEDNGSNVRISNYSLK 87

Query: 53  ----ACLKRVIVPEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQL 108
               ACLKRV+V ++ GLN +R EV  M+ L+G P++V Y DSNA RS + +  YEVL L
Sbjct: 88  LGDVACLKRVLVYDEVGLNEMRNEVNVMKKLRGCPNIVQYYDSNATRSHNGNPGYEVLLL 147

Query: 109 MEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLIS 168
           ME C    L+++MN RL  +L E EVL IM  VT G+  MH L  PLIHRDIKIENVL+ 
Sbjct: 148 MELCSNNSLLNYMNQRLATQLSEKEVLKIMYDVTSGVAQMHYLKTPLIHRDIKIENVLVD 207

Query: 169 SNGEYKVCDFGSVSGIIRPPKNT--EEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEK 226
           SN  +K+CDFGS +    PP  T  ++   + Q++  +TT QYR PEM+DLYR  PINEK
Sbjct: 208 SNNNFKLCDFGSATTC--PPVATTHQDIALLGQNVYVHTTPQYRSPEMIDLYRYLPINEK 265

Query: 227 SDIWALGVFLYKICYYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQR 286
           SDIWALGVFLYK+ +YTTPFE  G+ A+LH+++  P    YSS++ NL+ +ML E    R
Sbjct: 266 SDIWALGVFLYKLLFYTTPFETTGQFAMLHSKFDIPANK-YSSKIINLVIIMLSENLNLR 324

Query: 287 PNVCQVLEEVSSMQGIPCPLPNFY 310
           PN+ QV+  +  +  +  P+ + Y
Sbjct: 325 PNIYQVMHYICQLIQVDTPILDIY 348

>TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {ON}
           Anc_3.273 YBR059C
          Length = 1361

 Score =  301 bits (771), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 151/318 (47%), Positives = 206/318 (64%), Gaps = 16/318 (5%)

Query: 6   IKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQV--------NPPNPINGM---NLAC 54
           I+ Y PG  ++VG HQV I  YL  GGFAQIY+V+         N  + +N +   ++AC
Sbjct: 32  IEKYKPGKLISVGAHQVKIEDYLAEGGFAQIYKVKFIDYLNEFENKKDQLNSLKSGDIAC 91

Query: 55  LKRVIVPEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGT--YEVLQLMEFC 112
           LKRV+V +++GLN +R EVE M+LL+G P++V Y DSNA R   NDG   YE+L LME C
Sbjct: 92  LKRVLVNDENGLNEMRNEVEVMKLLQGCPNIVQYYDSNALRR--NDGLNGYEILLLMELC 149

Query: 113 PGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGE 172
           P   L+D+MN RL+ +L E E++ IM   T  +  MH L+ PLIH+DIK+EN+L+ SN  
Sbjct: 150 PNNSLLDYMNQRLKTKLNETEIVKIMYDTTLAVSQMHYLDKPLIHKDIKVENILVDSNNN 209

Query: 173 YKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWAL 232
           +K+CDFGS S       +  +   + Q+I  +TT QYR PEM+DLYR  PINE SDIWAL
Sbjct: 210 FKLCDFGSTSPCYEIVTSHHDIAVLTQNIYMHTTPQYRSPEMIDLYRCLPINETSDIWAL 269

Query: 233 GVFLYKICYYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQV 292
           GVFLYK+ ++ TPFE  G+ +ILHA++  P    Y  +L NLI +ML E    RPN+ QV
Sbjct: 270 GVFLYKLLFFITPFERTGQFSILHAKFDIP-VNNYHPKLINLIIIMLSENLNLRPNIYQV 328

Query: 293 LEEVSSMQGIPCPLPNFY 310
           + E+ S+   P P+ + Y
Sbjct: 329 MYEICSITNTPLPIEDKY 346

>KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} similar
           to uniprot|P38080 Saccharomyces cerevisiae YBR059C AKL1
           Ser-Thr protein kinase
          Length = 901

 Score =  293 bits (750), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 145/316 (45%), Positives = 203/316 (64%), Gaps = 10/316 (3%)

Query: 4   PHIKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQV---------NPPNPINGMNLAC 54
           P ++    G+++ VG H+V I+KYL  GGFA IY V+           P   +     AC
Sbjct: 24  PVLERLKTGSQVIVGNHRVEIVKYLAEGGFAHIYVVKFVEYANELEQAPSITLKVGETAC 83

Query: 55  LKRVIVPEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPG 114
           LKRV+V +++GLN +R EV  M+ L G P++V Y DS+A+RS      +EV+ LME CP 
Sbjct: 84  LKRVLVTDENGLNEMRNEVSVMKQLSGCPNIVQYYDSHASRSRDGVPGFEVMLLMELCPN 143

Query: 115 GGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYK 174
             L+D+MN RL  +L E E+L IM  VT+ +  MH L  PLIHRD+KIENVL+  +  +K
Sbjct: 144 NSLLDYMNQRLTTKLSEQEILKIMFDVTRALAQMHYLPIPLIHRDVKIENVLVDGDNNFK 203

Query: 175 VCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGV 234
           +CDFGS S  +      +E   +  +I  +TT QYR PEM+DLYR  PI+EKSDIWALG+
Sbjct: 204 LCDFGSTSTCLPVANTHQEIAVLTNNIYIHTTPQYRSPEMIDLYRCLPIDEKSDIWALGI 263

Query: 235 FLYKICYYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLE 294
           FLYK+ +YTTPFE  G+ AILH++Y++P    YSS+L NLI +ML E P  RPN+ Q+++
Sbjct: 264 FLYKLLFYTTPFELTGQFAILHSKYEFP-INNYSSKLINLIIIMLAENPNLRPNIYQIMD 322

Query: 295 EVSSMQGIPCPLPNFY 310
            + S+  +  P+ + Y
Sbjct: 323 NLCSIMKVENPIEDKY 338

>AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR059C
           (AKL1)
          Length = 961

 Score =  293 bits (750), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 150/309 (48%), Positives = 200/309 (64%), Gaps = 9/309 (2%)

Query: 12  GTKLNVGIHQVSIIKYLTSGGFAQIYQVQ-VNPPNPINGMN-------LACLKRVIVPEK 63
           G+ + VG+HQV +I+YL  GGFA IY+V  V   N ++  +         CLKRV V ++
Sbjct: 32  GSTVLVGVHQVEVIEYLAEGGFAHIYKVSFVGYTNELDRQDRILQPGDTVCLKRVRVSDE 91

Query: 64  SGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNT 123
           +GLN LR EVE M+ L+   ++V Y DSNA+R       YEVL LME CP G L+D+MN 
Sbjct: 92  NGLNELRNEVEVMKKLRNCSNIVQYYDSNASRLGDGKPGYEVLLLMELCPNGSLLDYMNQ 151

Query: 124 RLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSG 183
           RL  +L E EVL IM  +T G+  MH    PLIHRDIKIENVL+ ++  +K+CDFGS S 
Sbjct: 152 RLATKLSEAEVLKIMYDITVGLSHMHYQRTPLIHRDIKIENVLVDADNNFKLCDFGSTSP 211

Query: 184 IIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYT 243
            +    + +E   +  +I  +TT QYR PEM+DLYR  PINEKSDIWALG+FLYK+ +YT
Sbjct: 212 CLPAVASHQEIAMLMNNIYVHTTPQYRSPEMIDLYRCLPINEKSDIWALGIFLYKLLFYT 271

Query: 244 TPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQGIP 303
           TPFE  G+ AILH++Y+ P+   +SS+L NL+ +ML E P  RPNV QV+  + SM    
Sbjct: 272 TPFELTGQFAILHSKYEIPRN-SFSSKLINLVIIMLAENPYLRPNVYQVMYHICSMMECE 330

Query: 304 CPLPNFYLQ 312
             + + Y Q
Sbjct: 331 VKIDDLYGQ 339

>TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3.273
           YBR059C
          Length = 1054

 Score =  292 bits (747), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 149/324 (45%), Positives = 201/324 (62%), Gaps = 31/324 (9%)

Query: 6   IKNYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQV---------------NPPNPINGM 50
           I+ Y  GT L VGI ++ I+KYLT GGFAQIY V+                N    +   
Sbjct: 37  IEKYKQGTILTVGIRRIEILKYLTEGGFAQIYTVRFIEYLNEFDNDDAENDNNSRNLKIG 96

Query: 51  NLACLKRVIVPEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGT-------- 102
           ++ACLKRV+VP+++GL+ +R EV+ M+ L   P++V Y DSNA++   N           
Sbjct: 97  DVACLKRVLVPDENGLSEMRNEVDVMKKLVNCPNIVQYYDSNASKIKDNSNIDTTNNNDN 156

Query: 103 -------YEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPL 155
                  +E+L LME+CP   L+DFMN RL  +L E E+L  M  +T  ++ MH L  PL
Sbjct: 157 NKNTDLGFEILLLMEYCPNKSLLDFMNQRLTTKLTENEILKAMTDITTAVLQMHYLAQPL 216

Query: 156 IHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEML 215
           IHRDIKIENVL+ SN  +K+ DFGS + I  P    ++   + +DI  NTT QYR PEM+
Sbjct: 217 IHRDIKIENVLVDSNNNFKLADFGSTTKIQPPITTHQDIAILNKDIYMNTTPQYRSPEMI 276

Query: 216 DLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAILHARYQYPQYPMYSSRLKNLI 275
           DLY+  PI+EKSDIWALGV LYK+ +YTTPFE  G+ AILH++Y++P    YSS+  NLI
Sbjct: 277 DLYKCLPIDEKSDIWALGVLLYKLLFYTTPFELTGQFAILHSKYEFPA-NNYSSKFINLI 335

Query: 276 RMMLMEKPEQRPNVCQVLEEVSSM 299
            +ML E P  RPN+ QVL  + S+
Sbjct: 336 IIMLAENPNLRPNIFQVLYYLKSI 359

>CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa]
           {ON} some similarities with uniprot|P38080 Saccharomyces
           cerevisiae YBR059c AKL1 Ark-family Kinase-Like protein
          Length = 991

 Score =  291 bits (744), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 154/331 (46%), Positives = 209/331 (63%), Gaps = 22/331 (6%)

Query: 3   QPHIKNYDPGTKL-NVGIHQVSIIKYLTSGGFAQIYQVQ-VNPPN------------PIN 48
           QP I+   P  K+  VG H+V ++ YL  GGFAQIY V+ V   N            P+ 
Sbjct: 89  QPQIEEKFPAGKVVTVGSHRVEVVSYLAEGGFAQIYVVKFVEYTNEFERKNDESMNQPLK 148

Query: 49  GMNLACLKRVIVPEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGT----YE 104
             + ACLKRV+V ++ GLN +R+EVE M+ L+G P++V Y DSNA+R     G     +E
Sbjct: 149 PGSPACLKRVLVQDEVGLNKMRSEVEVMKKLQGAPNIVQYFDSNASRLRDYSGNITQGFE 208

Query: 105 VLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIEN 164
           VL LME CP   L+D+MN RL  +L E E+  IM  +T  +  MH L  PLIHRDIKIEN
Sbjct: 209 VLLLMELCPNKSLLDYMNQRLATKLTEQEIFKIMYDITLAVAQMHYLPVPLIHRDIKIEN 268

Query: 165 VLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPIN 224
           VL+ +N  +K+CDFGS S       + ++   + QD+  +TT QYR PEM+DL++  PIN
Sbjct: 269 VLVDANNNFKLCDFGSTSTCFPAFTSFQDIAMLSQDLYMHTTPQYRSPEMIDLFKYIPIN 328

Query: 225 EKSDIWALGVFLYKICYYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPE 284
           EKSDIWALGVFLYK+ ++TTPFE  G+ A+LH+++++P    YSS+L NLI +ML E P 
Sbjct: 329 EKSDIWALGVFLYKLLFFTTPFERTGQFAMLHSKFEFPPN-SYSSKLINLIIVMLAENPS 387

Query: 285 QRPNVCQV---LEEVSSMQGIPCPLPNFYLQ 312
            RPN+ QV   L EV++ +  P  L + Y Q
Sbjct: 388 LRPNIYQVLYYLSEVTNREVPPTVLSDKYGQ 418

>KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7.86
            YAL017W
          Length = 1440

 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 71/231 (30%), Positives = 108/231 (46%), Gaps = 29/231 (12%)

Query: 66   LNTLRAEVEAMQLLKGKPH--VVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNT 123
            L T+ +E++ M  L  +PH  ++  +D         D  Y  ++       G +  F   
Sbjct: 1227 LGTIPSEIQIMATLNKQPHENILRLLD------FFEDDDYYYIETPIHGETGCIDLFDLI 1280

Query: 124  RLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSG 183
             L+N + E EV  I  Q+  GI  +H  +  +IHRDIK ENV++ + G  K+ DFGS + 
Sbjct: 1281 ELKNNMTEMEVKLIFKQIVSGIKHLH--DQAIIHRDIKDENVIVDATGFVKLIDFGSAAH 1338

Query: 184  IIRPPKNTEEFNFVQQDIMKNTTAQYRCPEML--DLYRGQPINEKSDIWALGVFLYKICY 241
            +   P +     FV        T  Y  PE+L  D Y G+P     DIWA+G+ LY I +
Sbjct: 1339 VKSGPFDV----FV-------GTIDYAAPEVLSGDPYEGKP----QDIWAIGILLYTIVF 1383

Query: 242  YTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQV 292
               PF N  E  IL     + +    S+  K LI M+L    ++RP +  +
Sbjct: 1384 KENPFYNIDE--ILEGELTFSESSDVSAECKALISMILNRNVQKRPTIDDI 1432

>Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236C -
           Hypothetical ORF [contig 165] FULL
          Length = 346

 Score = 93.6 bits (231), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 84/324 (25%), Positives = 132/324 (40%), Gaps = 55/324 (16%)

Query: 24  IIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKS--GLNTLRAEVEAMQLLKG 81
           I K L  GG + +Y V+           L  LK+   P  S   ++    EV   Q    
Sbjct: 28  IQKLLGEGGLSFVYLVESKEGE------LFALKKTRCPFGSIGSISPAMKEVANYQRFS- 80

Query: 82  KPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQN--RLKEFEVLNIMN 139
            P++   +DS   +    DG+  V  L+ +   G L D +N  L +  ++ E ++L +  
Sbjct: 81  SPYIAQIVDSQVVQE--KDGSKTVYVLLPYFAKGSLQDLINRHLLDCTQMSELDILRMAL 138

Query: 140 QVTQGIVAMHSLNP-----------------------------------PLIHRDIKIEN 164
            + +G++ +H  NP                                      HRD+K  N
Sbjct: 139 GIARGLLCIHEANPNHETDVAYSIVSAPYAEDSSLLNDLELDTFGESQQSYAHRDVKPSN 198

Query: 165 VLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPIN 224
           ++IS      + D GS S       + +     Q+    N T  Y  PE+LD+     I 
Sbjct: 199 IMISPEDLPVISDLGSCSRARIDINSRQALLRFQEWSSDNCTLSYAAPEILDVKLNSVIT 258

Query: 225 EKSDIWALGVFLYKICYYTTPFE-----NGGE--RAILHARYQYPQYPMYSSRLKNLIRM 277
           EK DIW+ G  +Y +C+  +PFE     +G     AI   +Y  P+   YSS L  LI  
Sbjct: 259 EKCDIWSFGCTMYSMCFGISPFEREEQISGASVTYAITTGKYTVPRGTSYSSSLIELIGK 318

Query: 278 MLMEKPEQRPNVCQVLEEVSSMQG 301
            L   PEQRP+V +++  +  +QG
Sbjct: 319 CLSVNPEQRPSVNELIALLMELQG 342

>KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON} 
          Length = 668

 Score = 95.9 bits (237), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 76/286 (26%), Positives = 135/286 (47%), Gaps = 53/286 (18%)

Query: 31  GGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLN---TLRAEVEAMQLLKGKPHVVG 87
           G  + +Y+V     +P +   LA  K  I   K   N   T+  E+E  +L+ G  +++ 
Sbjct: 59  GSHSIVYKV----THPTSDATLALKKLPINDYKLKTNRRSTILKEIEIHKLVNGHKNIIS 114

Query: 88  YIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVA 147
            ID         D T  +  ++E C  G L D +  R +  L+E+E   +M Q+   +  
Sbjct: 115 MIDH-----FEIDAT--MYMVLELCGAGSLYDII-CRSKRSLREWEAKRLMIQLCGAVDW 166

Query: 148 MHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNT-- 205
           +H  N  ++H D+K+ N+LI S+   ++CDFG               +FV  DI  N+  
Sbjct: 167 IHEKN--IVHADLKLSNILIDSSNNLQLCDFGH--------------SFVSTDIDNNSIN 210

Query: 206 ---TAQYRCPEML---------DLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGERA 253
              T  Y  PE++         DLY      ++SDIW++G+ LY + +  TPFE    R+
Sbjct: 211 KFGTPNYLSPEIISNFILSDKKDLY----FPKESDIWSIGIVLYAMIFDKTPFEATTLRS 266

Query: 254 ----ILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEE 295
               I+  +Y + +    S+++K LI+ +L  +P +R  + +++ +
Sbjct: 267 TYENIVECKYGFVENKRVSNKVKKLIQNILKIQPLERKTIVEIVSD 312

>SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 364

 Score = 93.6 bits (231), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 85/346 (24%), Positives = 146/346 (42%), Gaps = 78/346 (22%)

Query: 23  SIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLKG- 81
           +I + L  GGF+ +Y VQ    N     +L  LK++  P       + +  EAM+ +   
Sbjct: 29  AIQRLLGEGGFSFVYLVQSRENN-----DLFALKKIHCP----FGNIESVSEAMREVNSY 79

Query: 82  ----KPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQN--RLKEFEVL 135
                P++   + S   +    DG+  V  L+ + P G L+D +NT L +   + E E++
Sbjct: 80  KKFRSPYITHCVSSQVLQE--QDGSKTVFILLPYFPTGSLLDKINTHLLDGTTISEEEIV 137

Query: 136 NIMNQVTQGIVAMH-------------SLNPPLIHR------------------------ 158
            I+  V +G+  MH             S+N  L +R                        
Sbjct: 138 RILVSVARGLRTMHNPAGQEDSIEDQTSVNTDLQYRDTVSMTYNEDLRLLNDSLELDVLS 197

Query: 159 ----------------DIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIM 202
                           DIK  N++ SS+G   +CD GS S       +  +    Q+   
Sbjct: 198 GNTSSFMASTTAYSHKDIKPANIMFSSDGLPVICDLGSCSRAHVDISSRSQLVEFQEWCN 257

Query: 203 KNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPFE-----NGGER--AIL 255
           ++ T  +R PE+L++     I+EK DIW+LG  LY +C+  +PFE     +G     AI 
Sbjct: 258 EHCTLPFRSPELLNVTLNSKIDEKVDIWSLGCTLYCMCFGISPFEREEQLSGASMTYAIA 317

Query: 256 HARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQG 301
             ++  P    YS  L  +I+  +    ++RP++ ++L  +  +QG
Sbjct: 318 TGKFSIPPNTNYSPELIKIIKDCIEVDSKKRPSIDELLARLQDLQG 363

>Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 93.6 bits (231), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 86/334 (25%), Positives = 142/334 (42%), Gaps = 61/334 (18%)

Query: 13  TKLNVGIHQVSIIKYLTSGGFAQIYQVQV-----NPPNPINGMNLACLKRVIVPEKSGLN 67
           T + V   +  I + L  GG + +Y VQ+     +  N      L  LK++I P    ++
Sbjct: 21  TTIRVNDRRYKIQRLLGEGGMSFVYLVQLLKGSLSMENSAATAELYALKKIICPSVENIS 80

Query: 68  TLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRL-- 125
               E+E  +  +  P+V+  IDS   +    DG+  +  ++ +   G L D +N RL  
Sbjct: 81  NGMREIENYKRFQ-SPYVIQSIDSQVMQE--KDGSKTIYIILPYYSLGSLQDSINRRLLE 137

Query: 126 QNRLKEFEVLNIMNQVTQGIVAMH------------------------------------ 149
              + E E + IM  VT+G++ +H                                    
Sbjct: 138 GTFISEAECVRIMLGVTRGLLCLHDPASRQDNVTTRTTVDTISMTYSDETAMLLEDTPLE 197

Query: 150 -----SLNPPLI---HRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDI 201
                S +  LI   HRDI   N+L SS+G   + D GS S       N  + + +Q+ +
Sbjct: 198 MDMLSSSSAGLIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLSELQEWV 257

Query: 202 MKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPFE-----NGGE--RAI 254
             N T  Y  PE+L+L   Q ++ K DIW++G   Y + +  +PFE     +G     AI
Sbjct: 258 NDNCTLPYTAPELLNLKLNQALSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASLTYAI 317

Query: 255 LHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPN 288
              +Y +P+   +S RL ++I+  +   P QRP 
Sbjct: 318 NTGKYSFPRNSRFSERLLDVIKRCIQVDPIQRPT 351

>ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakly
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1262

 Score = 96.7 bits (239), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 64/179 (35%), Positives = 89/179 (49%), Gaps = 20/179 (11%)

Query: 116  GLIDFMN-TRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYK 174
            G ID  +   L+  + E+E   I  QV   I  +HS    ++HRDIK ENV++ S G  K
Sbjct: 1094 GCIDLFDLIELKTNMTEYEAKLIFRQVVSAIRHLHSQG--IVHRDIKDENVVVDSKGFVK 1151

Query: 175  VCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEK-SDIWALG 233
            + DFGS + +   P +     FV        T  Y  PE+L    G+P + K  DIWA+G
Sbjct: 1152 LIDFGSAAYVKSGPFDV----FV-------GTIDYAAPEVL---SGEPFDGKPQDIWAIG 1197

Query: 234  VFLYKICYYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQV 292
            V LY I +   PF N  E  IL    ++      S    NLI+M+L + P QRP + +V
Sbjct: 1198 VLLYTIVFKENPFYNIDE--ILEVNLKFHGTKGVSEECINLIKMILNKNPSQRPTIDEV 1254

>Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {ON}
           YPL236C (REAL)
          Length = 364

 Score = 93.2 bits (230), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 89/339 (26%), Positives = 143/339 (42%), Gaps = 61/339 (17%)

Query: 13  TKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPI--NGM---NLACLKRVIVPEKSGLN 67
           T + V   +  I + L  GG + +Y VQ+   + I  NG+    L  LK++I P    ++
Sbjct: 21  TTIRVNDKRYKIQRLLGEGGLSFVYLVQLLKGSLIMENGVAAPELYALKKIICPNVESIS 80

Query: 68  TLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRL-- 125
               E+E  +  +  P+V+  IDS   +    DG+  +  ++ F   G L D +N RL  
Sbjct: 81  NGMREIENYKRFQ-SPYVIQSIDSQVMQE--KDGSKSIYIILPFYTLGSLQDSINRRLLE 137

Query: 126 QNRLKEFEVLNIMNQVTQGIVAMHS-----------------------------LNPPL- 155
              + E E + IM  V +G++ +H                               + PL 
Sbjct: 138 GTFISEAECVRIMLGVIRGLLCLHDPASRQDNTNSRTTVDTVSMTYSDETAFLLEDTPLE 197

Query: 156 --------------IHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDI 201
                          HRDI   N+L SS+G   + D GS S       N  +   +Q+ +
Sbjct: 198 MDMLSSNLGASIAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIGNRNQLRELQEWV 257

Query: 202 MKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPFE-----NGGE--RAI 254
             N T  Y  PE+L L   Q ++ K DIW+LG   Y + +  +PFE     +G     AI
Sbjct: 258 NDNCTLPYTAPELLGLKLNQTLDCKVDIWSLGCTFYTLMFGISPFEREEQIHGASITYAI 317

Query: 255 LHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVL 293
              +Y +P+   +S  L ++I+  +   P QRP   Q+L
Sbjct: 318 NTGKYSFPRNSRFSEGLLSVIKKCIQVDPVQRPTTSQLL 356

>Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045W -
            Hypothetical ORF [contig 47] FULL
          Length = 1213

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 75/276 (27%), Positives = 122/276 (44%), Gaps = 32/276 (11%)

Query: 24   IIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVP---EKSGLNTLRAEVEAMQLLK 80
            +++ +  G + ++          I  + L   +R++V        L T+ +E++ M  L 
Sbjct: 955  VLQKMGEGAYGKVDLCMHKKDRYIVVIKLIFKERILVDTWVRDRKLGTIPSEIQIMATLN 1014

Query: 81   GKPH--VVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIM 138
             KPH  ++  +D         D  Y  ++       G +  F    ++  + E E + I 
Sbjct: 1015 AKPHENILMLLD------FFEDDDYYYIETAVHGTSGSIDLFDLIEMKTDMTEHEAMLIF 1068

Query: 139  NQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQ 198
             Q+  GI  +H  +  ++HRDIK ENV++  NG  K+ DFGS + +   P +     FV 
Sbjct: 1069 KQIASGIKNLH--DNGIVHRDIKDENVIVDCNGFVKIVDFGSAAYVKSGPFDV----FV- 1121

Query: 199  QDIMKNTTAQYRCPEML--DLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAILH 256
                   T  Y  PE+L  + Y G+P     DIWA+GV LY I Y   PF N  E  IL 
Sbjct: 1122 ------GTIDYAAPEVLGGEPYEGKP----QDIWAIGVLLYTIIYKENPFYNIDE--ILD 1169

Query: 257  ARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQV 292
            A  +       S     LIR +L     +RP++ ++
Sbjct: 1170 ADLRVNSSERISDDCIALIRKILNRSVSKRPSIDEI 1205

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 95.9 bits (237), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 79/287 (27%), Positives = 132/287 (45%), Gaps = 35/287 (12%)

Query: 28  LTSGGFAQIYQVQVNPPNPINGMNLACL---KRVIVPEKSGLNTLRAEVEAMQLLKGKPH 84
           L  GGFA+ + ++ +      G++ AC    K+ I  E++    L +E++  Q L+   H
Sbjct: 99  LGEGGFARCFHIKDDV-----GISFACKIVSKKSIKTERTKFKLL-SEIQIHQNLRY-SH 151

Query: 85  VVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQG 144
           +V ++D         +    V  L+E CP G L+D +  R    L E EV  +  QV   
Sbjct: 152 IVKFMDCF-------EDELNVYILLELCPNGSLMDLLKKR--KILTEAEVKFMTTQVCGA 202

Query: 145 IVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKN 204
           I  MHS N  +IHRD+K+ NV    N   K+ DFG  + +          N  ++     
Sbjct: 203 INYMHSNN--IIHRDLKLGNVFFDKNFNIKIGDFGLAATLS---------NVSEKKYTMC 251

Query: 205 TTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAILH----ARYQ 260
            T  Y  PE++ L +    + ++DIW+LG+ +Y +     PF+      I       +Y+
Sbjct: 252 GTPNYIAPEVI-LSKQIGHSFEADIWSLGIMIYAMVLGKPPFQAKDVTTIYEKIKLCQYE 310

Query: 261 YPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQGIPCPLP 307
           +P     ++ +K LI+ +L+  P QRP +  +L+        P  LP
Sbjct: 311 FPPDKYITNDVKVLIQDLLVLDPSQRPRIMDILKYNWFKHSFPPKLP 357

>NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1411

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 73/256 (28%), Positives = 114/256 (44%), Gaps = 37/256 (14%)

Query: 52   LACLK-----RVIVP---EKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSIS--NDG 101
            + C+K     R++V        L T+ +E++ M  L  KPH       N  R +    D 
Sbjct: 1176 IVCIKMIFKERILVDTWVRDRKLGTIPSEIQIMATLNKKPH------ENILRLLDFFEDD 1229

Query: 102  TYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIK 161
             Y  ++       G +  F     +  + EFE   I  QV  GI  +H  +  ++HRDIK
Sbjct: 1230 NYYYIETPIHGETGCIDLFDLIEFKTNMTEFEAKLIFKQVVSGIKHLH--HQGIVHRDIK 1287

Query: 162  IENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEML--DLYR 219
             ENV++ S G  K+ DFGS + +   P +     FV        T  Y  PE+L  + Y 
Sbjct: 1288 DENVIVDSKGLVKIIDFGSAAYVKSGPFDV----FVG-------TIDYAAPEVLSGEPYE 1336

Query: 220  GQPINEKSDIWALGVFLYKICYYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMML 279
            G+P     DIWALG+ LY I +   PF N  E  IL    ++      +     LI+ +L
Sbjct: 1337 GKP----QDIWALGILLYTIVFKENPFYNIDE--ILEGDLKFDSNTEVTEDCMELIKKVL 1390

Query: 280  MEKPEQRPNVCQVLEE 295
            + +   RP + ++ ++
Sbjct: 1391 IRQVRNRPAIDEIFDD 1406

>KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1229

 Score = 94.7 bits (234), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 75/235 (31%), Positives = 108/235 (45%), Gaps = 31/235 (13%)

Query: 66   LNTLRAEVEAMQLLKGKPHVVGYIDSNAARSIS--NDGTYEVLQLMEFCPGGGLIDFMN- 122
            L T+ +E++ M  L  KPH       N  R +    D  Y  L+  E     G ID  + 
Sbjct: 1016 LGTIPSEIQIMVTLNRKPH------ENILRILDFFEDDDYYYLE-TEMHGETGSIDLFDL 1068

Query: 123  TRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVS 182
              L+  + EFE   +  QV  GI  +H  +  ++HRDIK ENV++ + G  K+ DFGS +
Sbjct: 1069 IELKTNMTEFEAKLLFKQVASGIKHLH--DNGIVHRDIKDENVIVDNKGFVKLIDFGSAA 1126

Query: 183  GIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEML--DLYRGQPINEKSDIWALGVFLYKIC 240
             +   P +     FV        T  Y  PE+L  + Y G+P     DIWA+GV LY I 
Sbjct: 1127 YVKSGPFDV----FV-------GTIDYAAPEVLGGEPYEGKP----QDIWAIGVLLYTII 1171

Query: 241  YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEE 295
            Y   PF N  E  IL    +       S+    LIR +L     +RP +  ++E+
Sbjct: 1172 YKENPFYNIDE--ILDGDLRIQSTHEVSAECVALIRKILNRSVSKRPTIDDIMED 1224

>TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1300

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 73/234 (31%), Positives = 106/234 (45%), Gaps = 29/234 (12%)

Query: 66   LNTLRAEVEAMQLLKGKPHVVGYIDSNAARSIS--NDGTYEVLQLMEFCPGGGLIDFMNT 123
            L T+ +E++ M  L  KPH       N  R I    D  Y  L+       G +  F   
Sbjct: 1086 LGTIPSEIQIMYTLNRKPH------DNILRMIDFFEDDQYYYLETPVHGESGCIDLFDLI 1139

Query: 124  RLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSG 183
              +  + E E   I  QV  G+  +HSL   ++HRDIK ENV+I S G  K+ DFGS + 
Sbjct: 1140 EFRTDMTEDEAKLIFKQVASGLQHLHSLG--IVHRDIKDENVIIDSKGYVKIIDFGSAAY 1197

Query: 184  IIRPPKNTEEFNFVQQDIMKNTTAQYRCPEML--DLYRGQPINEKSDIWALGVFLYKICY 241
            +   P +     FV        T  Y  PE+L  + Y G+P     DIWALG+ LY I +
Sbjct: 1198 VKNGPFDV----FVG-------TIDYAAPEVLAGNPYEGKP----QDIWALGILLYTIIF 1242

Query: 242  YTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEE 295
               PF N  E  I+     +      +     LI+ ML++   +RP++ +V  +
Sbjct: 1243 KENPFYNIDE--IIEGNVNFDNEASVNPVCVQLIKKMLIKTVPKRPDINEVFSD 1294

>YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON}
           ENV7Protein proposed to be involved in vacuolar
           functions; mutant shows defect in CPY processing; has
           sequence similarity with the human serine/threonine
           protein kinase STK16
          Length = 364

 Score = 91.7 bits (226), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 85/322 (26%), Positives = 141/322 (43%), Gaps = 61/322 (18%)

Query: 24  IIKYLTSGGFAQIYQVQVNPPNPI--NGM---NLACLKRVIVPEKSGLNTLRAEVEAMQL 78
           I + L  GG + +Y VQ++  + I  NG+    L  LK++I P    ++    E+E  + 
Sbjct: 32  IQRLLGEGGMSFVYLVQLSKNSLIIDNGIATPELYALKKIICPSVESISNGMREIENYKR 91

Query: 79  LKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRL--QNRLKEFEVLN 136
            +  P+V+  IDS   +    DG+  +  ++ +   G L D +N RL     + E E + 
Sbjct: 92  FQ-SPYVIKSIDSQVMQE--KDGSKTIYIVLPYYSLGSLQDSINRRLLEGTFVSEAECVR 148

Query: 137 IMNQVTQGIVAMHS-----------------------------LNPPL------------ 155
           IM  VT+G++ +H                               + PL            
Sbjct: 149 IMLGVTRGLLCLHDPASRQDNATSRVNVDAVSMTYSDETAMLLEDTPLEMDMLSSNSAGS 208

Query: 156 ---IHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCP 212
               HRDI   N+L SS+G   + D GS S      +N  + + +Q+ +  N T  Y  P
Sbjct: 209 IAYAHRDITPSNILFSSDGLPVIGDLGSCSQADITIENRHQLSELQEWVNDNCTLPYTPP 268

Query: 213 EMLDLYRGQPINEKSDIWALGVFLYKICYYTTPFE-----NGGE--RAILHARYQYPQYP 265
           E+L+L   Q ++ K DIW+LG   Y + +  +PFE     +G     AI   +Y +P+  
Sbjct: 269 ELLNLKLNQVLSSKVDIWSLGCTFYTLMFGISPFEREEQIHGASLTYAINTGKYSFPRNS 328

Query: 266 MYSSRLKNLIRMMLMEKPEQRP 287
            +S  L ++I+  +   P QRP
Sbjct: 329 RFSEGLLSVIKKCIQVDPIQRP 350

>KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7.86
            YAL017W
          Length = 1055

 Score = 94.4 bits (233), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 69/230 (30%), Positives = 105/230 (45%), Gaps = 29/230 (12%)

Query: 68   TLRAEVEAMQLLKGKPH--VVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRL 125
            T+ +E+  M      PH  +   +D         D  Y  ++L      G +  F    L
Sbjct: 844  TIPSEIYIMSKFNAHPHDNITQIMD------FFEDDDYYYIELESHGETGSIDLFDLIEL 897

Query: 126  QNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGII 185
            +  + EFE   I  Q+  GI  +H  +  ++HRDIK ENV++ SNG  K+ DFGS +   
Sbjct: 898  KTNMTEFEAKLIFKQIVSGIKYLH--DQGIVHRDIKDENVIVDSNGFVKLIDFGSAAYTK 955

Query: 186  RPPKNTEEFNFVQQDIMKNTTAQYRCPEML--DLYRGQPINEKSDIWALGVFLYKICYYT 243
              P       FV        T  Y  PE+L  + Y+G+P     DIWALGV LY + Y  
Sbjct: 956  TGPFEV----FVG-------TIDYAAPEILGGNPYKGKP----QDIWALGVLLYTLIYKE 1000

Query: 244  TPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVL 293
             PF N  E  IL  + ++      +    +LIR +L +    RP++ +++
Sbjct: 1001 NPFYNVDE--ILEGQLRFDGTCNVTQDCIDLIRWILTKSVNDRPSIDEIV 1048

>KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24
           YDR523C
          Length = 543

 Score = 93.2 bits (230), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 76/282 (26%), Positives = 136/282 (48%), Gaps = 28/282 (9%)

Query: 23  SIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLKGK 82
           +I K +  G F  +++   N    +  + +  L      E+     ++ E+  M LLK  
Sbjct: 17  TIDKCVGKGNFGDVFKAMNNVTKEVVAIKIINLDD---SEEETFEIIK-EMRLMSLLKS- 71

Query: 83  PHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVT 142
           P++  YI      +I+ D  Y +  +ME+C GG   D + T  +  L E +V  ++  V 
Sbjct: 72  PYIARYI-----TTINED--YLMWIVMEYCGGGSARDLIKTCYREGLAENKVAFVVKSVL 124

Query: 143 QGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIM 202
            G+  +H+ +   IHRDIK  N+L++ +G  KV DFG VS  +R     + F        
Sbjct: 125 LGLQYLHAQHK--IHRDIKAANILLTDSGLVKVADFG-VSAEMRSTMKAKTF-------- 173

Query: 203 KNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAILH--ARYQ 260
              T  +  PE++ +  G   NEKSDIW+LG+  Y++     P        ++    + +
Sbjct: 174 -VGTPYWMAPEVV-MNEGMGYNEKSDIWSLGITTYELLKGVPPLAKYDAIRVMRNIPKRK 231

Query: 261 YPQ-YPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQG 301
            P+ +  Y++ +K+ I   L++ PE+RP+  ++LE    ++G
Sbjct: 232 PPKLHGAYTNLVKHFIATCLIKDPEKRPSASELLEHDFMVKG 273

>CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31 or
            uniprot|Q08217 Saccharomyces cerevisiae YOL045w
          Length = 1206

 Score = 94.0 bits (232), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 71/237 (29%), Positives = 112/237 (47%), Gaps = 33/237 (13%)

Query: 66   LNTLRAEVEAMQLLKGKPH--VVGYIDSNAARSISNDGTYEVLQLMEFCPGG--GLIDFM 121
            L T+ +E++ +  +  +PH  ++G +D        +D  Y     +E  P G  G +D  
Sbjct: 993  LGTIPSEIQILATINKRPHENILGLLDF-----FEDDDYY----YLETPPHGQTGSVDLF 1043

Query: 122  NT-RLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180
            +    ++ + EFE   I  Q+  GI  +H  +  ++HRDIK ENV++ S G  K+ DFGS
Sbjct: 1044 DIIEFKSNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKGFVKLIDFGS 1101

Query: 181  VSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKS-DIWALGVFLYKI 239
             + +   P +     FV        T  Y  PE+L    G P   KS DIWA+G+ LY +
Sbjct: 1102 AAYVKSGPFDV----FV-------GTIDYAAPEVLG---GNPYEGKSQDIWAIGILLYTL 1147

Query: 240  CYYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEV 296
             Y   PF N  E  IL    ++      S   K LI  +L     +RP + ++ ++V
Sbjct: 1148 IYKENPFYNIDE--ILEGELRFNDSADVSQECKALITKILNRCVRKRPTIDEICQDV 1202

>KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {ON}
           similar to uniprot|Q7LGU7 Saccharomyces cerevisiae
           YPL236C Hypothetical ORF
          Length = 346

 Score = 90.9 bits (224), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 83/332 (25%), Positives = 143/332 (43%), Gaps = 55/332 (16%)

Query: 15  LNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKS--GLNTLRAE 72
           ++V  H+  I + L  GGF+ +Y V+       NG  L  LK++  P  S   ++    E
Sbjct: 19  VSVNGHRYHIKRLLGEGGFSFVYLVESRE----NG--LMALKKIRCPFGSIGSISPAMKE 72

Query: 73  VEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQN--RLK 130
           V+  Q  K  P++   IDS   +    DG+  V  L+ +   G L D +N  L +  ++ 
Sbjct: 73  VDNYQKFK-SPYIAQIIDSQVVQE--RDGSKTVYILLPYFSKGSLQDEINRHLLDCTQVP 129

Query: 131 EFEVLNIMNQVTQGIVAMHSLNPP-----------------------------------L 155
           E EV+ +   V +G++ +H   P                                     
Sbjct: 130 ELEVVRLALGVARGLLCIHDAAPADESDVTYSIVSAPYAEDSSLLNDLELDTFGESHQAY 189

Query: 156 IHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEML 215
            H DIK  N++ISS G   + D GS S       + +     Q+   ++ T  +  PE+L
Sbjct: 190 AHHDIKPSNIMISSEGMPVISDLGSCSRACVEINSRQALLQFQEWRSEHCTLTFMAPEIL 249

Query: 216 DLYRGQPINEKSDIWALGVFLYKICYYTTPFE-----NGGE--RAILHARYQYPQYPMYS 268
           D+     I EK D+W+ G  +Y +C+  +PFE     +G     ++   +Y  P    YS
Sbjct: 250 DVKLNSVITEKCDVWSFGCTIYTMCFGISPFEREEQISGASVTYSLTTGKYSIPSGTNYS 309

Query: 269 SRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300
           S L ++++  L   P+ RP+V +++  +  +Q
Sbjct: 310 SGLIDVVKKCLNVDPDGRPSVDELISLLMDLQ 341

>TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_7.86
            YAL017W
          Length = 1262

 Score = 93.6 bits (231), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 75/279 (26%), Positives = 126/279 (45%), Gaps = 34/279 (12%)

Query: 24   IIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVP---EKSGLNTLRAEVEAMQLL- 79
            I+K +  G + ++          I  + +   +R++V        L T+ +E++ M  L 
Sbjct: 1004 ILKKMGEGAYGKVDLCYHKKEKYIVVIKMIFKERILVDTWVRDRKLGTIPSEIQIMSTLN 1063

Query: 80   -KGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMN-TRLQNRLKEFEVLNI 137
                 +++  +D        +D  Y V Q +      G ID  +    +  + EFE   I
Sbjct: 1064 KTSNKNILSILDF-----FEDDDYYYVEQPVH--GKTGCIDLFDLIEFKTNMTEFEAKLI 1116

Query: 138  MNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFV 197
              Q+  GI  +H     ++HRDIK ENV++ + G  K+ DFGS + +   P +     FV
Sbjct: 1117 FKQIISGISHLHE--SGIVHRDIKDENVIVDAKGFVKLIDFGSAAYVKNGPFDV----FV 1170

Query: 198  QQDIMKNTTAQYRCPEML--DLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAIL 255
                    T  Y  PE+L  + Y G+P     DIWALG+ LY I +   PF N  E  IL
Sbjct: 1171 -------GTIDYASPEVLRGEKYEGKP----QDIWALGILLYTIVFKENPFYNIDE--IL 1217

Query: 256  HARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLE 294
                ++P+    S+   +LI+++L     +RP++  + E
Sbjct: 1218 EGDMKFPETENISANCIDLIKLILNRSALERPSITDISE 1256

>KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1223

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 71/231 (30%), Positives = 106/231 (45%), Gaps = 29/231 (12%)

Query: 66   LNTLRAEVEAMQLLKGKPH--VVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNT 123
            L T+ +E++ M  L  KPH  ++  +D         D  Y  ++       G +  F   
Sbjct: 1010 LGTIPSEIQIMATLNTKPHENILMLLD------FFEDDEYYYIETPIHGTSGSVDLFDLI 1063

Query: 124  RLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSG 183
             L+  + E E   I  Q+  GI  +H  +  ++HRDIK ENV++ SNG  K+ DFGS + 
Sbjct: 1064 ELKTDMTEHEAKLIFKQIVSGIKHLH--DNGIVHRDIKDENVIVDSNGFVKIIDFGSAAY 1121

Query: 184  IIRPPKNTEEFNFVQQDIMKNTTAQYRCPEML--DLYRGQPINEKSDIWALGVFLYKICY 241
            +   P +     FV        T  Y  PE+L  + Y G+P     DIWA+GV LY I +
Sbjct: 1122 VKSGPFDV----FV-------GTIDYAAPEVLGGEPYEGKP----QDIWAIGVLLYTIIF 1166

Query: 242  YTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQV 292
               PF N  E  IL A  +       S     LIR +L     +RP++ ++
Sbjct: 1167 KENPFYNIDE--ILDADLRVDSNHRVSDECIALIRKILNRPISKRPSISKI 1215

>Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {ON}
            similar to Ashbya gossypii ACR281C
          Length = 1325

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 71/231 (30%), Positives = 107/231 (46%), Gaps = 29/231 (12%)

Query: 66   LNTLRAEVEAMQLLKGKPH--VVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNT 123
            L T+ +E++ M  L+ KPH  ++  +D         D  Y  ++       G +  F   
Sbjct: 1112 LGTIPSEIQIMATLQKKPHENIMKLLD------FFEDDQYYYIESPMHGETGSIDLFDLI 1165

Query: 124  RLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSG 183
             L+  + E+E   +  Q+T G+  +H  +  ++HRDIK ENV++ + G  K+ DFGS + 
Sbjct: 1166 ELKTNMTEYEAKLLFKQITSGVKHLH--DNGIVHRDIKDENVIVDNKGCVKLIDFGSAAY 1223

Query: 184  IIRPPKNTEEFNFVQQDIMKNTTAQYRCPEML--DLYRGQPINEKSDIWALGVFLYKICY 241
            + R P +     FV        T  Y  PE+L  D Y G+P     DIWA+GV LY I Y
Sbjct: 1224 VKRGPFDV----FV-------GTIDYAAPEVLEGDPYEGKP----QDIWAIGVLLYTIIY 1268

Query: 242  YTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQV 292
               PF N  E  IL    +     + S     LI M+L     +RP V  +
Sbjct: 1269 KENPFYNVDE--ILDGDLRINPSVIVSEECVALITMVLDRSLSKRPTVDDI 1317

>CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096w KIN2 ser/thr protein kinase
          Length = 1192

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 84/312 (26%), Positives = 145/312 (46%), Gaps = 39/312 (12%)

Query: 21  QVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEA-MQLL 79
           +V  IK +     A +++ Q +PP P+N  N   ++R    EK      RA  EA +  +
Sbjct: 132 EVCAIKIVNRATKAFLHKEQNSPP-PVN--NQEIMERQKKLEKEISRDKRAIREASLGQI 188

Query: 80  KGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMN 139
              PH+    +     ++SN        L E+  GG L+D++       L+E        
Sbjct: 189 FYHPHICRLFEMC---TMSN----HFYMLFEYVAGGQLLDYIIQ--HGSLREHHARKFAR 239

Query: 140 QVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQ 199
            V   +  +H+ N  ++HRD+KIEN++IS++GE K+ DFG +S +    K    F     
Sbjct: 240 GVASALQYLHANN--IVHRDLKIENIMISNSGEIKIIDFG-LSNVYDTRKQLHTF----- 291

Query: 200 DIMKNTTAQYRCPEMLDL--YRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAILH- 256
                 +  +  PE+L    Y G  +    D+W+ GV LY +     PF++    ++LH 
Sbjct: 292 ----CGSLYFAAPELLKAHPYTGPEV----DVWSFGVVLYVLVCGKVPFDDENS-SVLHE 342

Query: 257 ----ARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQGIPCPLPNFYLQ 312
                + +YPQ+   S  + +L+  ML+  P +R ++ QV+E     +G   P P++   
Sbjct: 343 KIKRGKVEYPQH--LSIEVMSLLSKMLVVDPSRRASLKQVVEHPWMTKGYDTPAPSYVPN 400

Query: 313 RQQATQLMMNNT 324
           R   T  M+++T
Sbjct: 401 RIPLTPEMLDST 412

>NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {ON}
            Anc_7.86
          Length = 1382

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 67/234 (28%), Positives = 106/234 (45%), Gaps = 29/234 (12%)

Query: 66   LNTLRAEVEAMQLLKGKPH--VVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNT 123
            L T+ +E++ M  L  KPH  ++  +D         D  Y  ++       G +  F   
Sbjct: 1169 LGTIPSEIQIMATLNKKPHDNILSLLD------FFEDDDYYYIETPVHGETGCIDLFDLI 1222

Query: 124  RLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSG 183
              +  + EFE   I  Q+  GI  +H  +  ++HRDIK ENV++ S G  K+ DFGS + 
Sbjct: 1223 EFKTNMTEFEAKLIFKQIVSGIKHLH--DQGIVHRDIKDENVIVDSKGCVKIIDFGSAAY 1280

Query: 184  IIRPPKNTEEFNFVQQDIMKNTTAQYRCPEML--DLYRGQPINEKSDIWALGVFLYKICY 241
            +   P +     FV        T  Y  PE+L  + Y G+P     DIWA+G+ LY I +
Sbjct: 1281 VKSGPFDV----FVG-------TIDYAAPEVLSGEPYEGKP----QDIWAIGILLYTIVF 1325

Query: 242  YTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEE 295
               PF N  E  IL    ++      S     LI+ +L+    +RP + ++  +
Sbjct: 1326 KENPFYNIDE--ILEGELKFNNSNDISEDCIELIKKILIRSVPKRPLIEEIFND 1377

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 60/204 (29%), Positives = 102/204 (50%), Gaps = 41/204 (20%)

Query: 104 EVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIE 163
           +V   +E+CPG  L D + +   +R+   E   +  Q++  +   HS++   +HRD+K+E
Sbjct: 106 KVWMALEYCPGKELYDHLLS--LHRISLLECAELFAQISGAVYYAHSMH--CVHRDLKLE 161

Query: 164 NVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNT------TAQYRCPEMLD- 216
           N+L+  NG  K+ DFG                F ++ + K T      T  Y  PE+++ 
Sbjct: 162 NILLDKNGNAKLTDFG----------------FTRECMTKTTLETVCGTTVYMAPELIER 205

Query: 217 -LYRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAILHARYQYP-QYPMYSSRL--- 271
             Y G  I    DIW+LGV LY +   + PF++  E   +  +++   + P Y S L   
Sbjct: 206 RTYDGFKI----DIWSLGVILYTLITGSLPFDDDDE---VKTKWKIVNEEPNYDSTLIPD 258

Query: 272 --KNLIRMMLMEKPEQRPNVCQVL 293
             K+LI  +L + P++RP++ QVL
Sbjct: 259 DAKDLISRLLAKNPKERPSLPQVL 282

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score = 91.3 bits (225), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 60/202 (29%), Positives = 96/202 (47%), Gaps = 37/202 (18%)

Query: 104 EVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIE 163
           +V   +E+CPG  L D + ++  +RL   E   +  Q+T  +   H+LN   +HRD+K+E
Sbjct: 107 KVWMALEYCPGKELYDHLLSK--SRLPTLECAELFAQITGAVHYAHTLN--CVHRDLKLE 162

Query: 164 NVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNT------TAQYRCPEMLDL 217
           NVL+  NG  K+ DFG                F ++ + K        T  Y  PEM+  
Sbjct: 163 NVLLDKNGNAKLTDFG----------------FTRESMTKAVLETVCGTTVYMAPEMI-- 204

Query: 218 YRGQPINE-KSDIWALGVFLYKICYYTTPFENGGERAILHARYQYPQYPMYSSRL----- 271
            + +P +  K DIW+LGV LY +     PF+   +  +L  +      P+   R+     
Sbjct: 205 -QHKPYDGFKVDIWSLGVILYTLLCGCLPFDEDDD--LLTKQKIINDTPVIDERITIPEA 261

Query: 272 KNLIRMMLMEKPEQRPNVCQVL 293
           +NLI  +L + P +RPN   +L
Sbjct: 262 QNLIEQLLSKDPTERPNTSAIL 283

>TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1237

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 70/235 (29%), Positives = 107/235 (45%), Gaps = 29/235 (12%)

Query: 66   LNTLRAEVEAMQLLKGKPHVVGYIDSNAARSIS--NDGTYEVLQLMEFCPGGGLIDFMNT 123
            L T+ +E++ M +L   P      D N  R +    D  Y  ++       G +  F   
Sbjct: 1024 LGTIPSEIQIMAVLNKHP------DENILRLLDFFEDDDYYYIETPVHGETGSIDLFDLI 1077

Query: 124  RLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSG 183
             L+  + EFE   I  QV  GI  +H     ++HRDIK ENV++ S G  K+ DFGS + 
Sbjct: 1078 ELKTNMTEFEAKLIFKQVISGIKHLHEQG--IVHRDIKDENVIVDSKGFVKLIDFGSAAY 1135

Query: 184  IIRPPKNTEEFNFVQQDIMKNTTAQYRCPEML--DLYRGQPINEKSDIWALGVFLYKICY 241
            +   P +     FV        T  Y  PE+L  + Y G+P     DIWA+G+ LY I +
Sbjct: 1136 VKSGPFDV----FV-------GTIDYAAPEVLGGEPYEGKP----QDIWAVGILLYTIVF 1180

Query: 242  YTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEV 296
               PF N  E  I+    ++      S    NLI+ +L +   +RP +  + ++V
Sbjct: 1181 KENPFYNIDE--IMEGTLKFSIGSEVSEECVNLIKKILNKNAPKRPTIQDIYDDV 1233

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score = 90.9 bits (224), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 101/205 (49%), Gaps = 41/205 (20%)

Query: 104 EVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIE 163
           +V   +E+CPG  L D + +   +R+   E + +  Q+  G+   HSLN   +HRD+K+E
Sbjct: 103 KVWMALEYCPGKELYDRVLS--MHRVPTDECVQLFAQIVGGVHYAHSLN--CVHRDLKLE 158

Query: 164 NVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNT------TAQYRCPEMLDL 217
           N+L+  +G+ K+ DFG                F ++ + K T      T  Y  PE+++ 
Sbjct: 159 NILLDKSGDAKLTDFG----------------FTRECMTKTTLETICGTTVYMAPELIER 202

Query: 218 --YRGQPINEKSDIWALGVFLYKICYYTTPF----ENGGERAILHARYQYPQY--PMYSS 269
             Y G  I    DIW+LGV LY +   + PF    E   E  I+H   Q PQ    + ++
Sbjct: 203 KSYDGFKI----DIWSLGVILYTMINGSMPFDEDDETKTEWKIVH---QTPQLNENIVTA 255

Query: 270 RLKNLIRMMLMEKPEQRPNVCQVLE 294
             K+LI  +L + P  RP V Q+L+
Sbjct: 256 DAKDLILRLLAKNPNDRPTVEQILK 280

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score = 90.5 bits (223), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 64/217 (29%), Positives = 103/217 (47%), Gaps = 34/217 (15%)

Query: 104 EVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIE 163
           E+  ++E+  GG L D++  R   +L E E ++   Q+ QG+   H+ N  + HRD+K E
Sbjct: 138 ELYLVLEYVEGGELFDYLIAR--GKLPEQEAIHYFKQIVQGVSYCHNFN--ICHRDLKPE 193

Query: 164 NVLISS-NGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEML--DLYRG 220
           N+L+   N   K+ DFG  +         E  N + +      +  Y  PE++    Y G
Sbjct: 194 NLLLDKKNKTVKIADFGMAA--------LETTNRLLE--TSCGSPHYASPEIVMGQKYHG 243

Query: 221 QPINEKSDIWALGVFLYKICYYTTPFENGGERAIL----HARYQYPQYPMYSSRLKNLIR 276
            P    SD+W+ G+ L+ +     PF +   R +L    H RYQ P     S   K+LI 
Sbjct: 244 SP----SDVWSCGIILFALLTGHLPFNDDNVRKLLLKVQHGRYQMPSN--VSKEAKDLIS 297

Query: 277 MMLMEKPEQRPNVCQVLEEVSSMQ-------GIPCPL 306
            +L+  PE+R  V ++LE    ++       G+ CPL
Sbjct: 298 KILVVDPEKRITVDKILEHPLLVKYDNPGKGGLACPL 334

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score = 90.1 bits (222), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 77/289 (26%), Positives = 121/289 (41%), Gaps = 54/289 (18%)

Query: 17  VGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVI-VPEKSGLNTLRAEVEA 75
           V I    I+K +  G F ++Y         +    L   K V+    K+  N +R     
Sbjct: 32  VDIGNYKIVKLIGEGSFGKVY---------LANHRLTHQKVVLKTGNKNDPNVVREVFYH 82

Query: 76  MQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVL 135
            Q     PH+    +     S       +V   +E+CPG  L +++   +Q+R+   E  
Sbjct: 83  RQF--DFPHITKLYEVIVTES-------KVWMALEYCPGKELYEYL--LMQHRISLEESG 131

Query: 136 NIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFN 195
            +  Q+   +   HSL    +HRD+K+EN+L+   G  K+ DFG                
Sbjct: 132 KLFAQIVSAVYYAHSLQ--CVHRDLKLENILLDKKGRAKITDFG---------------- 173

Query: 196 FVQQDIMKNT------TAQYRCPEMLDL--YRGQPINEKSDIWALGVFLYKICYYTTPFE 247
           F ++   K        T  Y  PE+++   Y G  I    DIW+LGV LY + + T PF+
Sbjct: 174 FTRECATKTMLETVCGTTVYMAPELIERKSYDGFKI----DIWSLGVILYTMIHGTMPFD 229

Query: 248 NGGE-RAILHARYQYPQY--PMYSSRLKNLIRMMLMEKPEQRPNVCQVL 293
              E +       + P Y   + S   K+LI  +L + P QRP + QVL
Sbjct: 230 EEDETKTKWKIINEEPFYNDDVVSKDAKDLISQLLCKDPSQRPQLSQVL 278

>Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (REAL)
          Length = 1356

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 69/231 (29%), Positives = 102/231 (44%), Gaps = 29/231 (12%)

Query: 66   LNTLRAEVEAMQLLKGKPHVVGYIDSNAARSIS--NDGTYEVLQLMEFCPGGGLIDFMNT 123
            L T+ +E++ M  L  KPH       N  R +    D  Y  ++       G +  F   
Sbjct: 1143 LGTIPSEIQIMATLNKKPH------ENILRLLDFFEDDDYYYIETPVHGETGCIDLFDLI 1196

Query: 124  RLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSG 183
              +  + EFE   I  QV  GI  +H  +  ++HRDIK ENV++ S G  K+ DFGS + 
Sbjct: 1197 EFKTNMTEFEAKLIFKQVVAGIKHLH--DQGIVHRDIKDENVIVDSKGFVKIIDFGSAAY 1254

Query: 184  IIRPPKNTEEFNFVQQDIMKNTTAQYRCPEML--DLYRGQPINEKSDIWALGVFLYKICY 241
            +   P +     FV        T  Y  PE+L  + Y GQP     DIWA+G+ LY + +
Sbjct: 1255 VKSGPFDV----FV-------GTIDYAAPEVLGGNPYEGQP----QDIWAIGILLYTVVF 1299

Query: 242  YTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQV 292
               PF N  E  IL    ++      S     LI+ +L  +   RP +  +
Sbjct: 1300 KENPFYNIDE--ILEGDLKFNNAEEVSEDCIELIKSILNRRVPNRPTIDDI 1348

>ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1204

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 61/223 (27%), Positives = 111/223 (49%), Gaps = 26/223 (11%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLI 167
           L E+  GG L+D++       L+E         +   +  +H+ N  ++HRD+KIEN++I
Sbjct: 242 LFEYVSGGQLLDYIIQ--HGSLREHHARKFARGIASALQYLHANN--IVHRDLKIENIMI 297

Query: 168 SSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQP-INEK 226
           S++GE K+ DFG +S +  P   T+   F         +  +  PE+L   +  P +  +
Sbjct: 298 STSGEIKIIDFG-LSNMFDP--RTQLHTFC-------GSLYFAAPELL---KASPYVGPE 344

Query: 227 SDIWALGVFLYKICYYTTPFENGGERAILH-----ARYQYPQYPMYSSRLKNLIRMMLME 281
            D+W+ GV LY +     PF++    ++LH      +  YPQ+   S  + +L+  ML+ 
Sbjct: 345 VDVWSFGVVLYVLVCGKVPFDDENS-SVLHEKIKQGKVDYPQH--LSIEVISLLSKMLVV 401

Query: 282 KPEQRPNVCQVLEEVSSMQGIPCPLPNFYLQRQQATQLMMNNT 324
            P +R ++ QV+E    ++G   P P++   R   +  M++ T
Sbjct: 402 DPRKRASLKQVVEHHWMIRGYDFPAPSYVPNRIPMSPEMLDIT 444

>KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8.279
           YLR096W
          Length = 1095

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 61/216 (28%), Positives = 106/216 (49%), Gaps = 26/216 (12%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLI 167
           L E+  GG L+D++       L+E         V   +  +H+ N  ++HRD+KIEN++I
Sbjct: 203 LFEYVSGGQLLDYIIQ--HGSLREHHARKFARGVASALQYLHANN--IVHRDLKIENIMI 258

Query: 168 SSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQP-INEK 226
           S++GE K+ DFG +S +    K    F           +  +  PE+L   +  P I  +
Sbjct: 259 STSGEIKIIDFG-LSNVFDTRKQLHTF---------CGSLYFAAPELL---KANPYIGPE 305

Query: 227 SDIWALGVFLYKICYYTTPFENGGERAILH-----ARYQYPQYPMYSSRLKNLIRMMLME 281
            DIW+ GV LY +     PF++    ++LH      + +YP +   S  + +L+  ML+ 
Sbjct: 306 VDIWSFGVVLYVLVCGKVPFDDENS-SVLHEKIKQGKVEYPNH--LSIEVISLLSKMLVV 362

Query: 282 KPEQRPNVCQVLEEVSSMQGIPCPLPNFYLQRQQAT 317
            P +R N+ +V+E    ++G   P P++  +R   T
Sbjct: 363 DPLKRANLTKVIEHPWMIRGYDFPPPSYLPKRSPMT 398

>YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One of two
            (see also PSK2) PAS domain containing S/T protein
            kinases; coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1356

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 69/231 (29%), Positives = 102/231 (44%), Gaps = 29/231 (12%)

Query: 66   LNTLRAEVEAMQLLKGKPHVVGYIDSNAARSIS--NDGTYEVLQLMEFCPGGGLIDFMNT 123
            L T+ +E++ M  L  KPH       N  R +    D  Y  ++       G +  F   
Sbjct: 1143 LGTIPSEIQIMATLNKKPH------ENILRLLDFFEDDDYYYIETPVHGETGCIDLFDLI 1196

Query: 124  RLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSG 183
              +  + EFE   I  QV  GI  +H  +  ++HRDIK ENV++ S G  K+ DFGS + 
Sbjct: 1197 EFKTNMTEFEAKLIFKQVVAGIKHLH--DQGIVHRDIKDENVIVDSKGFVKIIDFGSAAY 1254

Query: 184  IIRPPKNTEEFNFVQQDIMKNTTAQYRCPEML--DLYRGQPINEKSDIWALGVFLYKICY 241
            +   P +     FV        T  Y  PE+L  + Y GQP     DIWA+G+ LY + +
Sbjct: 1255 VKSGPFDV----FV-------GTIDYAAPEVLGGNPYEGQP----QDIWAIGILLYTVVF 1299

Query: 242  YTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQV 292
               PF N  E  IL    ++      S     LI+ +L     +RP +  +
Sbjct: 1300 KENPFYNIDE--ILEGDLKFNNAEEVSEDCIELIKSILNRCVPKRPTIDDI 1348

>Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W
            (REAL)
          Length = 1357

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 69/231 (29%), Positives = 102/231 (44%), Gaps = 29/231 (12%)

Query: 66   LNTLRAEVEAMQLLKGKPHVVGYIDSNAARSIS--NDGTYEVLQLMEFCPGGGLIDFMNT 123
            L T+ +E++ M  L  KPH       N  R +    D  Y  ++       G +  F   
Sbjct: 1144 LGTIPSEIQIMATLNKKPH------ENILRLLDFFEDDDYYYIETPVHGETGCIDLFDLI 1197

Query: 124  RLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSG 183
              +  + EFE   I  QV  GI  +H  +  ++HRDIK ENV++ S G  K+ DFGS + 
Sbjct: 1198 EFKTNMTEFEAKLIFKQVVAGIKHLH--DQGIVHRDIKDENVIVDSKGFVKIIDFGSAAY 1255

Query: 184  IIRPPKNTEEFNFVQQDIMKNTTAQYRCPEML--DLYRGQPINEKSDIWALGVFLYKICY 241
            +   P +     FV        T  Y  PE+L  + Y GQP     DIWA+G+ LY + +
Sbjct: 1256 VKSGPFDV----FV-------GTIDYAAPEVLGGNPYEGQP----QDIWAIGILLYTVVF 1300

Query: 242  YTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQV 292
               PF N  E  IL    ++      S     LI+ +L     +RP +  +
Sbjct: 1301 KENPFYNIDE--ILEGDLKFNNAEGVSEDCIELIKSILNRCVPKRPTIDDI 1349

>TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.668
           YPL150W
          Length = 871

 Score = 88.2 bits (217), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 98/202 (48%), Gaps = 35/202 (17%)

Query: 104 EVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIE 163
           +V   +E+CPG  L D++   +  R+   E   +  Q+   +   HSLN   +HRD+K+E
Sbjct: 102 KVWMSLEYCPGKELYDYL--LVMRRIPLDECSRLFAQIVGAVYYAHSLN--CVHRDLKLE 157

Query: 164 NVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNT------TAQYRCPEML-- 215
           N+L+   G  K+ DFG                F ++   KN       T  Y  PE+L  
Sbjct: 158 NILLDMQGNAKLADFG----------------FTRECATKNQLETICGTTVYMAPELLRR 201

Query: 216 DLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGE-RAILHARYQYPQY--PMYSSRLK 272
           D Y G  I    DIW+LGV LY +   + PF+   E R       + P Y   ++++   
Sbjct: 202 DTYDGFKI----DIWSLGVILYTLINGSMPFDEEDETRTEWKIINEEPDYNEKIFNANSI 257

Query: 273 NLIRMMLMEKPEQRPNVCQVLE 294
            LI+ +L++ P++RP++ ++L+
Sbjct: 258 ELIKSLLIKDPKKRPSMTEILK 279

>SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] {ON}
            similar to uniprot|P31374 Saccharomyces cerevisiae
            YAL017W PSK1 One of two (see also PSK2) PAS domain
            containing S/T protein kinases coordinately regulates
            protein synthesis and carbohydrate metabolism and storage
            in response to a unknown metabolite that reflects
            nutritional status
          Length = 1274

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 75/276 (27%), Positives = 119/276 (43%), Gaps = 32/276 (11%)

Query: 24   IIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVP---EKSGLNTLRAEVEAMQLLK 80
            I++ +  G + ++          I  + L   +R++V        L T+ +E++ M  L 
Sbjct: 1016 ILQKMGEGAYGKVDLCMHKVEQYIVVIKLIFKERILVDTWVRDRKLGTIPSEIQIMATLN 1075

Query: 81   GKPH--VVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIM 138
             KPH  ++  +D         D  Y  ++       G +  F    L+  + E E   I 
Sbjct: 1076 KKPHENILTLLD------FFEDDDYYYIETPMHGETGSIDLFDLIELKTNMTEHEAKLIF 1129

Query: 139  NQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQ 198
             QV  GI  +H  +  ++HRDIK EN+++ + G  K+ DFGS + +   P +     FV 
Sbjct: 1130 KQVASGIKHLH--DNGIVHRDIKDENIIVDNKGFVKLIDFGSAAYVKSGPFDV----FV- 1182

Query: 199  QDIMKNTTAQYRCPEML--DLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAILH 256
                   T  Y  PE+L  D Y G+P     DIWA+GV LY I +   PF N  E  IL 
Sbjct: 1183 ------GTIDYAAPEVLGGDPYEGKP----QDIWAIGVLLYTIIFKENPFYNIDE--ILD 1230

Query: 257  ARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQV 292
               +       S     LIR +L     +RP + ++
Sbjct: 1231 GDLRISSSVTVSEECIALIRRILNRSVPKRPTIEEI 1266

>KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86
           YAL017W
          Length = 368

 Score = 85.5 bits (210), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 65/234 (27%), Positives = 116/234 (49%), Gaps = 32/234 (13%)

Query: 67  NTLRAEVEAMQLLKGKPH--VVGYIDSNAARSISNDGTYEVLQLMEFCPGGG---LIDFM 121
            T+ +E+  +  L   PH  VV  ID         D  +  +++     G G   L DF+
Sbjct: 155 GTVPSEIHILTKLTELPHDNVVSMID------FFEDDDFYYVEMPIHGQGDGCIELFDFI 208

Query: 122 NTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSV 181
           + R  + + ++E   I+ Q+   I  +H  +  ++HRDIK EN+++ + G  ++ DFGS 
Sbjct: 209 DIR--DEVSDWECKLIIKQLVSAIKYLHDRD--IVHRDIKDENIIMDARGHIQLIDFGSA 264

Query: 182 SGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQP-INEKSDIWALGVFLYKIC 240
           +  +R P  T    F+        T  Y  PE+    RG+P + +  DIWALG+ LY + 
Sbjct: 265 TNAVRGPFRT----FL-------GTIDYEPPEVA---RGEPFLGKPQDIWALGILLYILR 310

Query: 241 YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLE 294
           +   PF +  ++AIL    ++PQ    ++   +LI  +L  + ++RP +  ++E
Sbjct: 311 FKEPPFLD--QKAILTGDLKFPQGTSVNTDCIDLINAILSPRVDERPTIDDIVE 362

>KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1381

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 66/231 (28%), Positives = 104/231 (45%), Gaps = 29/231 (12%)

Query: 66   LNTLRAEVEAMQLLKGKPHVVGYIDSNAARSIS--NDGTYEVLQLMEFCPGGGLIDFMNT 123
            L T+ +E++ M  L  KPH       N  R +    D  Y  ++       G +  F   
Sbjct: 1168 LGTIPSEIQIMATLNKKPH------ENILRLLDFFEDDEYYYIETPVHGETGSIDLFDLI 1221

Query: 124  RLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSG 183
               + + EFE+  +  QV  G+  +H  +  ++HRDIK EN+++ + G  K+ DFGS + 
Sbjct: 1222 EFTSNMTEFEIKLLFKQVVSGVKHLH--DQGIVHRDIKDENIIVDNKGFIKIIDFGSAAY 1279

Query: 184  IIRPPKNTEEFNFVQQDIMKNTTAQYRCPEML--DLYRGQPINEKSDIWALGVFLYKICY 241
            +   P +     FV        T  Y  PE+L  + Y G+P     DIWALG+ LY I +
Sbjct: 1280 VKSGPFDV----FVG-------TIDYAAPEVLGGNPYEGKP----QDIWALGILLYTIVF 1324

Query: 242  YTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQV 292
               PF N  E  IL    ++      S     LI+++L     +RP +  +
Sbjct: 1325 KENPFYNIDE--ILEGDLKFNDPENISQDCIELIKLILNRNVFKRPTIDDI 1373

>TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON}
           Anc_6.262 YPL236C
          Length = 372

 Score = 85.5 bits (210), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 67/271 (24%), Positives = 115/271 (42%), Gaps = 55/271 (20%)

Query: 83  PHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRL--QNRLKEFEVLNIMNQ 140
           P+++  +DS   +    DG+  +  L+ + P G L D +N  L     + E E + IM  
Sbjct: 102 PYIITLVDSQVVQE--KDGSKTLCILLPYFPLGSLQDMVNRNLLKGTFVSEAECIRIMIG 159

Query: 141 VTQGIVAMH-----------------SL-----------NPPL----------------I 156
           + +G+  +H                 SL           + PL                +
Sbjct: 160 IARGLRCLHDPSARETSDAETMRDTVSLSYSDEAAFLLDDTPLELDVLSSHNTVNTRSYV 219

Query: 157 HRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLD 216
           HRDI++ N+L SS G   V D GS            + N +Q  +  N +  Y  PE+L+
Sbjct: 220 HRDIRLANILFSSEGLPVVSDLGSCCKADITVSTKHQLNELQDWVTANCSFPYTAPELLN 279

Query: 217 LYRGQPINEKSDIWALGVFLYKICYYTTPFE-----NGGE--RAILHARYQYPQYPMYSS 269
           +     I+ K+DIW++G   Y + +  +PFE     +G     AI   +Y +P+   YS 
Sbjct: 280 VKLNSTIDCKADIWSVGCTCYAMLFGMSPFERELQVSGASLTYAIGCGKYTFPKQTRYSE 339

Query: 270 RLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQ 300
            L  +I+  L   P  RP++ ++L+ +  +Q
Sbjct: 340 SLLAVIKSCLQVDPTARPDINELLDTLQDLQ 370

>TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8.279
           YLR096W
          Length = 1126

 Score = 87.8 bits (216), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 61/224 (27%), Positives = 109/224 (48%), Gaps = 32/224 (14%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLI 167
           L E+  GG L+D++       L+E         +   +  +H+ N  ++HRD+KIEN++I
Sbjct: 180 LFEYVSGGQLLDYIIQ--HGSLREHHARKFTRGIASALQYLHANN--IVHRDLKIENIMI 235

Query: 168 SSNGEYKVCDFGSVSGIIRPPKNTEEF----NFVQQDIMKNTTAQYRCPEMLDLYRGQPI 223
           S++GE K+ DFG +S +    K    F     F   +++K   + Y  PE+         
Sbjct: 236 STSGEIKIIDFG-LSNLFDKSKQLHTFCGSLYFAAPELLK--ASPYTGPEV--------- 283

Query: 224 NEKSDIWALGVFLYKICYYTTPFENGGERAILH-----ARYQYPQYPMYSSRLKNLIRMM 278
               D+W+ GV LY +     PF++    ++LH      + +YPQ+   S  + +L+  M
Sbjct: 284 ----DVWSFGVVLYVLVCGKVPFDDENS-SVLHEKIKQGKVEYPQH--LSIEVISLLSKM 336

Query: 279 LMEKPEQRPNVCQVLEEVSSMQGIPCPLPNFYLQRQQATQLMMN 322
           L+  P +R ++ QV+E    ++G   P P++   R   T  M++
Sbjct: 337 LVVDPHRRASLKQVVEHHWMVRGYDGPPPSYVPNRIPLTPEMLD 380

>Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054W
           (REAL)
          Length = 388

 Score = 85.5 bits (210), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 66/217 (30%), Positives = 103/217 (47%), Gaps = 20/217 (9%)

Query: 24  IIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLKGKP 83
           II++L  G +  +  V+    NP   + +  +  +   E      +R E++ M   KG  
Sbjct: 40  IIQFLGKGAYGTVCSVKFKGQNPPAKIAVKKISNIFNKEILLKRAIR-ELKFMNFFKGHK 98

Query: 84  HVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQ 143
           ++V  ID     S   DG Y   +L+++     L   +++ +Q  L EF +   + Q+  
Sbjct: 99  NIVNLIDLEIVSSSPYDGLYCYQELIDY----DLAKVIHSSVQ--LSEFHIKYFLYQILC 152

Query: 144 GIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNF---VQQD 200
           G+  +HS +  +IHRD+K  N+L + NG  K+CDFG   GI     + E F     VQ  
Sbjct: 153 GLKYIHSAD--VIHRDLKPGNILCTLNGCLKICDFGLARGI-----HAEFFQCNPSVQPH 205

Query: 201 IMKNT-TAQYRCPEMLDLYRGQPINEKSDIWALGVFL 236
           I     T  YR PE+  L   QP N+  DIWA+G  L
Sbjct: 206 ITNYVATRWYRAPEL--LLSNQPYNKSIDIWAVGCIL 240

>Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C
           (REAL)
          Length = 364

 Score = 85.1 bits (209), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 85/333 (25%), Positives = 143/333 (42%), Gaps = 61/333 (18%)

Query: 13  TKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPI--NGM---NLACLKRVIVPEKSGLN 67
           T + V   +  I + L  GG + +Y VQ+   + I  NG+    +  LK++I P    ++
Sbjct: 21  TTIRVNDKRYKIQRLLGEGGMSFVYLVQLLKNSLIMENGIITPEMYALKKIICPSVESIS 80

Query: 68  TLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRL-- 125
               E+E  +  +  P+V+  IDS   +    +G+  +  ++ +   G L D +N RL  
Sbjct: 81  NGMREIENYKRFQ-SPYVIQSIDSQVTQE--KNGSKIIYIILPYYSLGSLQDSINRRLLE 137

Query: 126 QNRLKEFEVLNIMNQVTQGIVAMHS-------LNP----------------------PL- 155
              + E E + IM  VT+G++ +H        + P                      PL 
Sbjct: 138 GTFISEAECVRIMLGVTRGLLCLHDPASRQDNITPRVNVDAVSMTYSDETAMLLEDTPLE 197

Query: 156 --------------IHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDI 201
                          HRDI   N+L SS G   + D GS S       +  + + +Q+ +
Sbjct: 198 MDVLSSGSAGSIAYAHRDITPSNILYSSEGLPVIADLGSCSQADIRIGSRNQLSELQEWV 257

Query: 202 MKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPFE-----NGGE--RAI 254
             N T  Y  PE+L+L   Q ++ K DIW++G   Y + +  +PFE     +G     AI
Sbjct: 258 NDNCTLPYTAPELLNLKLNQILSCKVDIWSMGCTFYTLMFGISPFEREEQIHGASITYAI 317

Query: 255 LHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRP 287
              +Y +P+   +S  L N+I+  +   P QRP
Sbjct: 318 NTGKYSFPRNSRFSEALLNVIKKCIQVDPIQRP 350

>NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86
          Length = 1082

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 76/297 (25%), Positives = 125/297 (42%), Gaps = 37/297 (12%)

Query: 8    NYDPGTKLNV-----GIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVP- 61
            NY P T +            ++++ L  G + ++          I  + +   +R++V  
Sbjct: 803  NYTPSTSIGSQKRIKKFSDFTVLQQLGEGAYGKVKLCIHKEKRTIVVIKMIFKERILVDT 862

Query: 62   --EKSGLNTLRAEVEAMQLLKGKPH--VVGYIDSNAARSISNDGTYEVLQLMEFCPGGGL 117
                  L T+ +E++ M  L  KPH  +V  +D         D  Y  ++       G +
Sbjct: 863  WVRDRKLGTIPSEIQIMATLNKKPHKNIVALLD------FFEDEEYYYMETPAHGETGSI 916

Query: 118  IDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCD 177
              F    L+  + E+E   I  QV  G+  +H  +  ++HRDIK ENV++ S G  K+ D
Sbjct: 917  DLFDLIELKKNMTEYEEKLIFKQVVSGLKHLH--DQGIVHRDIKDENVIVDSKGHVKLID 974

Query: 178  FGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEML--DLYRGQPINEKSDIWALGVF 235
            +GS +     P +     FV        T  Y  PE+L   +Y G+P     DIWA+G+ 
Sbjct: 975  YGSAAYTKSGPFDV----FVG-------TIDYAAPEVLGGSVYDGKP----QDIWAIGIL 1019

Query: 236  LYKICYYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQV 292
            LY I +   PF N  E  I+    ++      S     LI+ +L      RP V ++
Sbjct: 1020 LYTIIFKENPFYNIDE--IMDGELRFNDAGNTSEACIKLIKKILNRSIVDRPCVDEI 1074

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 87.0 bits (214), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 78/286 (27%), Positives = 131/286 (45%), Gaps = 29/286 (10%)

Query: 27  YLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLKGKPHVV 86
           +L  GGFA+ +Q++ +  +      +A  K  I  EK+    L +E++  + +   P++V
Sbjct: 87  FLGEGGFARCFQIKDDSGDIFAAKTVA--KASIKSEKTR-KKLLSEIQIHKSM-AHPNIV 142

Query: 87  GYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIV 146
            +ID        +D    V  L+E CP G L++ +  R    L E EV     Q+   I 
Sbjct: 143 QFIDC-----FEDDSN--VYILLEICPNGSLMELLKRR--KVLSEPEVRFFTTQICGAIK 193

Query: 147 AMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTT 206
            MHS    +IHRD+K+ N+   SN   K+ DFG  + +          N  ++      T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLA---------NESERKYTICGT 242

Query: 207 AQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPFE----NGGERAILHARYQYP 262
             Y  PE+L + +    + + DIW+LGV LY +     PF+    N     I    + +P
Sbjct: 243 PNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFP 301

Query: 263 QYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQGIPCPLPN 308
           +    S   K LIR +L   P +RP++ ++++ V      P  +P+
Sbjct: 302 KDKPISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIPS 347

>Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}
           similar to Ashbya gossypii AFL143C
          Length = 363

 Score = 85.1 bits (209), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 75/346 (21%), Positives = 139/346 (40%), Gaps = 65/346 (18%)

Query: 12  GTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRA 71
           G ++++      +   L  G    +YQV+   P   +   +  LK+V  P        RA
Sbjct: 21  GVRISINGKSYLVTTLLREGELTALYQVKC--PKRSHSGGVYALKKVTCPIGRADFVTRA 78

Query: 72  EVEAMQLLK-GKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRL--QNR 128
             E     +   P++   +D   A+   ++GT  +  L+ + P G L D +N  +   + 
Sbjct: 79  MTEISNYQRFNSPYITNILDFQVAQH--DNGTKIIYMLLPYFPAGSLQDLINNMIIRGDS 136

Query: 129 LKEFEVLNIMNQVTQGIVAMHS-------------------------------------L 151
           L E  V+ +M  + +G+  MH                                      L
Sbjct: 137 LSESRVVRLMLDICRGVRCMHEPSESDFRDPYDVAYFDAASLRYSDETHLLVDAMELDLL 196

Query: 152 NPPL--------IHRDIKIENVLISSNGEYKVCDFGSVSGIIRPP---KNTEEFNFVQQD 200
           +PPL        +H  +  EN+++SS G   + +  S    +R P    +  +   +Q+ 
Sbjct: 197 SPPLTNSEPSAYVHCGLNPENIMLSSEGLPVIYNMASC---VRAPLELTSNSKLLGLQEW 253

Query: 201 IMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGE-------RA 253
           + +N+   Y CPE+LDL+    I  + DIW+LG   Y + Y  + F    +        +
Sbjct: 254 LNENSCLPYTCPELLDLHPNTSITNRCDIWSLGCICYALMYSISSFAREQQLCGTPIKHS 313

Query: 254 ILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSM 299
           I    + +P  P YS  LK +++  L+  P +RP++ + L +   +
Sbjct: 314 ISTGNFSFPDEPRYSQSLKRIVQRCLVIDPHKRPDIYETLAQFQEL 359

>TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {ON}
           Anc_5.406 YHR102W
          Length = 996

 Score = 87.4 bits (215), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 70/276 (25%), Positives = 128/276 (46%), Gaps = 37/276 (13%)

Query: 26  KYLTSGGFAQIYQ---VQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLKGK 82
           K +  G F  +Y+   ++      I  +NL C       + + +  ++ E++ + LL+  
Sbjct: 10  KVIGKGKFGTVYKGHSIKSKKVFAIKVLNLDC-------DINEIQDIQNEIKFLSLLRYA 62

Query: 83  PHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVT 142
           P++  Y  S            ++  +ME+C GG + + +      R  E  +  I+ ++ 
Sbjct: 63  PNITYYYHSYLINR-------KIWIIMEYCNGGSVRNLIKI---GRFNEIYISVILRELL 112

Query: 143 QGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIM 202
             +  +H  N  +IHRDIK  N+LI+ NG  K+CDFG  + +        EF+  ++  M
Sbjct: 113 YALEYIHHDN--IIHRDIKAANILINQNGGIKLCDFGIAAKL--------EFSKPKRQTM 162

Query: 203 KNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPF-ENGGERAI-LHARYQ 260
              T  +  PE+  +      + K+DIW++G+  Y+I     P+ E    +A+ L  + +
Sbjct: 163 AG-TPYWMAPEV--IIESSLYDTKADIWSVGITAYEITTGNPPYCEYDATKAMQLITKLK 219

Query: 261 YPQY--PMYSSRLKNLIRMMLMEKPEQRPNVCQVLE 294
            P+    MYS  LK  I + L E P +R    ++LE
Sbjct: 220 PPRLEGKMYSKSLKEFIALCLDEDPSERLTSTKLLE 255

>ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOL045W and
            YAL017W (FUN31)
          Length = 1259

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 70/231 (30%), Positives = 101/231 (43%), Gaps = 29/231 (12%)

Query: 66   LNTLRAEVEAMQLLKGKPHVVGYIDSNAARSIS--NDGTYEVLQLMEFCPGGGLIDFMNT 123
            L T+ +E++ M  L  KPH       N  R +    D  Y  ++       G +  F   
Sbjct: 1046 LGTIPSEIQIMATLNKKPH------ENIMRLLDFFEDDEYYYIESPMHGETGSIDLFDLI 1099

Query: 124  RLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSG 183
             L+  + E E   +  QV  G+  +H     ++HRDIK ENV++ + G  K+ DFGS + 
Sbjct: 1100 ELKTNMTEHEAKLLFKQVASGLRHLHENG--IVHRDIKDENVIVDNRGRVKIIDFGSAAY 1157

Query: 184  IIRPPKNTEEFNFVQQDIMKNTTAQYRCPEML--DLYRGQPINEKSDIWALGVFLYKICY 241
            + R P +     FV        T  Y  PE+L  D Y G+P     D+WA+GV LY I Y
Sbjct: 1158 VKRGPFDV----FVG-------TIDYAAPEVLGGDPYEGKP----QDVWAVGVLLYTIIY 1202

Query: 242  YTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQV 292
               PF N  E  IL    +     + S     LI  +L     +RP V  +
Sbjct: 1203 KENPFYNIDE--ILDGDLRISPAVVVSEECVALITRILNRSVNRRPTVDDI 1251

>YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One of
            two (see also PSK1) PAS domain containing S/T protein
            kinases; regulates sugar flux and translation in response
            to an unknown metabolite by phosphorylating Ugp1p and
            Gsy2p (sugar flux) and Caf20p, Tif11p and Sro9p
            (translation)
          Length = 1101

 Score = 87.0 bits (214), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 90/183 (49%), Gaps = 22/183 (12%)

Query: 116  GLIDFMNT-RLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYK 174
            G ID  +    +  + E E   +  QV   I  +H  +  ++HRDIK ENV++ S+G  K
Sbjct: 933  GSIDLFDVIEFKKDMVEHEAKLVFKQVVASIKHLH--DQGIVHRDIKDENVIVDSHGFVK 990

Query: 175  VCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEML--DLYRGQPINEKSDIWAL 232
            + DFGS + I   P +     FV        T  Y  PE+L    Y+G+P     DIWAL
Sbjct: 991  LIDFGSAAYIKSGPFDV----FVG-------TMDYAAPEVLGGSSYKGKP----QDIWAL 1035

Query: 233  GVFLYKICYYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQV 292
            GV LY I Y   P+ N  E  IL    ++ +    S    +LI+ +L  + ++RP + ++
Sbjct: 1036 GVLLYTIIYKENPYYNIDE--ILEGELRFDKSEHVSEECISLIKRILTREVDKRPTIDEI 1093

Query: 293  LEE 295
             E+
Sbjct: 1094 YED 1096

>SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1062

 Score = 87.0 bits (214), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 58/208 (27%), Positives = 101/208 (48%), Gaps = 26/208 (12%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLI 167
           L E+  GG L+D++       L+E         +   +  +H  N  ++HRD+KIEN++I
Sbjct: 181 LFEYVSGGQLLDYIIQ--HGSLRERHARKFARGIASALQYLHMNN--IVHRDLKIENIMI 236

Query: 168 SSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQP-INEK 226
           S++GE K+ DFG +S +  P K    F           +  +  PE+L   +  P I  +
Sbjct: 237 STSGEIKIIDFG-LSNMYDPKKQLHTF---------CGSLYFAAPELL---KAHPYIGPE 283

Query: 227 SDIWALGVFLYKICYYTTPFENGGERAILH-----ARYQYPQYPMYSSRLKNLIRMMLME 281
            D+W+ GV LY +     PF++    ++LH      + +YPQ+   S  + +L+  ML+ 
Sbjct: 284 VDVWSFGVVLYVLVCGKVPFDDENA-SVLHEKIKQGKVEYPQH--LSIEVISLLSKMLVV 340

Query: 282 KPEQRPNVCQVLEEVSSMQGIPCPLPNF 309
            P +R  + QV+      +G   P P++
Sbjct: 341 DPSKRATLKQVVSHQWMQRGYDFPAPSY 368

>TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1367

 Score = 87.0 bits (214), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 67/234 (28%), Positives = 108/234 (46%), Gaps = 29/234 (12%)

Query: 66   LNTLRAEVEAMQLLKGKPH--VVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNT 123
            L T+ +E++ M  L   PH  ++  +D         D  Y  ++       G +  F   
Sbjct: 1154 LGTIPSEIQIMTTLNKSPHENIMQLLD------FFEDDDYYYIETPLHGETGCIDLFDLI 1207

Query: 124  RLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSG 183
              ++ + E E   I  QV  GI  +H  N  ++HRD+K ENV++ + G  K+ DFGS + 
Sbjct: 1208 EFKSNMTESEARLIFIQVVLGIKHLHDSN--IVHRDVKDENVIVDAKGFVKLIDFGSAAY 1265

Query: 184  IIRPPKNTEEFNFVQQDIMKNTTAQYRCPEML--DLYRGQPINEKSDIWALGVFLYKICY 241
            +   P +     FV        T  Y  PE+L  + Y G+P     DIWA+G+ LY I +
Sbjct: 1266 VNSGPFDV----FV-------GTIDYAAPEVLSGEPYLGKP----QDIWAIGILLYTIMF 1310

Query: 242  YTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEE 295
               PF N  E  IL A  +       S    +LI+ +L + P +RP + +++ +
Sbjct: 1311 KENPFYNIDE--ILEAELKINNTSDASQDCIDLIKRILTKNPNKRPTIDEIVND 1362

>Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL045W
            (REAL)
          Length = 1101

 Score = 87.0 bits (214), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 89/183 (48%), Gaps = 22/183 (12%)

Query: 116  GLIDFMNT-RLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYK 174
            G ID  +    +  + E E   +  QV   I  +H  N  ++HRDIK ENV++ S+G  K
Sbjct: 933  GSIDLFDVIEFKKDMVEHEAKLVFKQVVASIKHLH--NQGIVHRDIKDENVIVDSHGFVK 990

Query: 175  VCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEML--DLYRGQPINEKSDIWAL 232
            + DFGS + +   P +     FV        T  Y  PE+L    Y+G+P     DIWAL
Sbjct: 991  LIDFGSAAYVKSGPFDV----FVG-------TMDYAAPEVLGGSSYKGKP----QDIWAL 1035

Query: 233  GVFLYKICYYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQV 292
            GV LY I Y   P+ N  E  IL    ++ +    S     LI+ +L  + ++RP + ++
Sbjct: 1036 GVLLYTIIYKENPYYNIDE--ILEGELRFDKAEKVSEGCIGLIKRILTREVDKRPTIDEI 1093

Query: 293  LEE 295
             E+
Sbjct: 1094 YED 1096

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score = 86.7 bits (213), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 60/203 (29%), Positives = 97/203 (47%), Gaps = 39/203 (19%)

Query: 105 VLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIEN 164
           V   +E+CPG  L +++  +    L+E   L   +Q+   +   HS+    +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYLLAKKHIPLEECSEL--FSQIVGAVYYAHSMK--CVHRDLKLEN 158

Query: 165 VLISSNGEYKVCDFG-----SVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDL-- 217
           +L+   G  K+ DFG     +  GI+              + +  TT  Y  PE+++   
Sbjct: 159 ILLDKKGHAKLTDFGFTRECATKGIL--------------ETICGTTV-YMAPELIERKP 203

Query: 218 YRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAILHARYQYPQY-PMY-----SSRL 271
           Y G  I    D W+LG+ LY + + T PF+   E   +  +Y+   Y P Y      S  
Sbjct: 204 YEGYKI----DTWSLGIILYTMIHGTMPFDEVDE---VKTKYKIVHYNPTYDNDYIDSNG 256

Query: 272 KNLIRMMLMEKPEQRPNVCQVLE 294
           K LI  +L + P QRP++ QVL+
Sbjct: 257 KELISQLLEKDPNQRPSLTQVLQ 279

>CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} similar
           to uniprot|Q12236 Saccharomyces cerevisiae YOL100w PKH2
          Length = 1076

 Score = 87.0 bits (214), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 57/192 (29%), Positives = 95/192 (49%), Gaps = 17/192 (8%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLI 167
           L+E+ P G  +  M  +    L E        Q+  GI  +HS    +IHRDIK EN+L+
Sbjct: 259 LLEYAPNGDFLSVM--KKYGSLSEDCTRYYSAQIIDGIKYLHSKG--IIHRDIKPENILL 314

Query: 168 SSNGEYKVCDFGSVSGIIRPPKNTE----EFNFVQQDIMKNTTAQYRCPEML-DLYRGQP 222
             + + K+ DFG+    I  PKN +    EFN + +      TA+Y  PE+L D Y    
Sbjct: 315 DKDMKVKITDFGTAK--ILEPKNEDEDNPEFNLLTRSKSFVGTAEYVSPELLNDSY---- 368

Query: 223 INEKSDIWALGVFLYKICYYTTPFENGGERAILHA--RYQYPQYPMYSSRLKNLIRMMLM 280
           ++ + DIWA G  ++++     PF+   E        + QY     +   +++L++ +L+
Sbjct: 369 VDARCDIWAFGCMVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPVVVRDLVKRILL 428

Query: 281 EKPEQRPNVCQV 292
           + PEQR  + Q+
Sbjct: 429 KVPEQRLTIPQI 440

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
           (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score = 86.7 bits (213), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 71/273 (26%), Positives = 126/273 (46%), Gaps = 32/273 (11%)

Query: 27  YLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLKGKPHVV 86
           +L  GGFA+ +Q++ +         +A   ++ +  +   N L +E++  + ++ + ++V
Sbjct: 103 FLGEGGFARCFQMKDDDGKVFAAKTVA---KISIKSEKARNKLLSEIQIHKNMRHQ-NIV 158

Query: 87  GYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIV 146
            +ID         +    V  L+E CP G L+D +  R    L E EV     Q+   + 
Sbjct: 159 HFIDCF-------EDDINVYILLEICPNGSLMDLLKRR--KILTEPEVRFFTTQICGALD 209

Query: 147 AMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTT 206
            MHS N  +IHRD+K+ N+    +   K+ DFG ++ II   +N  ++           T
Sbjct: 210 HMHSRN--IIHRDLKLGNIFFDKDFNLKIGDFG-LAAIIN-NENERKYTIC-------GT 258

Query: 207 AQYRCPEMLDLYRGQPINE--KSDIWALGVFLYKICYYTTPFENGGERAIL----HARYQ 260
             Y  PE+  +  G+ I    + DIW+LGV ++ +     PF+      I     H  Y 
Sbjct: 259 PNYIAPEV--IMGGKQIGHSFEVDIWSLGVMIFAMITGKPPFQAKEVSTIYDRIKHCNYS 316

Query: 261 YPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVL 293
           +P     S  +K LI+ +L   P +RP + ++L
Sbjct: 317 FPTDKYVSKDVKKLIQDILSMNPMERPTIQEIL 349

>YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}
           KIN1Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1064

 Score = 86.7 bits (213), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 59/222 (26%), Positives = 109/222 (49%), Gaps = 28/222 (12%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLI 167
           L E+  GG L+D++       ++E +       +   ++ +H+ N  ++HRD+KIEN++I
Sbjct: 222 LFEYVSGGQLLDYIIQ--HGSIREHQARKFARGIASALIYLHANN--IVHRDLKIENIMI 277

Query: 168 SSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDL--YRGQPINE 225
           S + E K+ DFG +S I    K    F           +  +  PE+L    Y G  +  
Sbjct: 278 SDSSEIKIIDFG-LSNIYDSRKQLHTF---------CGSLYFAAPELLKANPYTGPEV-- 325

Query: 226 KSDIWALGVFLYKICYYTTPFENGGERAILH-----ARYQYPQYPMYSSRLKNLIRMMLM 280
             D+W+ GV L+ +     PF++    ++LH      + +YPQ+   S  + +L+  ML+
Sbjct: 326 --DVWSFGVVLFVLVCGKVPFDDENS-SVLHEKIKQGKVEYPQH--LSIEVISLLSKMLV 380

Query: 281 EKPEQRPNVCQVLEEVSSMQGIPCPLPNFYLQRQQATQLMMN 322
             P++R  + QV+E    ++G   P P++  +R   T  M++
Sbjct: 381 VDPKRRATLKQVVEHHWMVRGFNGPPPSYLPKRVPLTIEMLD 422

>Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON}
            (57057..60950) [3894 nt, 1298 aa]
          Length = 1297

 Score = 87.0 bits (214), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 68/232 (29%), Positives = 105/232 (45%), Gaps = 31/232 (13%)

Query: 66   LNTLRAEVEAMQLLKGKPH--VVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMN- 122
            L T+ +E++ M  L   PH  ++  +D        +D  Y +   M      G ID  + 
Sbjct: 1084 LGTILSEIQIMSTLNKHPHDNILRLLDF-----FEDDDYYYIETPMH--GETGCIDLFDL 1136

Query: 123  TRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVS 182
               +  + E E   I  QV   I  +H  +  ++HRDIK ENV++ S G  K+ DFGS +
Sbjct: 1137 IEFKTNMSEVETKLIFMQVVSSIKFLH--DQGIVHRDIKDENVIVDSQGFIKLIDFGSAA 1194

Query: 183  GIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEML--DLYRGQPINEKSDIWALGVFLYKIC 240
             +   P +     FV        T  Y  PE+L  + Y G+P     DIWA+G+ LY I 
Sbjct: 1195 YVKSGPFDV----FV-------GTIDYAAPEVLGGEPYVGKP----QDIWAIGILLYTII 1239

Query: 241  YYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQV 292
            +   PF N  E  IL A  ++           +LI+ +L   P +RP + ++
Sbjct: 1240 FKENPFYNIDE--ILEAELKFNTSTGACEDCVDLIKRILTRNPTKRPTIDEI 1289

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 75/276 (27%), Positives = 120/276 (43%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLKGKPH-- 84
           +L  GGFA+ +Q++           +A  K  I  EK    T R  +  +Q+ K   H  
Sbjct: 100 FLGEGGFARCFQIKDESGKIFAAKTVA--KISIKSEK----TKRKLLSEIQIHKSMKHSN 153

Query: 85  VVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQG 144
           +V +ID        +D    V  L+E CP G L+D +  R    L E EV     Q+   
Sbjct: 154 IVQFIDC-----FEDDAN--VYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGA 204

Query: 145 IVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKN 204
           I  +HS    +IHRD+K+ N+    +   KV DFG  + +          N  ++     
Sbjct: 205 IKYLHSRR--IIHRDLKLGNIFFDKDYNLKVGDFGLAAVLA---------NDRERKYTVC 253

Query: 205 TTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAILH----ARYQ 260
            T  Y  PE+L + +    + + DIW++GV +Y +     PF+      I       +Y 
Sbjct: 254 GTPNYIAPEVL-MGKHSGHSFEVDIWSIGVMIYALLVGKPPFQAKDVNVIYERIKLCKYG 312

Query: 261 YPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEV 296
           YP+    S   + LI  +L   P QRP +  ++++V
Sbjct: 313 YPKDKYVSKEAEILIHDILSLNPLQRPTIIDIIDDV 348

>Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL045W
            (REAL)
          Length = 1101

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 88/183 (48%), Gaps = 22/183 (12%)

Query: 116  GLIDFMNT-RLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYK 174
            G ID  +    +  + E E   +  QV   I  +H     ++HRDIK ENV++ S+G  K
Sbjct: 933  GSIDLFDVIEFKKDMVEHEAKLVFKQVVASIKHLHGQG--IVHRDIKDENVIVDSHGFVK 990

Query: 175  VCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEML--DLYRGQPINEKSDIWAL 232
            + DFGS + I   P +     FV        T  Y  PE+L    Y+G+P     DIWAL
Sbjct: 991  LIDFGSAAYIKSGPFDV----FVG-------TMDYAAPEVLGGSSYKGKP----QDIWAL 1035

Query: 233  GVFLYKICYYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQV 292
            GV LY I Y   P+ N  E  IL    ++ +    S     LI+ +L  + ++RP + ++
Sbjct: 1036 GVLLYTIIYKENPYYNIDE--ILEGELRFDKSEKVSEECIGLIKRILTREVDKRPTIDEI 1093

Query: 293  LEE 295
             E+
Sbjct: 1094 YED 1096

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 95/201 (47%), Gaps = 35/201 (17%)

Query: 104 EVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIE 163
           +V   +E+CPG  L + +   + +R+   E   +  Q+   +   HSLN   +HRD+K+E
Sbjct: 102 KVWMALEYCPGRELYEHL--LMLHRIPLDECAKLFAQIVSAVHYAHSLN--CVHRDLKLE 157

Query: 164 NVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNT------TAQYRCPEML-- 215
           N+L+  NG  K+ DFG                F ++ + K++      T  Y  PE++  
Sbjct: 158 NILLDKNGNAKLTDFG----------------FTRECVSKSSLETICGTTVYMAPELIQR 201

Query: 216 DLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGE-RAILHARYQYPQY--PMYSSRLK 272
             Y G  I    DIW+LGV LY +   T PF+   E +        +P +     S   K
Sbjct: 202 QAYDGFKI----DIWSLGVILYTMINGTMPFDEDDETKTKWKIVNDFPNFNDNFVSHEAK 257

Query: 273 NLIRMMLMEKPEQRPNVCQVL 293
           +LI+ +L + P +RP + Q+L
Sbjct: 258 DLIKRLLAKCPSERPTMEQIL 278

>KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 1016

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 61/223 (27%), Positives = 108/223 (48%), Gaps = 27/223 (12%)

Query: 69  LRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNR 128
           +R E++ +  LK  P++  Y  S    +       ++  +ME+C GG L   +   +   
Sbjct: 59  IRKEIQFLSSLKQTPNITHYYGSYLIDT-------KLWVIMEYCAGGSLRTLLRPGI--- 108

Query: 129 LKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPP 188
           ++E  +  IM ++   ++++H  N  +IHRDIK  N+LI++NG  K+CDFG  + + +  
Sbjct: 109 IEEKYIGVIMREILVALISIHRDN--VIHRDIKAANILIANNGSVKLCDFGVAAQLSQ-- 164

Query: 189 KNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPF-E 247
                 + +++  M   T  +  PE+  +  G   + K DIW+LG+  Y+I     P+  
Sbjct: 165 ------SMLKRQTMAG-TPYWMAPEV--IMEGVYYDTKVDIWSLGITAYEIATGNPPYCH 215

Query: 248 NGGERAILHARYQYP---QYPMYSSRLKNLIRMMLMEKPEQRP 287
               RA+       P   +   YS  LK  I + L E P++RP
Sbjct: 216 MEAIRAMQMITKSKPPRLEGREYSQPLKEFIALCLDEDPKERP 258

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 75/283 (26%), Positives = 128/283 (45%), Gaps = 30/283 (10%)

Query: 27  YLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLKGKPHVV 86
           +L  GGFA+ +Q++           +A   ++ +  +     L +E++  + +K  P++V
Sbjct: 97  FLGEGGFARCFQIKDESGKIFAAKTVA---KISIKTEKTKKKLLSEIQIHKSMK-HPNIV 152

Query: 87  GYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIV 146
            ++D         D T  V  L+E C  G L+D M  R    L E EV     Q+   + 
Sbjct: 153 HFVDC------FEDDT-NVYILLEICSNGSLMDLMKKR--KTLTEPEVRFFTTQICGAVK 203

Query: 147 AMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTT 206
            MHS    +IHRD+K+ N+    +   KV DFG  + +     N  E  +         T
Sbjct: 204 YMHSRR--VIHRDLKLGNIFFDKDYNLKVGDFGLAAVL----ANNRERKYTVCG-----T 252

Query: 207 AQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAILH----ARYQYP 262
             Y  PE+L + +    + + DIW++GV +Y +     PF+      I       +Y YP
Sbjct: 253 PNYIAPEVL-MGKHAGHSFEVDIWSIGVMIYALLVGKPPFQAKDVNVIYDRIKACQYGYP 311

Query: 263 QYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQGIPCP 305
           +    SS  K LI  +L   P +RP++ +++++V   +GI  P
Sbjct: 312 KDKYVSSEAKTLIADILCVDPVERPSIREIIDDV-WFRGIFPP 353

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 74/286 (25%), Positives = 125/286 (43%), Gaps = 62/286 (21%)

Query: 24  IIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLKGKP 83
           I+K +  G F ++Y     P +        CLK     +K+  N +R      Q     P
Sbjct: 43  ILKQIGEGSFGKVYLALHRPTH-----RKVCLK---TSDKNDPNIVREVFYHRQF--DFP 92

Query: 84  HVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQ 143
           ++    +     S       +V   +E+CPG  L D + +   +R+   E   +  Q++ 
Sbjct: 93  YITKLYEVIVTES-------KVWMALEYCPGKELYDHLLS--LHRISLLECGELFAQISG 143

Query: 144 GIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMK 203
            +   HS++   +HRD+K+EN+L+  NG  K+ DFG                F ++ + K
Sbjct: 144 AVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDFG----------------FTRECMTK 185

Query: 204 NT------TAQYRCPEML--DLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAIL 255
            T      T  Y  PE++    Y G  I    D W+LGV LY +   + PF++  E    
Sbjct: 186 TTLETVCGTTVYMAPELIGRKTYDGFKI----DTWSLGVILYTLITGSLPFDDDDE---- 237

Query: 256 HARYQYP---QYPMYSSRL-----KNLIRMMLMEKPEQRPNVCQVL 293
            A+ ++    + P Y  +L     K+LI  +L + P +RP++ QVL
Sbjct: 238 -AKTKWKIVNEEPKYDPKLIPDDAKDLISRLLAKNPGERPSLPQVL 282

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 77/286 (26%), Positives = 130/286 (45%), Gaps = 29/286 (10%)

Query: 27  YLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLKGKPHVV 86
           +L  GGFA+ +Q++ +         +A  K  I  EK+    L +E++  + +   P++V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA--KASIKSEKTR-KKLLSEIQIHKSM-AHPNIV 142

Query: 87  GYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIV 146
            ++D        +D    V  L+E CP G L++ +  R    L E EV     Q+   I 
Sbjct: 143 QFVDC-----FEDDSN--VYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 AMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTT 206
            MHS    +IHRD+K+ N+   SN   K+ DFG  + +          N  ++      T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLA---------NESERKYTICGT 242

Query: 207 AQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPFE----NGGERAILHARYQYP 262
             Y  PE+L + +    + + DIW+LGV LY +     PF+    N     I    + +P
Sbjct: 243 PNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFP 301

Query: 263 QYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQGIPCPLPN 308
           +    S   K LIR +L   P +RP++ ++++ V      P  +P+
Sbjct: 302 KDKPISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIPS 347

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 78/286 (27%), Positives = 130/286 (45%), Gaps = 29/286 (10%)

Query: 27  YLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLKGKPHVV 86
           +L  GGFA+ +Q++ +         +A  K  I  EK+    L +E++  + +   P++V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA--KASIKSEKTR-KKLLSEIQIHKSM-SHPNIV 142

Query: 87  GYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIV 146
            +ID        +D    V  L+E CP G L++ +  R    L E EV     Q+   I 
Sbjct: 143 QFIDC-----FEDDSN--VYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 AMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTT 206
            MHS    +IHRD+K+ N+   SN   K+ DFG  + +          N  ++      T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLA---------NESERKYTICGT 242

Query: 207 AQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPFE----NGGERAILHARYQYP 262
             Y  PE+L + +    + + DIW+LGV LY +     PF+    N     I    + +P
Sbjct: 243 PNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFP 301

Query: 263 QYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQGIPCPLPN 308
           +    S   K LIR +L   P +RP++ ++++ V      P  +P+
Sbjct: 302 RDKPISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIPS 347

>KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8.279
           YLR096W
          Length = 1192

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 60/221 (27%), Positives = 110/221 (49%), Gaps = 26/221 (11%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLI 167
           L E+  GG L+D++       L+E         +   +  +H+ N  ++HRD+KIEN++I
Sbjct: 211 LFEYVSGGQLLDYIIQ--HGSLREHHARKFARGIGSALQYLHANN--IVHRDLKIENIMI 266

Query: 168 SSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQP-INEK 226
           S++GE K+ DFG +S +  P K    F           +  +  PE+L   + +P +  +
Sbjct: 267 STSGEIKIIDFG-LSNVYDPRKQLHTF---------CGSLYFAAPELL---KARPYLGPE 313

Query: 227 SDIWALGVFLYKICYYTTPFENGGERAILHAR-----YQYPQYPMYSSRLKNLIRMMLME 281
            D+W+ GV LY +     PF++    ++LH +      +YP +   S  + +L+  ML+ 
Sbjct: 314 VDVWSFGVVLYVLVCGKVPFDDEVS-SVLHEKIKQGNVEYPNH--LSIEVLSLLSKMLVV 370

Query: 282 KPEQRPNVCQVLEEVSSMQGIPCPLPNFYLQRQQATQLMMN 322
            PE+R ++ QV+E     +G     P++  +R   T  M++
Sbjct: 371 DPERRASLKQVIEHPWMNRGYDYITPSYLPKRIPLTPDMLD 411

>ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR102W
           (KIC1)
          Length = 947

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 75/267 (28%), Positives = 124/267 (46%), Gaps = 50/267 (18%)

Query: 35  QIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAA 94
           Q+Y V+V        +NL C      PE   +  ++ E++ +  LK  P++  Y      
Sbjct: 49  QVYAVKV--------LNLDC------PEDE-VEDVQKEIQFLASLKQVPNITRYY----- 88

Query: 95  RSISNDGTY----EVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHS 150
                 G+Y    ++  +ME+C GG L   +      ++ E  +  I+ ++   +V +H 
Sbjct: 89  ------GSYLYDTKLWVIMEYCAGGSLRTLLR---PGKIDEKYLGVIVRKLLIALVYIHK 139

Query: 151 LNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYR 210
            N  +IHRDIK  NVLI++ G  K+CDFG  + +          N  +Q +    T  + 
Sbjct: 140 DN--VIHRDIKAANVLITNEGHVKLCDFGVAAQLT-------AANHKRQTMAG--TPYWM 188

Query: 211 CPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPF-ENGGERAI-LHARYQYPQYPM-- 266
            PE+  +  G   N K+DIW+LG+  Y+I     P+ +    RA+ L  + + P+     
Sbjct: 189 APEV--IMEGVYYNTKADIWSLGITAYEIATGNPPYCDVEALRAMQLITKSKPPRLEGRN 246

Query: 267 YSSRLKNLIRMMLMEKPEQRPNVCQVL 293
           YS  LK  I + L E PE+RP    +L
Sbjct: 247 YSPLLKEFIALCLDEDPEERPTAEDLL 273

>Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {ON}
           YDR122W (KIN1) - Serine/threonine protein kinase [contig
           174] PARTIAL
          Length = 858

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 61/226 (26%), Positives = 107/226 (47%), Gaps = 32/226 (14%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLI 167
           L E+  GG L+D++       L+E         +   +  +H  N  ++HRD+KIEN++I
Sbjct: 11  LFEYVSGGQLLDYIIQ--HGSLRERSARKFARGIASALQYLHMNN--IVHRDLKIENIMI 66

Query: 168 SSNGEYKVCDFGSVSGIIRPPKNTEEF----NFVQQDIMKNTTAQYRCPEMLDLYRGQPI 223
           S++GE K+ DFG +S +  P K    F     F   +++K       CP     Y G  +
Sbjct: 67  STSGEIKIIDFG-LSNMYNPKKQLHTFCGSLYFAAPELLKA------CP-----YTGPEV 114

Query: 224 NEKSDIWALGVFLYKICYYTTPFENGGERAILH-----ARYQYPQYPMYSSRLKNLIRMM 278
               D+W+ GV L+ +     PF++    ++LH      + +YPQ+   S  + +L+  M
Sbjct: 115 ----DVWSFGVVLFVLVCGKVPFDDENS-SVLHEKIKQGKVEYPQH--LSIEVISLLSKM 167

Query: 279 LMEKPEQRPNVCQVLEEVSSMQGIPCPLPNFYLQRQQATQLMMNNT 324
           L+  P +R ++ QV+      +G   P P++   R   T   ++ T
Sbjct: 168 LVVDPTKRASLKQVVNHQWMQRGYDFPAPSYIPHRVPLTADALDAT 213

>Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON}
           similar to Ashbya gossypii AGR058W
          Length = 1145

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 62/222 (27%), Positives = 105/222 (47%), Gaps = 28/222 (12%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLI 167
           L E+  GG L+D++       L+E         +   +  +H  N  ++HRD+KIEN++I
Sbjct: 219 LFEYVSGGQLLDYIIQ--HGSLRERHARKFARGIASALQYLHMNN--IVHRDLKIENIMI 274

Query: 168 SSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDL--YRGQPINE 225
           SS+GE ++ DFG +S +  P K    F           +  +  PE+L    Y G  +  
Sbjct: 275 SSSGEIRIIDFG-LSNLYDPKKQLHTF---------CGSLYFAAPELLKAHPYTGPEV-- 322

Query: 226 KSDIWALGVFLYKICYYTTPFENGGERAILH-----ARYQYPQYPMYSSRLKNLIRMMLM 280
             DIW+ GV LY +     PF++    ++LH      + +YPQ+   S  + +L+  ML+
Sbjct: 323 --DIWSFGVVLYVLVCGKVPFDDENA-SVLHEKIKQGKVEYPQH--LSIDVISLLSKMLV 377

Query: 281 EKPEQRPNVCQVLEEVSSMQGIPCPLPNFYLQRQQATQLMMN 322
             P +R  + QV+      +G   P P++  Q    T  ++N
Sbjct: 378 VDPLKRATLKQVVNHQWMQKGYDFPPPSYLPQSVPLTSDLIN 419

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 78/285 (27%), Positives = 129/285 (45%), Gaps = 29/285 (10%)

Query: 27  YLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLKGKPHVV 86
           +L  GGFA+ +Q++ +         +A  K  I  EK+    L +E++  + +   P++V
Sbjct: 87  FLGEGGFARCFQIKDDSGEIFAAKTVA--KASIKSEKTR-KKLLSEIQIHKSM-SHPNIV 142

Query: 87  GYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIV 146
            +ID        +D    V  L+E CP G L++ +  R    L E EV     Q+   I 
Sbjct: 143 QFIDC-----FEDDSN--VYILLEICPNGSLMELLKRR--KVLTEPEVRFFTTQICGAIK 193

Query: 147 AMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTT 206
            MHS    +IHRD+K+ N+   SN   K+ DFG  + +          N  ++      T
Sbjct: 194 YMHSRR--VIHRDLKLGNIFFDSNYNLKIGDFGLAAVLA---------NESERKYTICGT 242

Query: 207 AQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPFE----NGGERAILHARYQYP 262
             Y  PE+L + +    + + DIW+LGV LY +     PF+    N     I    + +P
Sbjct: 243 PNYIAPEVL-MGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFP 301

Query: 263 QYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQGIPCPLP 307
           +    S   K LIR +L   P +RP++ ++++ V      P  +P
Sbjct: 302 KDKPISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIP 346

>CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017w FUN31
          Length = 1336

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 62/231 (26%), Positives = 103/231 (44%), Gaps = 29/231 (12%)

Query: 66   LNTLRAEVEAMQLLKGKPH--VVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNT 123
            L T+ +E++ M  +  +PH  ++  +D         D  Y  ++       G +  F   
Sbjct: 1123 LGTIPSEIQIMATISKEPHENILTLLD------FFEDDDYYYIETPVHGETGSIDLFDLI 1176

Query: 124  RLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSG 183
              +  + E E   +  QV  G+  +H  +  ++HRDIK EN+++ S G  K+ DFGS + 
Sbjct: 1177 EFKTNMTEIEAKLLFKQVVSGVKHLH--DQGIVHRDIKDENIIVDSQGFVKIIDFGSAAY 1234

Query: 184  IIRPPKNTEEFNFVQQDIMKNTTAQYRCPEML--DLYRGQPINEKSDIWALGVFLYKICY 241
            +   P +     FV        T  Y  PE+L    Y G+P     DIWA+G+ LY I +
Sbjct: 1235 VKSGPFDV----FV-------GTIDYAAPEVLGGSPYEGKP----QDIWAIGILLYTIVF 1279

Query: 242  YTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQV 292
               PF N  E  IL    ++    + S +   LI  +L    ++RP +  +
Sbjct: 1280 KENPFYNIDE--ILEGELKFNSSELVSEQCTTLIAKILNRNVQKRPTIDDI 1328

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 60/195 (30%), Positives = 95/195 (48%), Gaps = 23/195 (11%)

Query: 104 EVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIE 163
           +V  ++E+CP   L D++ ++   R+   E   I  Q+   +   HSL+   +HRD+K+E
Sbjct: 104 KVWMVIEYCPNKELYDYLLSK--KRISLDESARIFAQIVGAVYYAHSLS--CVHRDLKLE 159

Query: 164 NVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEML--DLYRGQ 221
           N+L+  +   K+ DFG         KNT      Q + +  TT  Y  PE+L  + Y G 
Sbjct: 160 NILLDKDNNAKLTDFGFTRDF---SKNT------QLETICGTTV-YMAPELLRREKYDGY 209

Query: 222 PINEKSDIWALGVFLYKICYYTTPF-ENGGERAILHARYQYPQYP--MYSSRLKNLIRMM 278
            I    DIWALG+ LY I   T PF E+  ++  L      P Y    ++    +L+  +
Sbjct: 210 KI----DIWALGILLYTIINGTMPFDEDDPKKTELKIISASPDYDNKYFNDDSIDLVNRL 265

Query: 279 LMEKPEQRPNVCQVL 293
           L + P  RP + Q+L
Sbjct: 266 LSKDPSMRPTIEQIL 280

>KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1142

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 106/226 (46%), Gaps = 32/226 (14%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLI 167
           L E+  GG L+D++       L+E         +   +  +H  N  ++HRD+KIEN++I
Sbjct: 286 LFEYVSGGQLLDYIIQ--HGSLRERSARKFARGIASALQYLHLNN--IVHRDLKIENIMI 341

Query: 168 SSNGEYKVCDFGSVSGIIRPPKNTEEFN----FVQQDIMKNTTAQYRCPEMLDLYRGQPI 223
           S++GE K+ DFG +S +  P K    F     F   +++K       CP     Y G  +
Sbjct: 342 STSGEIKIIDFG-LSNMFNPKKQLHTFCGSLYFAAPELLKA------CP-----YTGPEV 389

Query: 224 NEKSDIWALGVFLYKICYYTTPFENGGERAILH-----ARYQYPQYPMYSSRLKNLIRMM 278
               D+W+ GV LY +     PF++    ++LH      + +YPQ+   S  + +L+  M
Sbjct: 390 ----DVWSFGVVLYVLVCGKVPFDDENS-SVLHEKIKQGKVEYPQH--LSIEVISLLSKM 442

Query: 279 LMEKPEQRPNVCQVLEEVSSMQGIPCPLPNFYLQRQQATQLMMNNT 324
           L+  P +R  + QV+      +G   P P++   R   T   ++ T
Sbjct: 443 LVVDPSKRATLKQVVNHQWMQRGYDFPAPSYIPHRVPLTADALDPT 488

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score = 85.1 bits (209), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 73/276 (26%), Positives = 127/276 (46%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLKGKPHVV 86
           +L  GGFA+ +Q++ +         +A   ++ +  +     L +E++  + +K  P++V
Sbjct: 78  FLGEGGFARCFQMKDDSGKVFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMK-HPNIV 133

Query: 87  GYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIV 146
            + D         D T  V  L+E CP G L+D +  R Q  L E EV     Q+   I 
Sbjct: 134 QFTDC------FEDDT-NVYILLEICPNGSLMDLLKQRKQ--LTEPEVRFFTTQIVGAIK 184

Query: 147 AMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTT 206
            MHS    +IHRD+K+ N+    +   K+ DFG  + +          N  ++      T
Sbjct: 185 YMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFGLAAVLA---------NDRERKYTICGT 233

Query: 207 AQYRCPEML-DLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAILHAR-----YQ 260
             Y  PE+L   + G     + DIW++GV +Y +     PF+   E   ++ R     + 
Sbjct: 234 PNYIAPEVLTGKHTGHSF--EVDIWSIGVMIYALLIGKPPFQ-AKEVNTIYERIKVCDFS 290

Query: 261 YPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEV 296
           +P+    SS  K LI+ +L   P +RP++ +++E V
Sbjct: 291 FPKDKPISSEAKVLIKDILSLDPLERPSLAEIMEYV 326

>Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054W
           (REAL)
          Length = 398

 Score = 83.6 bits (205), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 62/215 (28%), Positives = 101/215 (46%), Gaps = 13/215 (6%)

Query: 24  IIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLKGKP 83
           II++L  G +  +  V+     P   + +  +  +   E      +R E++ M   KG  
Sbjct: 48  IIQFLGKGAYGTVCSVKFKGQTPPAKIAVKKISNIFNKEILLKRAIR-ELKFMNFFKGHK 106

Query: 84  HVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQ 143
           ++V  ID     S   DG Y   +L+++     L   +++ +Q  L EF +   + Q+  
Sbjct: 107 NIVNLIDLEIVSSSPYDGLYCYQELIDY----DLAKVIHSSVQ--LSEFHIKYFLYQILC 160

Query: 144 GIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMK 203
           G+  +HS +  +IHRD+K  N+L + NG  K+CDFG   GI       +  N   Q  + 
Sbjct: 161 GLKYIHSAD--VIHRDLKPGNILCTLNGCLKICDFGLARGIHTEFFQCQTTNSAVQPHIT 218

Query: 204 NTTA--QYRCPEMLDLYRGQPINEKSDIWALGVFL 236
           N  A   YR PE+  L   QP ++  DIWA+G  L
Sbjct: 219 NYVATRWYRAPEL--LLSNQPYDKAIDIWAVGCIL 251

>KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {ON}
           weakly similar to uniprot|Q03306 YDR466W Saccharomyces
           cerevisiae YDR466W Protein kinase with similarity to
           mammalian phosphoinositide-dependent kinase 1 (PDK1) and
           yeast Pkh1p and Pkh2p, two redundant upstream activators
           of Pkc1p; identified as a multicopy suppressor of a pkh1
           pkh2 double mutant
          Length = 647

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 59/197 (29%), Positives = 93/197 (47%), Gaps = 17/197 (8%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLI 167
           +++F PGG L+  + T  Q R  E    + M Q+   +  +H     ++HRD+K EN+L+
Sbjct: 89  VLDFAPGGELLQLLQT--QGRFNEAWTKHFMCQLIDALEYIHGCK--VVHRDLKPENLLL 144

Query: 168 SSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKS 227
           SS G+  + DFG  S +      +   +FV        TA+Y  PE+L   +    N  S
Sbjct: 145 SSEGKLMITDFGVASNLAATDNLSSTSSFVG-------TAEYVSPELLLQNKS---NFCS 194

Query: 228 DIWALGVFLYKICYYTTPFENGGERAILH--ARYQYPQYPMYSSRLKNLIRMMLMEKPEQ 285
           DIWA+G  LY+    T PF    E A         Y    M S  + +L+  +L+  P+ 
Sbjct: 195 DIWAVGCMLYQFTQGTPPFRGENELAAFEKIVNLDYHWIYMVSQHITDLVSKILVLDPDS 254

Query: 286 RPNVCQVLEEVSSMQGI 302
           R  + Q+ +  +  QGI
Sbjct: 255 RYTLPQI-KNHAWFQGI 270

>Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W
           (REAL)
          Length = 1066

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 73/300 (24%), Positives = 139/300 (46%), Gaps = 37/300 (12%)

Query: 21  QVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLK 80
           +V  +K +     A +++ Q+ PP P N  ++   ++ +  E S       E    Q+L 
Sbjct: 142 EVCAVKIVNRATKAFLHKEQMLPP-PKNEQDVLERQKKLEKEISRDKRTIREASLGQVLY 200

Query: 81  GKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQ 140
             PH+    +     ++SN        L E+  GG L+D++       ++E +       
Sbjct: 201 -HPHICRLFE---MCTLSN----HFYMLFEYVSGGQLLDYIIQ--HGSIREHQARKFARG 250

Query: 141 VTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQD 200
           +   ++ +H+ N  ++HRD+KIEN++IS + E K+ DFG +S +    K    F      
Sbjct: 251 IASALMYLHANN--IVHRDLKIENIMISDSSEIKIIDFG-LSNLYDSRKQLHTF------ 301

Query: 201 IMKNTTAQYRCPEMLDL--YRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAILH-- 256
                +  +  PE+L    Y G  +    D+W+ GV L+ +     PF++    ++LH  
Sbjct: 302 ---CGSLYFAAPELLKAHPYTGPEV----DVWSFGVVLFVLVCGKVPFDDENS-SVLHEK 353

Query: 257 ---ARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQGIPCPLPNFYLQR 313
               + +YPQ+   S  + +L+  ML+  P++R  + QV+E    ++G   P P++  +R
Sbjct: 354 IKQGKVEYPQH--LSIEVISLLSKMLVVDPKRRATLKQVVEHHWMVRGFNAPPPSYLPKR 411

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 63/232 (27%), Positives = 114/232 (49%), Gaps = 35/232 (15%)

Query: 69  LRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNR 128
           +  E+  M+L+   P+V+G ++    +S       E+  ++E+  GG L D++ ++   +
Sbjct: 173 IEREIVIMKLI-SHPNVMGLLEVWENKS-------ELYLVLEYVDGGELFDYLVSK--GK 222

Query: 129 LKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISS-NGEYKVCDFGSVSGIIRP 187
           L E E ++   Q+ QG+   HS N  + HRD+K EN+L+   N   K+ DFG ++ +  P
Sbjct: 223 LSEPEAVHYFTQIIQGVSYCHSFN--ICHRDLKPENLLLDKKNKVIKIADFG-MAALELP 279

Query: 188 PKNTEEFNFVQQDIMKNTTAQYRCPEML--DLYRGQPINEKSDIWALGVFLYKICYYTTP 245
            K  E             +  Y  PE++    Y G P    SD+W+ G+ L+ +     P
Sbjct: 280 NKLLE---------TSCGSPHYASPEIVMGKPYHGGP----SDVWSCGIILFALLTGHLP 326

Query: 246 FENGGERAIL----HARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVL 293
           F +   + +L      R+Q P  P  ++  K+LI  +L+  PE+R  + ++L
Sbjct: 327 FNDDNIKKLLLKVQAGRFQLP--PYLTNDAKDLITRILVTNPEKRLTINEIL 376

>Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054W
           (REAL)
          Length = 388

 Score = 83.2 bits (204), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 63/214 (29%), Positives = 102/214 (47%), Gaps = 14/214 (6%)

Query: 24  IIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLKGKP 83
           II++L  G +  +  V+    NP   + +  +  +   E      +R E++ M   KG  
Sbjct: 40  IIQFLGKGAYGTVCSVKFKGQNPPAKIAVKKISNIFNKEILLKRAIR-ELKFMNFFKGHK 98

Query: 84  HVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQ 143
           ++V  ID     S   DG Y   +L+++     L   +++ +Q  L EF +   + Q+  
Sbjct: 99  NIVNLIDLEIVTSSPYDGLYCYQELIDY----DLAKVIHSSVQ--LSEFHIKYFLYQILC 152

Query: 144 GIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMK 203
           G+  +HS +  +IHRD+K  N+L + NG  K+CDFG   GI       +  + +Q  I  
Sbjct: 153 GLKYIHSAD--VIHRDLKPGNILCTLNGCLKICDFGLARGI--HAGFFQCHSTIQPHITN 208

Query: 204 NT-TAQYRCPEMLDLYRGQPINEKSDIWALGVFL 236
              T  YR PE+  L   QP N+  DIWA+G  L
Sbjct: 209 YVATRWYRAPEL--LLSNQPYNKSVDIWAVGCIL 240

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 80/285 (28%), Positives = 128/285 (44%), Gaps = 34/285 (11%)

Query: 27  YLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLKGKPH-- 84
           +L  GGFA+ +Q++ +         +A L   I  EK    T +  +  +Q+ K   H  
Sbjct: 87  FLGEGGFARCFQIKDDSGKIFAAKTVAKLS--IKSEK----TRKKLLSEIQIHKSMKHQN 140

Query: 85  VVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQG 144
           VV +ID         D T  V  L+E CP G L+D +  R    L E EV     Q+   
Sbjct: 141 VVQFIDC------FEDDT-NVYILLEICPNGSLMDLLKKR--KLLTEPEVRFFTTQICGA 191

Query: 145 IVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKN 204
           I  MHS    +IHRD+K+ N+    N   K+ DFG  + +     N  E  +        
Sbjct: 192 IKYMHSRR--VIHRDLKLGNIFFDRNYNLKIGDFGLAAVL----ANDRERKYTV-----C 240

Query: 205 TTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAILH----ARYQ 260
            T  Y  PE+L + +    + + DIW++GV LY +     PF++     I        + 
Sbjct: 241 GTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQSKDVNTIYERIKCCDFS 299

Query: 261 YPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQGIPCP 305
           +P+    S+  K LI+ +L   P +RP++ ++++ V   +GI  P
Sbjct: 300 FPKEKHISNEAKVLIQDLLSLDPLERPSISEIMDYV-WFRGIFPP 343

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score = 84.7 bits (208), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 79/288 (27%), Positives = 132/288 (45%), Gaps = 33/288 (11%)

Query: 27  YLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLKGKPHVV 86
           +L  GGFA+ +Q++ +         +A L   I  EK+    L +E++  + +K  P++V
Sbjct: 95  FLGEGGFARCFQMKDDKGKVFAAKTVAKLS--IKSEKTR-RKLLSEIQIHKSMK-HPNIV 150

Query: 87  GYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIV 146
            + D         D T  V  L+E CP G +++ +  R    L E EV   M Q+   I 
Sbjct: 151 QFTDC------FEDDT-NVYILLEICPNGSVMELLRQR--KHLTEPEVRFCMIQIIGAIR 201

Query: 147 AMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTT 206
            MHS    +IHRD+K+ N+        K+ DFG ++ ++   K        ++      T
Sbjct: 202 YMHSRR--VIHRDLKLGNIFFDKEYNLKIGDFG-LAAVLANDK--------ERKYTICGT 250

Query: 207 AQYRCPEML-DLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAILHAR-----YQ 260
             Y  PE+L   + G   + + DIW++GV LY + +   PF+   E   ++ R     + 
Sbjct: 251 PNYIAPEVLTGKHTGH--SYEVDIWSIGVMLYALLFGKPPFQ-AKEVETIYERIKCRDFI 307

Query: 261 YPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQGIPCPLPN 308
           +P     SS  KNLI  +L   P  RP++ ++ + V      P  LP+
Sbjct: 308 FPADKPVSSDAKNLISHLLQLNPAARPSLYEITDNVWFRNTFPSRLPS 355

>NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa]
           {ON} 
          Length = 1176

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 62/204 (30%), Positives = 97/204 (47%), Gaps = 27/204 (13%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLI 167
           L E+  GG L+D++       LKE    N   Q+   +  +H+ N  ++HRD+KIEN++I
Sbjct: 205 LFEYVSGGQLLDYIIQ--HGSLKESHARNFARQILSALKYLHANN--IVHRDLKIENIMI 260

Query: 168 SSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQP-INEK 226
           SSNG  K+ DFG +S +    K  + +           +  +  PE+L   R  P I  +
Sbjct: 261 SSNGNIKIIDFG-LSNLYDKSKKLKTY---------CGSLYFAAPELL---RANPYIGPE 307

Query: 227 SDIWALGVFLYKICYYTTPFE----NGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEK 282
            D+W+ GV LY +     PF+    N     I   R  YPQ+   S  + +L+  ML+  
Sbjct: 308 IDVWSFGVVLYVLVCGKVPFDDENSNVLHEKIKQGRVFYPQF--LSIEVISLLSTMLVVD 365

Query: 283 PEQRPNVCQVLEE---VSSMQGIP 303
           P +R  + QV++    V     IP
Sbjct: 366 PFKRATLDQVMKHHWMVKDYDSIP 389

>Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W
           (REAL)
          Length = 1065

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 75/309 (24%), Positives = 143/309 (46%), Gaps = 37/309 (11%)

Query: 21  QVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLK 80
           +V  +K +     A +++ Q+ PP P N  ++   ++ +  E S       E    Q+L 
Sbjct: 142 EVCAVKIVNRATKAFLHKEQMLPP-PKNEQDVLERQKKLEKEISRDKRTIREASLGQILY 200

Query: 81  GKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQ 140
             PH+    +     ++SN        L E+  GG L+D++       ++E +       
Sbjct: 201 -HPHICRLFE---MCTLSN----HFYMLFEYVSGGQLLDYIIQ--HGSIREHQAKKFARG 250

Query: 141 VTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQD 200
           +   ++ +H+ N  ++HRD+KIEN++IS + E K+ DFG +S +    K    F      
Sbjct: 251 IASALMYLHANN--IVHRDLKIENIMISDSSEIKIIDFG-LSNLYDSRKQLYTF------ 301

Query: 201 IMKNTTAQYRCPEMLDL--YRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAILH-- 256
                +  +  PE+L    Y G  +    D+W+ GV L+ +     PF++    ++LH  
Sbjct: 302 ---CGSLYFAAPELLKANPYTGPEV----DVWSFGVVLFVLVCGKVPFDDENS-SVLHEK 353

Query: 257 ---ARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQGIPCPLPNFYLQR 313
               + +YPQ+   S  + +L+  ML+  P++R  + QV+E    ++G   P P++  +R
Sbjct: 354 IKQGKVEYPQH--LSIEVISLLSKMLVVDPKRRATLKQVVEHHWMVRGFSGPPPSYLPKR 411

Query: 314 QQATQLMMN 322
              T  M++
Sbjct: 412 IPLTMEMLD 420

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 98/203 (48%), Gaps = 39/203 (19%)

Query: 105 VLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIEN 164
           V   +E+CPG  L +++   ++ R+   E  ++ +Q+   +   HS+    +HRD+K+EN
Sbjct: 103 VWMALEYCPGKELYEYL--LIKKRIPLDECSHLFSQIVGAVFYAHSMK--CVHRDLKLEN 158

Query: 165 VLISSNGEYKVCDFG-----SVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDL-- 217
           +L+   G+ K+ DFG     +  GI+              + +  TT  Y  PE+++   
Sbjct: 159 ILLDKKGQAKLTDFGFTRECATKGIL--------------ETVCGTTV-YMAPELIERKP 203

Query: 218 YRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAILHARYQYP-QYPMYSSRL----- 271
           Y G  I    D W+LG+ LY + +   PF+   E   +  +Y+     P Y         
Sbjct: 204 YEGYKI----DTWSLGIILYTMIHGAMPFD---EEDDIKTKYRIVNNEPFYDDNFIDANG 256

Query: 272 KNLIRMMLMEKPEQRPNVCQVLE 294
           K+LI  +L + P QRP++ QVL+
Sbjct: 257 KDLIMQLLQKDPSQRPSLTQVLQ 279

>CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} similar
           to uniprot|P13185 Saccharomyces cerevisiae YDR122w KIN1
           or uniprot|P13186 Saccharomyces cerevisiae YLR096w KIN2
          Length = 944

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 63/216 (29%), Positives = 109/216 (50%), Gaps = 33/216 (15%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVA----MHSLNPPLIHRDIKIE 163
             EF  GG L+D++       LKE    N   +V++GI++    +H+ N  ++HRD+KIE
Sbjct: 169 FFEFISGGQLLDYIIQ--HGSLKE----NHARKVSRGILSALQYLHANN--IVHRDLKIE 220

Query: 164 NVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQP- 222
           N+++S  GE K+ DFG +S +  P K+ + F           +  +  PE+L   +  P 
Sbjct: 221 NIMLSKTGEIKLIDFG-LSNMYDPRKSLQTF---------CGSLYFAAPELL---KAHPY 267

Query: 223 INEKSDIWALGVFLYKICYYTTPFENGGERA----ILHARYQYPQYPMYSSRLKNLIRMM 278
           +  + D+W+ GV LY +     PF++    A    I   +  YPQ+   S  + +L+  +
Sbjct: 268 LGPEVDVWSFGVVLYVLVCGKVPFDDENSSALHEKIKKGKVTYPQF--LSIDVISLLSKI 325

Query: 279 LMEKPEQRPNVCQVLEEVSSMQGIPCPLPNFYLQRQ 314
           L+  P++R  + QV+     ++G   P P  YL R+
Sbjct: 326 LVVDPQKRATLQQVVNHQWMLKGYDFP-PQSYLPRR 360

>Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {ON}
           similar to Ashbya gossypii AFR335C
          Length = 1077

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 96/190 (50%), Gaps = 16/190 (8%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLI 167
           L+E+ P G  +  M  +    L E        Q+  GI  +H     +IHRDIK EN+L+
Sbjct: 281 LLEYAPNGDFLSIM--KKYGSLNEECARYYGAQILNGIYFLHRHG--IIHRDIKPENILL 336

Query: 168 SSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKS 227
             + + K+ DFG+   + R    TEE++   +      TA+Y  PE+L+      ++ K 
Sbjct: 337 DKSMKVKLTDFGTAKLLNR-KDGTEEYDLTTRSKSFVGTAEYVSPELLN---DSWVDHKC 392

Query: 228 DIWALGVFLYKICYYTTPFENGGE----RAILHARYQYPQ-YPMYSSRLKNLIRMMLMEK 282
           DIWA G  L+++     PF+   E    + ++  +Y +   +PM    +++L++ +L++K
Sbjct: 393 DIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPMV---VRDLVKQILVKK 449

Query: 283 PEQRPNVCQV 292
           PE R  + Q+
Sbjct: 450 PEHRLTIPQI 459

>Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W
           (REAL)
          Length = 1089

 Score = 84.7 bits (208), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 73/300 (24%), Positives = 139/300 (46%), Gaps = 37/300 (12%)

Query: 21  QVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLK 80
           +V  +K +     A +++ Q+ PP P N  ++   ++ +  E S       E    Q+L 
Sbjct: 155 EVCAVKIVNRATKAFLHKEQMLPP-PKNEQDVLERQKKLEKEISRDKRTIREASLGQILY 213

Query: 81  GKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQ 140
             PH+    +     ++SN        L E+  GG L+D++       ++E +       
Sbjct: 214 -HPHICRLFEMC---TLSN----HFYMLFEYVSGGQLLDYIIQ--HGSIREHQARKFARG 263

Query: 141 VTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQD 200
           +   ++ +H+ N  ++HRD+KIEN++IS + E K+ DFG +S +    K    F      
Sbjct: 264 IASALMYLHANN--IVHRDLKIENIMISDSSEIKIIDFG-LSNLYDSRKQLHTF------ 314

Query: 201 IMKNTTAQYRCPEMLDL--YRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAILH-- 256
                +  +  PE+L    Y G  +    D+W+ GV L+ +     PF++    ++LH  
Sbjct: 315 ---CGSLYFAAPELLKANPYTGPEV----DVWSFGVVLFVLVCGKVPFDDENS-SVLHEK 366

Query: 257 ---ARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQGIPCPLPNFYLQR 313
               + +YPQ+   S  + +L+  ML+  P++R  + QV+E    ++G   P P++  +R
Sbjct: 367 IKQGKVEYPQH--LSIEVISLLSKMLVVDPKRRATLKQVVEHHWMVRGFDGPPPSYLPKR 424

>Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} similar
           to Ashbya gossypii ACL104C
          Length = 1003

 Score = 84.3 bits (207), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 74/267 (27%), Positives = 122/267 (45%), Gaps = 34/267 (12%)

Query: 31  GGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLKGKPHVVGYID 90
           G   + Y V+      I  +NL C      PE   +  ++ EV+ +  LK  P++  Y  
Sbjct: 35  GVVYKAYHVKTKQVYAIKVLNLDC------PEDE-VEDVQKEVQFLSSLKQVPNITQYYG 87

Query: 91  SNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHS 150
           S    +       ++  +ME+C GG L   +      ++ E  +  I+  +   ++ +H 
Sbjct: 88  SFLYET-------KLWVIMEYCAGGSLRTLLR---PGKIDEKYLGVIVRNLLVALLYIHK 137

Query: 151 LNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYR 210
            N  +IHRDIK  NVLI++ G  K+CDFG  + +          N  +Q +    T  + 
Sbjct: 138 DN--VIHRDIKAANVLITNGGHVKLCDFGVAAQLTTA-------NHKRQTMAG--TPYWM 186

Query: 211 CPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPF-ENGGERAI-LHARYQYPQYPM-- 266
            PE+  +  G   N K+DIW+LG+  Y+I     P+ +    RA+ L  + + P+     
Sbjct: 187 APEV--IMEGVYYNTKADIWSLGITTYEIATGNPPYCDVEALRAMQLITKSKPPRLEGRN 244

Query: 267 YSSRLKNLIRMMLMEKPEQRPNVCQVL 293
           YS  LK  I + L E PE RP   ++L
Sbjct: 245 YSPLLKEFIALCLDEDPEARPTAEELL 271

>KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 878

 Score = 84.3 bits (207), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 79/301 (26%), Positives = 134/301 (44%), Gaps = 57/301 (18%)

Query: 14  KLNVGIHQVSI------IKYLTSGGFAQIYQ---VQVNPPNPINGMNLACLKRVIVPEKS 64
           K N G+ + S+       + +  G F  +Y+   ++ N    I  +NL      +     
Sbjct: 5   KTNAGVPKSSVSTLFKRTEVIGRGKFGIVYKGYYIKTNRVCAIKVLNLDSADDEV----- 59

Query: 65  GLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTY----EVLQLMEFCPGGGLIDF 120
               ++ EV+ +  LK  P++  Y            G+Y    E+  +ME+C GG L   
Sbjct: 60  --EDVQKEVQFLSSLKQVPNITHYY-----------GSYLNNTELWVIMEYCAGGSLRTL 106

Query: 121 MNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGS 180
           +      ++ E  +  IM ++   I  MH     +IHRDIK  NVLI+++G  K+CDFG 
Sbjct: 107 LR---PGKIGEQYIGVIMRELL--IALMHIHKDGVIHRDIKAANVLITNDGHIKLCDFGV 161

Query: 181 VSGIIRPPKNTEEFNFVQQDIMKNTTAQ---YRCPEMLDLYRGQPINEKSDIWALGVFLY 237
            +               Q  I + T A    +  PE+  +  G   + K DIW+LG+  Y
Sbjct: 162 AA------------QLSQTKIRRQTMAGTPYWMAPEV--IMEGVYYDTKVDIWSLGITAY 207

Query: 238 KICYYTTPF-ENGGERAI-LHARYQYPQYP--MYSSRLKNLIRMMLMEKPEQRPNVCQVL 293
           +I     P+ +    RA+ L  + + P+     +SS LK  I + L E P++RP+  ++L
Sbjct: 208 EIATGNPPYCDVEALRAMQLITKSKPPRLEGRQHSSALKEFIALCLDEDPKERPSAEELL 267

Query: 294 E 294
           +
Sbjct: 268 K 268

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score = 84.0 bits (206), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 80/299 (26%), Positives = 134/299 (44%), Gaps = 38/299 (12%)

Query: 27  YLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLKGKPH-- 84
           +L  GGFA+ +Q++ +         +A L   I  EK    T +  +  +Q+ K   H  
Sbjct: 106 FLGEGGFARCFQIKDDSGKIFAAKTVAKLS--IKTEK----TRKKLLSEIQIHKSMRHAN 159

Query: 85  VVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQG 144
           +V +ID     +        V  L+E CP G L++ +  R    L E EV     Q+  G
Sbjct: 160 IVQFIDCFEDET-------NVYILLEICPNGSLMELLKKR--KTLTEPEVRFFTTQICGG 210

Query: 145 IVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKN 204
           I  MHS    +IHRD+K+ N+    N   K+ DFG  + +          N  ++     
Sbjct: 211 IKYMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFGLAAVLA---------NDRERKYTVC 259

Query: 205 TTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPFE----NGGERAILHARYQ 260
            T  Y  PE+L + +    + + DIW++GV +Y +     PF+    N     I    + 
Sbjct: 260 GTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQAKDVNTIYERIKCCDFV 318

Query: 261 YPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQGIPCPLPNFYLQRQQATQL 319
           +P+    SS  + L++ +L   P +RP++ +VL+ V   +GI  P    Y+Q    T++
Sbjct: 319 FPKEKYISSEARILVQDLLSLDPLERPSIMEVLDYV-WFRGIFPP----YIQSDVMTEV 372

>NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON} 
          Length = 1210

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 60/223 (26%), Positives = 107/223 (47%), Gaps = 28/223 (12%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLI 167
           L E+  GG L+D++       L+E         +   +  +H+ N  ++HRD+KIEN++I
Sbjct: 264 LFEYVSGGQLLDYIIQ--HGSLREHHARKFARGIASALEYIHANN--IVHRDLKIENIMI 319

Query: 168 SSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDL--YRGQPINE 225
           S++GE K+ DFG +S +    K    F           +  +  PE+L    Y G  +  
Sbjct: 320 STSGEIKIIDFG-LSNVFDRKKQLHTF---------CGSLYFAAPELLKAHPYTGPEV-- 367

Query: 226 KSDIWALGVFLYKICYYTTPFENGGERAILH-----ARYQYPQYPMYSSRLKNLIRMMLM 280
             D+W+ GV LY +     PF++    ++LH      +  YP +   S  + +L+  ML+
Sbjct: 368 --DVWSFGVVLYVLVCGKVPFDDENS-SVLHEKIKQGKVDYPNH--LSIEVISLLSKMLV 422

Query: 281 EKPEQRPNVCQVLEEVSSMQGIPCPLPNFYLQRQQATQLMMNN 323
             P +R ++ QV+E     +G   P P++  +R   T  +++N
Sbjct: 423 VDPLRRASLKQVVEHPWMTRGYDYPPPSYVPRRIPMTPEIIDN 465

>KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa]
           {ON} 
          Length = 1009

 Score = 84.0 bits (206), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 60/202 (29%), Positives = 100/202 (49%), Gaps = 35/202 (17%)

Query: 104 EVLQLMEFCPGGGLIDFMNTRLQ-NRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKI 162
           +V   +E+CPG  L D +   LQ  R+   E + + +Q+   +   HSLN   +HRD+K+
Sbjct: 111 KVWMALEYCPGRELYDHV---LQMKRIPAEECIQLFSQIVGAVYYAHSLN--CVHRDLKL 165

Query: 163 ENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDL--YRG 220
           EN+L+  +G  K+ DFG            E    V  + +  TT  Y  PE+ +   Y G
Sbjct: 166 ENILLDKDGNAKLTDFGFTR---------ECMEKVNLETICGTTV-YMAPELTERKPYDG 215

Query: 221 QPINEKSDIWALGVFLYKICYYTTPFENGGERAILHARYQYP---QYPMYSSRL-----K 272
             I    DIW+LGV LY +   + PF+   E     A+ ++    + P Y+S+      +
Sbjct: 216 FKI----DIWSLGVILYTMLSGSMPFDEDDE-----AKTKWKIINEEPEYNSKFMTAEGE 266

Query: 273 NLIRMMLMEKPEQRPNVCQVLE 294
           +L+R +L +    RP+V ++L+
Sbjct: 267 DLVRKLLQKDSNLRPSVREILQ 288

>TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {ON}
           Anc_1.24 YDR523C
          Length = 482

 Score = 82.8 bits (203), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 69/267 (25%), Positives = 125/267 (46%), Gaps = 28/267 (10%)

Query: 31  GGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLKGKPHVVGYID 90
           G F  +Y+      + +  + +  L+         +  L  E+  +  LK  P +  YI 
Sbjct: 24  GNFGDVYKAIDKNESKVVAIKIVNLENT----DEDIELLTQEIFFLSELKS-PFITNYI- 77

Query: 91  SNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHS 150
                +++ D T  ++  ME+C GG   D +       + E +V  I+    +G+  +H 
Sbjct: 78  ----TTLTEDVTMWIV--MEYCGGGSCADLIKMVYSKGIPESKVSYILRDTVKGLKYLH- 130

Query: 151 LNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYR 210
            +   IHRDIK  N+L++  G+ K+ DFG VSG IR     +   FV        T  + 
Sbjct: 131 -DQKKIHRDIKAANILLTDCGKVKLGDFG-VSGQIRA--TMKRGTFVG-------TPYWM 179

Query: 211 CPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGE-RAILHARYQYP--QYPMY 267
            PE+++  + +  NEK+DIW+LG+  Y++     P       + +L+   + P   +  Y
Sbjct: 180 APEVIN-KQCKGYNEKADIWSLGITAYELLKGVPPLSKYDPFKVMLNIPKRKPPKLHGQY 238

Query: 268 SSRLKNLIRMMLMEKPEQRPNVCQVLE 294
           S + K  + + L++ P+QRP++  +LE
Sbjct: 239 SEKAKYFVSLCLIKDPKQRPSIEALLE 265

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score = 83.6 bits (205), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 75/276 (27%), Positives = 129/276 (46%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLKGKPHVV 86
           +L  GGFA+ +Q++ +         +A   ++ +  +     L +E++  + +K  P++V
Sbjct: 82  FLGEGGFARCFQMKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMK-HPNIV 137

Query: 87  GYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIV 146
            +ID         D T  V  L+E CP G L+D +  R    L E EV     Q+   I 
Sbjct: 138 QFIDC------FEDDT-NVYILLEICPNGSLMDLLKKR--KVLTEPEVRYFTTQIVGAIK 188

Query: 147 AMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTT 206
            MH  N  +IHRD+K+ N+   SN   K+ DFG  + +     N  E  +         T
Sbjct: 189 YMH--NRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVL----ANDRERKYTV-----CGT 237

Query: 207 AQYRCPEML-DLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAILHAR-----YQ 260
             Y  PE+L   + G   + + DIW++GV +Y +     PF+   E  I++ R     Y 
Sbjct: 238 PNYIAPEVLAGKHSGH--SYEVDIWSIGVMIYALLIGKPPFQ-AKEVNIIYERIKSGDYI 294

Query: 261 YPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEV 296
           +P+    S  +  LI+ +L   P +RP++ ++++ V
Sbjct: 295 FPREKPTSKEVMVLIQDILSIDPIERPSLDEIMDYV 330

>AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR096W (KIN2) and
           YDR122W (KIN1)
          Length = 1071

 Score = 84.0 bits (206), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 100/209 (47%), Gaps = 28/209 (13%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLI 167
           L E+  GG L+D++       L+E         +   +  +H  N  ++HRD+KIEN++I
Sbjct: 158 LFEYVSGGQLLDYIIQ--HGSLRERHARKFARGIASALQYLHLNN--IVHRDLKIENIMI 213

Query: 168 SSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDL--YRGQPINE 225
           SS+GE ++ DFG +S +  P K    F           +  +  PE+L    Y G  +  
Sbjct: 214 SSSGEIRIIDFG-LSNMYDPKKQLHTF---------CGSLYFAAPELLKAHPYTGPEV-- 261

Query: 226 KSDIWALGVFLYKICYYTTPFENGGERAILH-----ARYQYPQYPMYSSRLKNLIRMMLM 280
             DIW+ GV LY +     PF++    ++LH      + +YPQ+   S  + +L+  ML+
Sbjct: 262 --DIWSFGVVLYVLVCGKVPFDDENA-SVLHEKIKQGKVEYPQH--LSIDVISLLSKMLV 316

Query: 281 EKPEQRPNVCQVLEEVSSMQGIPCPLPNF 309
             P +R  + QV+      +G   P P++
Sbjct: 317 VDPYKRATLKQVVHHQWMQKGYDFPPPSY 345

>NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {ON}
           Anc_8.668
          Length = 883

 Score = 83.6 bits (205), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 64/237 (27%), Positives = 108/237 (45%), Gaps = 42/237 (17%)

Query: 104 EVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIE 163
           +V    E+CPG  L D +   LQ R+     + +  Q+   +   HSLN   +HRD+K+E
Sbjct: 103 KVWMAQEYCPGKDLYDHV-LSLQ-RVPSSACIELFTQIVGAVYYAHSLN--CVHRDLKLE 158

Query: 164 NVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNT------TAQYRCPEML-- 215
           N+L+  NG  K+ DFG                F ++ + K +      T  Y  PE++  
Sbjct: 159 NILLDKNGNAKLTDFG----------------FTRECMTKTSLETICGTTVYMAPELIKR 202

Query: 216 DLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGE-RAILHARYQYPQY--PMYSSRLK 272
           + Y G  I    DIW+LGV LY +   + PF+   E +       + P +   + S   K
Sbjct: 203 ESYDGFKI----DIWSLGVILYTMLNGSMPFDEDDETKTEWKIMNEMPVFNDTILSEDAK 258

Query: 273 NLIRMMLMEKPEQRPNVCQVLEEVSSMQGIPCPLPNFYLQRQQATQLMMNNTNGSIY 329
           +L+  +L + P +RP++ ++L         P   P   L  ++  +L+    NG+I+
Sbjct: 259 DLLIKLLSKDPNERPSMQEILHH-------PFLQPYGSLLLEKTDRLLRKQRNGTIH 308

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score = 83.6 bits (205), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 79/297 (26%), Positives = 134/297 (45%), Gaps = 41/297 (13%)

Query: 27  YLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLKGKPHV- 85
           +L  GGFA+ +Q++ +         +A  K  I  EK    T +  +  +Q+ K   HV 
Sbjct: 100 FLGEGGFARCFQIRDDSGKIFAAKTVA--KISIKSEK----TRKKLLSEIQIHKSMKHVN 153

Query: 86  -VGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQG 144
            V +ID         D T  V  L+E CP G L+D +  R    L E EV     Q+   
Sbjct: 154 IVQFIDC------FEDDT-NVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGA 204

Query: 145 IVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKN 204
           I  MHS    +IHRD+K+ N+        K+ DFG  + +          N  ++     
Sbjct: 205 IKYMHSRK--VIHRDLKLGNIFFDRKYNLKIGDFGLAATLA---------NDRERKYTVC 253

Query: 205 TTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAI---LHAR-YQ 260
            T  Y  PE+L + +    + + DIW++GV +Y +     PF++     I   +  R + 
Sbjct: 254 GTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALIIGRPPFQSKDVNTIYERIKCRDFS 312

Query: 261 YPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEV--------SSMQGIPCPLPNF 309
           +P+  + SS  K LI+ +L   P +RP+V ++++ +        S+ + +   +PN+
Sbjct: 313 FPKDKLISSEAKILIQDILSLDPLERPSVNEIMDYIWFRGCFPPSTKESVMVEVPNY 369

>NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa] {ON}
            Anc_7.86
          Length = 1317

 Score = 84.0 bits (206), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 65/228 (28%), Positives = 101/228 (44%), Gaps = 29/228 (12%)

Query: 66   LNTLRAEVEAMQLLKGKPH--VVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNT 123
            L T+ +E++ M  L   PH  ++  +D         D  Y  +++      G +  +   
Sbjct: 1104 LGTIPSEIQIMATLNKTPHENILSILD------FFEDDNYYYVEMPTHGETGTIDLYDLI 1157

Query: 124  RLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSG 183
              +  + E E   +  QV   I  MH  +  ++HRDIK EN+++ S G  K+ D+GS + 
Sbjct: 1158 EFKKNMTELECKLMFKQVVSAIKCMH--DQGIVHRDIKDENIIVDSKGCIKLIDYGSAAY 1215

Query: 184  IIRPPKNTEEFNFVQQDIMKNTTAQYRCPEML--DLYRGQPINEKSDIWALGVFLYKICY 241
                P +     FV        T  Y  PE+L  +LY G+P     DIWALG+ LY I +
Sbjct: 1216 TKSGPFDV----FV-------GTIDYAAPEVLSGNLYDGKP----QDIWALGILLYTIVF 1260

Query: 242  YTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNV 289
               PF N  E  I+     + +     S+   LI+ ML     QRP +
Sbjct: 1261 KENPFYNIDE--IVDGELTFNESMSIDSKCIILIKKMLNRVVGQRPTI 1306

>Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR096W
           (REAL)
          Length = 1162

 Score = 84.0 bits (206), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 62/221 (28%), Positives = 106/221 (47%), Gaps = 26/221 (11%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLI 167
           L E+  GG L+D++       LKE         +   +  +HS N  ++HRD+KIEN++I
Sbjct: 209 LFEYVSGGQLLDYIIQ--HGSLKEHHARKFARGIASALQYLHSNN--IVHRDLKIENIMI 264

Query: 168 SSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQP-INEK 226
           SS+GE K+ DFG +S I         F++ +Q      +  +  PE+L   + QP    +
Sbjct: 265 SSSGEIKIIDFG-LSNI---------FDYRKQLHTFCGSLYFAAPELL---KAQPYTGPE 311

Query: 227 SDIWALGVFLYKICYYTTPFENGGERAILH-----ARYQYPQYPMYSSRLKNLIRMMLME 281
            DIW+ G+ LY +     PF++    +ILH      +  YP +   S    +L+  M++ 
Sbjct: 312 VDIWSFGIVLYVLVCGKVPFDDENS-SILHEKIKKGKVDYPSH--LSIEAISLLTKMIVV 368

Query: 282 KPEQRPNVCQVLEEVSSMQGIPCPLPNFYLQRQQATQLMMN 322
            P +R  +  V++     +G     P++ L R   T  M++
Sbjct: 369 DPLRRATLKTVVDHPWMNRGYDFKAPSYILNRVPLTPEMID 409

>Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {ON}
           YHR102W (KIC1) - PAK/Ste20 kinase family [contig 128]
           FULL
          Length = 865

 Score = 83.6 bits (205), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 67/233 (28%), Positives = 112/233 (48%), Gaps = 33/233 (14%)

Query: 69  LRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNR 128
           ++ E++ +  LK  P++  Y  S       ND    V+  ME+C GG L   +      +
Sbjct: 62  VQKEIQFLSSLKQVPNITHYYGSYL-----NDTKLWVI--MEYCAGGSLRTLLR---PGK 111

Query: 129 LKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPP 188
           + E  +  IM ++   ++ +H     +IHRDIK  NVLI+++G  K+CDFG  +      
Sbjct: 112 IGEQYIGVIMRELLTALMHIHKDG--VIHRDIKAANVLITNDGHIKLCDFGVAA------ 163

Query: 189 KNTEEFNFVQQDIMKNTTAQ---YRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTP 245
                    Q  I + T A    +  PE+  +  G   + K DIW+LG+  Y+I     P
Sbjct: 164 ------QLSQTKIRRQTMAGTPYWMAPEV--IMEGVYYDTKVDIWSLGITAYEIATGNPP 215

Query: 246 F-ENGGERAI-LHARYQYPQYP--MYSSRLKNLIRMMLMEKPEQRPNVCQVLE 294
           + E    RA+ L  + + P+     +SS LK +I + L E P++RP+   +L+
Sbjct: 216 YCEVEALRAMQLITKSKPPRLEGRQHSSALKEIIALCLDEDPKERPSAEDLLK 268

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score = 83.6 bits (205), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 73/286 (25%), Positives = 125/286 (43%), Gaps = 62/286 (21%)

Query: 24  IIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLKGKP 83
           I+K +  G F ++Y     P +        CLK     +K+  N +R      Q     P
Sbjct: 43  ILKQIGEGSFGKVYLALHRPTH-----RKVCLK---TSDKNDPNIVREVFYHRQF--DFP 92

Query: 84  HVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQ 143
           ++    +     S       +V   +E+CPG  L D  +     R+   E   +  Q++ 
Sbjct: 93  YITKLYEVIVTES-------KVWMALEYCPGKELYD--HLLSLRRISLLECGELFAQISG 143

Query: 144 GIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMK 203
            +   HS++   +HRD+K+EN+L+  NG  K+ DFG                F ++ + K
Sbjct: 144 AVYYAHSMH--CVHRDLKLENILLDKNGNAKLTDFG----------------FTRECMTK 185

Query: 204 NT------TAQYRCPEMLD--LYRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAIL 255
            T      T  Y  PE+++   Y G  I    DIW+LGV LY +     PF++  E    
Sbjct: 186 TTLETVCGTTVYMAPELIERRTYDGFKI----DIWSLGVILYTLITGYLPFDDDDE---- 237

Query: 256 HARYQYP---QYPMYSSRL-----KNLIRMMLMEKPEQRPNVCQVL 293
            A+ ++    + P Y +++     ++LI  +L + P +RP++ QVL
Sbjct: 238 -AKTKWKIVNEEPKYDAKVIPDDARDLISRLLAKNPGERPSLSQVL 282

>Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {ON}
           YDR490C (PKH1) - Ser/Thr protein kinase [contig 184]
           FULL
          Length = 984

 Score = 83.6 bits (205), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 104/197 (52%), Gaps = 30/197 (15%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLN------IMNQVTQGIVAMHSLNPPLIHRDIK 161
           L+E+ P G   DF++      +K+F  L+         Q+   I  +H  +  ++HRDIK
Sbjct: 235 LLEYAPNG---DFLSV-----IKKFGSLSQECAVYYSAQILDAIDYLH--HKGIVHRDIK 284

Query: 162 IENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEML-DLYRG 220
            EN+L+  + + K+ DFG+   I+   + T+ FN +++      TA+Y  PE+L D Y  
Sbjct: 285 PENILLDKDMKVKLTDFGTAR-ILEKDETTQTFNLLERSKSFVGTAEYVSPELLNDNY-- 341

Query: 221 QPINEKSDIWALGVFLYKICYYTTPFENGGE----RAILHARYQYPQ-YPMYSSRLKNLI 275
             ++ K DIWA G  L+++     PF+   E    + ++  +Y +   +P+    +++LI
Sbjct: 342 --VDYKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLV---IRDLI 396

Query: 276 RMMLMEKPEQRPNVCQV 292
           + +L++ PEQR +  Q+
Sbjct: 397 KKILVKSPEQRLDASQI 413

>TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1315

 Score = 83.6 bits (205), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 60/222 (27%), Positives = 106/222 (47%), Gaps = 28/222 (12%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLI 167
           L E+  GG L+D++       L+E         +   +  +HS N  ++HRD+KIEN++I
Sbjct: 285 LFEYVSGGQLLDYIIQ--HGSLREHHARKFARGIASALQYLHSNN--IVHRDLKIENIMI 340

Query: 168 SSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDL--YRGQPINE 225
           S++GE K+ DFG +S +    +    F           +  +  PE+L    Y G  +  
Sbjct: 341 STSGEIKIIDFG-LSNLYDTTRQLHTF---------CGSLYFAAPELLKAHPYTGPEV-- 388

Query: 226 KSDIWALGVFLYKICYYTTPFENGGERAILH-----ARYQYPQYPMYSSRLKNLIRMMLM 280
             D+W+ GV LY +     PF++    ++LH      +  YPQ+   S  + +L+  ML+
Sbjct: 389 --DVWSFGVVLYVLVCGKVPFDDENS-SVLHEKIKQGKVDYPQH--LSIEVISLLSKMLV 443

Query: 281 EKPEQRPNVCQVLEEVSSMQGIPCPLPNFYLQRQQATQLMMN 322
             P++R  + QV+E    ++G   P  ++   R   T  M++
Sbjct: 444 VDPKKRATLRQVVEHHWMVRGYDNPSSSYLPNRIPLTPQMLD 485

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score = 83.6 bits (205), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 75/284 (26%), Positives = 124/284 (43%), Gaps = 58/284 (20%)

Query: 24  IIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLKGKP 83
           I+K +  G F ++Y     P +        CLK     +K+  N +R      Q     P
Sbjct: 43  ILKQIGEGSFGKVYLALHRPTH-----RKVCLK---TSDKNDPNIVREVFYHRQF--DFP 92

Query: 84  HVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQ 143
           ++    +     S       +V   +E+CPG  L D  +     RL   E   +  Q++ 
Sbjct: 93  YITKLYEVIVTES-------KVWMALEYCPGKELYD--HLLSLRRLSLLECGELFAQISG 143

Query: 144 GIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMK 203
            +   HS++   +HRD+K+EN+L+  NG  K+ DFG                F ++ + K
Sbjct: 144 AVYYAHSMH--CVHRDLKLENILLDRNGNAKLTDFG----------------FTRECMTK 185

Query: 204 NT------TAQYRCPEMLD--LYRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAIL 255
            T      T  Y  PE+++   Y G  I    DIW+LGV LY +     PF++  E   +
Sbjct: 186 TTLETVCGTTVYMAPELIERKTYDGFKI----DIWSLGVILYTLITGYLPFDDDDE---V 238

Query: 256 HARYQYP-QYPMYSSRL-----KNLIRMMLMEKPEQRPNVCQVL 293
             +++   + P Y S+      K+LI  +L + P +RP++ QVL
Sbjct: 239 KTKWKIVNEEPKYDSKFIPDDAKDLISRLLAKNPGERPSLPQVL 282

>TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.92
           YDR490C
          Length = 819

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 57/193 (29%), Positives = 96/193 (49%), Gaps = 21/193 (10%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLI 167
           ++E+ P G L+  +  R    L      +   Q+   I A+HS+   +IHRDIK ENVL+
Sbjct: 222 VLEYAPHGDLLALL--RRHGSLSRAVTCHYAAQLLSAIGALHSVG--VIHRDIKPENVLL 277

Query: 168 SSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKN--TTAQYRCPEMLDLYRGQPINE 225
            S+   K+ DFG+ + + +   N E+   V + +  +   TA+Y  PE+L        + 
Sbjct: 278 DSHYRAKLTDFGTAALLPQTHSNLEQ---VSRHVTTSFVGTAEYVPPELLAAGHA---DG 331

Query: 226 KSDIWALGVFLYKICYYTTPFENGGE----RAILHARYQYPQYPMYSSRLKNLIRMMLME 281
             D+WA    ++++     PF+   E    + ++  RY YP  P + S LK+L+R +L  
Sbjct: 332 TCDLWAWACVVFQLIAGRPPFQARNEFLTFQNVMAVRYTYP--PGFPSDLKDLLRRVLRH 389

Query: 282 KPEQR---PNVCQ 291
           +P QR   P + Q
Sbjct: 390 EPRQRLLQPQITQ 402

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 71/276 (25%), Positives = 127/276 (46%), Gaps = 33/276 (11%)

Query: 27  YLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLKGKPHVV 86
           +L  GGFA+ +Q++ +         +A   ++ +  +     L +E++  + ++  P++V
Sbjct: 78  FLGEGGFARCFQMKDDSGKIFAAKTVA---KISIKSEKTRKKLLSEIQIHKSMR-HPNIV 133

Query: 87  GYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIV 146
            + D         D T  V  L+E CP G L+D +  R Q  L E EV     Q+   I 
Sbjct: 134 QFTDC------FEDDT-NVYILLEICPNGSLMDLLKQRKQ--LTEPEVRFFTTQIVGAIK 184

Query: 147 AMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTT 206
            MHS    +IHRD+K+ N+    +   K+ DFG  + +          N  ++      T
Sbjct: 185 YMHSRR--IIHRDLKLGNIFFDKHFNLKIGDFGLAAVLA---------NDRERKYTICGT 233

Query: 207 AQYRCPEML-DLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAILHAR-----YQ 260
             Y  PE+L   + G     + D+W++GV +Y +     PF+   E   ++ R     + 
Sbjct: 234 PNYIAPEVLTGKHTGHSF--EVDVWSIGVMIYALLIGKPPFQ-AKEVNTIYERIKVCDFN 290

Query: 261 YPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEV 296
           +P+    SS  K LI+ +L   P +RP++ +++E V
Sbjct: 291 FPRDKPISSEAKVLIKDILSLDPLERPSLTEIMEYV 326

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score = 82.8 bits (203), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 76/277 (27%), Positives = 124/277 (44%), Gaps = 33/277 (11%)

Query: 26  KYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLKGKPH- 84
           ++L  GGFA+ +Q++ +         +A  K  I  EK    T +  +  +Q+ K   H 
Sbjct: 85  QFLGEGGFARCFQIKDDSGKIFAAKTVA--KISIKSEK----TRKKLLSEIQIHKSMSHT 138

Query: 85  -VVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQ 143
            +V +ID         +    V  L+E CP G L++ +  R    + E EV   M Q+  
Sbjct: 139 NIVQFIDCF-------EDNVNVYILLEICPNGSLMELIKKR--KTITEPEVRFFMTQICG 189

Query: 144 GIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMK 203
           GI  MHS    +IHRD+K+ N+    +   K+ DFG  + +     N  E  F       
Sbjct: 190 GIQYMHS--NRVIHRDLKLGNIFFDEHYNLKIGDFGLAAVL----ANDRERKFTI----- 238

Query: 204 NTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPFE----NGGERAILHARY 259
             T  Y  PE+L + +    + + DIW++GV LY +     PF+    N     I    +
Sbjct: 239 CGTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMLYALLIGKPPFQAKDVNTIYERIKQRNF 297

Query: 260 QYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEV 296
            YP+    S   K LI  +L   P +RP++ ++++ V
Sbjct: 298 AYPKDKKISQDAKYLIDDILSLNPMERPSIQEIMDYV 334

>TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2.479
           YKL101W
          Length = 1534

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 95/200 (47%), Gaps = 31/200 (15%)

Query: 104 EVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIE 163
           E+  ++E+  GG L D++ ++   +L E E +    Q+ +G+   HS N  + HRD+K E
Sbjct: 234 ELYLVLEYVDGGELFDYLVSK--GKLTELEAVRYFKQIIRGVQYCHSFN--ICHRDLKPE 289

Query: 164 NVLISSNGEY-KVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTA--QYRCPEML--DLY 218
           N+L+    +  K+ DFG  +              V   ++K +     Y  PE++    Y
Sbjct: 290 NLLLDKKRKLIKIADFGMAALQ------------VSNTLLKTSCGSPHYASPEIVMGKTY 337

Query: 219 RGQPINEKSDIWALGVFLYKICYYTTPFENGGERAIL----HARYQYPQYPMYSSRLKNL 274
            G P    SD+W+ G+ L+ +     PF +   + +L    + RYQ P Y   S   K+L
Sbjct: 338 NGGP----SDVWSCGIILFALLTGHLPFNDDSIKKLLIKVQNGRYQMPNY--LSKDAKDL 391

Query: 275 IRMMLMEKPEQRPNVCQVLE 294
           I  +L+  P+ R    Q+LE
Sbjct: 392 ISRILLVNPKARLTTEQILE 411

>Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to
           Ashbya gossypii AFR724C
          Length = 440

 Score = 81.3 bits (199), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 69/277 (24%), Positives = 130/277 (46%), Gaps = 28/277 (10%)

Query: 21  QVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLK 80
           Q  I++ +  G F  +Y+ +    N I  + +  L+    P    ++ L  E+  +  L+
Sbjct: 19  QYEILQCIGRGNFGDVYKARYLATNEIVAIKVVNLEDTDEP----IDLLAQEIFFLSELR 74

Query: 81  GKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQ 140
             P++  Y       +   D +  ++  ME+C GG   + +    +++L E +   I+++
Sbjct: 75  S-PYITNY-----KTAFLVDVSMWIV--MEYCGGGSCAELLKYTPEHKLTEDQCAFIVSE 126

Query: 141 VTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQD 200
           V  G+  +HS     IHRDIK  N+L++ NG  K+ DFG VSG +   +  + F      
Sbjct: 127 VLVGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFG-VSGQMMVTRKRDTF------ 177

Query: 201 IMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAILHA--R 258
                T  +  PE++D  + +  NE +DIW+LG+ + ++     P +       L A  +
Sbjct: 178 ---VGTPFWMAPEVIDRNK-KGYNEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIPK 233

Query: 259 YQYPQY-PMYSSRLKNLIRMMLMEKPEQRPNVCQVLE 294
              P+    +SS  K+ +   L++ P QRP   ++L+
Sbjct: 234 RDPPKLDKRFSSHAKDFVAQCLIKDPSQRPTASELLK 270

>Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL045W
            (REAL)
          Length = 1106

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 71/280 (25%), Positives = 122/280 (43%), Gaps = 32/280 (11%)

Query: 23   SIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVP---EKSGLNTLRAEVEAMQLL 79
            +I++ +  G + ++     N  + I  + +   +R++V        L T+ +E++ M  L
Sbjct: 847  TILQAMGEGAYGKVNLCIHNKEHYIVVIKMIFKERILVDTWVRDRKLGTIPSEIQIMATL 906

Query: 80   KGKPHVVGYIDSNAARSIS--NDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNI 137
               P        N  R +    D  Y  ++       G +  F     +  + E E   +
Sbjct: 907  NKNPQ------ENILRLLDFFEDDDYYYIETPVHGETGSIDLFDVIEFKKDMVEHEAKLV 960

Query: 138  MNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFV 197
              QV   I  +H  +  ++HRDIK EN+++ S+G  K+ DFGS +     P +     FV
Sbjct: 961  FKQVVSSIKHLH--DQGIVHRDIKDENIIVDSHGFVKLIDFGSAAYTKSGPFDV----FV 1014

Query: 198  QQDIMKNTTAQYRCPEML--DLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAIL 255
                    T  Y  PE+L    Y+G+P     DIWALGV LY I Y   P+ N  E  IL
Sbjct: 1015 G-------TMDYAAPEVLGGSSYKGKP----QDIWALGVLLYTIIYKENPYYNIDE--IL 1061

Query: 256  HARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEE 295
                ++      S    +LI+ +L  + ++RP +  + ++
Sbjct: 1062 EGELRFDNAENVSDECISLIKGILTREVDKRPTIDDIYQD 1101

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 95/195 (48%), Gaps = 23/195 (11%)

Query: 105 VLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIEN 164
           V   +E+CPG  L D++   L+ R+   E   +  Q+   +   HSL    +HRD+K+EN
Sbjct: 103 VWMALEYCPGNELYDYL--LLKQRIPLDETRRLFAQIVSAVFYAHSLQ--CVHRDLKLEN 158

Query: 165 VLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEML--DLYRGQP 222
           +L+  NG   + DFG            E     Q + +  TT  Y  PE++  + Y G  
Sbjct: 159 ILLDKNGYAMLTDFGFTR---------ECATKTQLETVCGTTV-YMAPELIKREAYDGYK 208

Query: 223 INEKSDIWALGVFLYKICYYTTPF-ENGGERAILHARYQYPQ-YPMYSS-RLKNLIRMML 279
           +    D W+LG+ LY + +   PF E+   R  L   ++ P     Y+S + K+LI  +L
Sbjct: 209 V----DTWSLGIILYTMLHGYMPFDEDDTVRTGLKIMHEEPAVLDEYTSPQAKDLIVRLL 264

Query: 280 MEKPEQRPNVCQVLE 294
            +   QRPN+ +VL+
Sbjct: 265 DKNAAQRPNLNEVLQ 279

>KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 993

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 103/197 (52%), Gaps = 30/197 (15%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLN------IMNQVTQGIVAMHSLNPPLIHRDIK 161
           L+E+ P G   DF++      +K++  LN         Q+   I  +H     +IHRDIK
Sbjct: 240 LLEYAPNG---DFLSV-----IKKYGSLNQDCSVYYSAQILDAIDYLHQKG--VIHRDIK 289

Query: 162 IENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEML-DLYRG 220
            EN+L+  + + K+ DFG+   ++   + T+ +N +++      TA+Y  PE+L D Y  
Sbjct: 290 PENILLDKDMKVKLTDFGTAK-LVEKDETTQTYNLLERSKSFVGTAEYVSPELLNDNY-- 346

Query: 221 QPINEKSDIWALGVFLYKICYYTTPFENGGE----RAILHARYQYPQ-YPMYSSRLKNLI 275
             ++ K DIWA G  L+++     PF+   E    + ++  +Y +   +P+    +++LI
Sbjct: 347 --VDYKCDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLI---IRDLI 401

Query: 276 RMMLMEKPEQRPNVCQV 292
           + +L++ PEQR +  QV
Sbjct: 402 KQILVKNPEQRLDTLQV 418

>NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {ON}
           Anc_8.654
          Length = 729

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 64/215 (29%), Positives = 102/215 (47%), Gaps = 46/215 (21%)

Query: 104 EVLQ-------LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLI 156
           EVLQ       ++EF  GG    ++  +   RLKE     +  Q+  G+  MHS    L+
Sbjct: 120 EVLQNSKYIGIVLEFASGGEFYKYLQRK--RRLKEPHACQLFAQLISGVTYMHSKG--LV 175

Query: 157 HRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQ--YRCPEM 214
           HRD+K+EN+L+  N    + DFG V+          EF F   ++MK +     Y  PE+
Sbjct: 176 HRDLKLENLLLDKNENLIITDFGFVN----------EF-FGSNELMKRSCGSPCYAAPEL 224

Query: 215 L---DLYRGQPINEKSDIWALGVFLYKICYYTTPFE------NGGERAILHARYQYP--- 262
           +   + YR +    K DIW+ G+ LY +     P++      NG +   L   YQY    
Sbjct: 225 VLSTEPYRAR----KVDIWSCGIILYAMLAGYLPWDDDSQNPNGDDIGKL---YQYITKT 277

Query: 263 --QYPMYSSRL-KNLIRMMLMEKPEQRPNVCQVLE 294
             ++P Y S L ++LIR +L   P +R ++  + +
Sbjct: 278 ALKFPAYISPLARDLIRKILTANPSRRISISYICK 312

>TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa]
           {ON} Anc_8.668 YPL150W
          Length = 861

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 58/195 (29%), Positives = 91/195 (46%), Gaps = 23/195 (11%)

Query: 104 EVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIE 163
           +V   +E+CPG  L + +      R+   E   +  Q+   I   HSLN   +HRD+K+E
Sbjct: 102 KVWMALEYCPGKELYEHLLA--LKRISLDECSRLFAQIVGAIYYAHSLN--CVHRDLKLE 157

Query: 164 NVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDL--YRGQ 221
           N+L+   G  K+ DFG     +            Q D +  TT  Y  PE+ +   Y G 
Sbjct: 158 NILLDKKGNAKLTDFGFTRECVSKS---------QLDTICGTTV-YMAPELTERKSYDGF 207

Query: 222 PINEKSDIWALGVFLYKICYYTTPFENGGE-RAILHARYQYPQY--PMYSSRLKNLIRMM 278
            I    DIWALGV LY +   + PF+   E +       + P+    + S   K+LI  +
Sbjct: 208 KI----DIWALGVILYTMINGSMPFDEDDEAKTKWKIVNEMPEINEDLVSPDAKDLIEQL 263

Query: 279 LMEKPEQRPNVCQVL 293
           L + P +RP++ ++L
Sbjct: 264 LAKDPNERPSIEKIL 278

>YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}
           KIN2Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin1p
          Length = 1147

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/222 (27%), Positives = 107/222 (48%), Gaps = 26/222 (11%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLI 167
           L E+  GG L+D++       LKE         +   +  +H+ N  ++HRD+KIEN++I
Sbjct: 201 LFEYVSGGQLLDYIIQ--HGSLKEHHARKFARGIASALQYLHANN--IVHRDLKIENIMI 256

Query: 168 SSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQP-INEK 226
           SS+GE K+ DFG +S I         F++ +Q      +  +  PE+L   + QP    +
Sbjct: 257 SSSGEIKIIDFG-LSNI---------FDYRKQLHTFCGSLYFAAPELL---KAQPYTGPE 303

Query: 227 SDIWALGVFLYKICYYTTPFENGGERAILH-----ARYQYPQYPMYSSRLKNLIRMMLME 281
            DIW+ G+ LY +     PF++    +ILH      +  YP +   S  + +L+  M++ 
Sbjct: 304 VDIWSFGIVLYVLVCGKVPFDDENS-SILHEKIKKGKVDYPSH--LSIEVISLLTRMIVV 360

Query: 282 KPEQRPNVCQVLEEVSSMQGIPCPLPNFYLQRQQATQLMMNN 323
            P +R  +  V+E     +G     P++   R   T  M+++
Sbjct: 361 DPLRRATLKNVVEHPWMNRGYDFKAPSYVPNRVPLTPEMIDS 402

>YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middle
           sporulation-specific mitogen-activated protein kinase
           (MAPK) required for production of the outer spore wall
           layers; negatively regulates activity of the glucan
           synthase subunit Gsc2p
          Length = 388

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 62/214 (28%), Positives = 102/214 (47%), Gaps = 14/214 (6%)

Query: 24  IIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLKGKP 83
           II++L  G +  +  V+    +P   + +  +  +   E      +R E++ M   KG  
Sbjct: 40  IIQFLGKGAYGTVCSVKFKGRSPAARIAVKKISNIFNKEILLKRAIR-ELKFMNFFKGHK 98

Query: 84  HVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQ 143
           ++V  ID     S   DG Y   +L+++     L   +++ +Q  L EF +   + Q+  
Sbjct: 99  NIVNLIDLEIVTSSPYDGLYCYQELIDY----DLAKVIHSSVQ--LSEFHIKYFLYQILC 152

Query: 144 GIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMK 203
           G+  +HS +  +IHRD+K  N+L + NG  K+CDFG   GI       +  + VQ  I  
Sbjct: 153 GLKYIHSAD--VIHRDLKPGNILCTLNGCLKICDFGLARGI--HAGFFKCHSTVQPHITN 208

Query: 204 NT-TAQYRCPEMLDLYRGQPINEKSDIWALGVFL 236
              T  YR PE+  L   QP ++  DIWA+G  L
Sbjct: 209 YVATRWYRAPEL--LLSNQPYSKSVDIWAVGCIL 240

>TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1057

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 50/191 (26%), Positives = 97/191 (50%), Gaps = 17/191 (8%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLI 167
           L+E+ P G  +  M  +    L E        Q+   I  +HS    ++HRDIK EN+L+
Sbjct: 244 LLEYAPNGDFLSIM--KKYGSLNEDCACYYSAQIIDAIDFLHSKG--IVHRDIKPENILL 299

Query: 168 SSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEML-DLYRGQPINEK 226
             + + K+ DFG+   +   P  T+ ++ + +      TA+Y  PE+L D Y    ++ +
Sbjct: 300 DKDFKVKLTDFGTAKILEPKPNTTDSYDLLSRSKSFVGTAEYVSPELLNDNY----VDYR 355

Query: 227 SDIWALGVFLYKICYYTTPFENGGE----RAILHARYQYPQ-YPMYSSRLKNLIRMMLME 281
            DIWA G  L+++     PF+   E    + ++  +Y +   +P+    +++L++ +L++
Sbjct: 356 CDIWAFGCILFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLV---VRDLVKGILIK 412

Query: 282 KPEQRPNVCQV 292
           +P QR  + Q+
Sbjct: 413 QPAQRLTIPQI 423

>Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL101W
           (REAL)
          Length = 1526

 Score = 82.4 bits (202), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/237 (25%), Positives = 113/237 (47%), Gaps = 36/237 (15%)

Query: 104 EVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIE 163
           E+  ++E+  GG L D++ +R   +L E E ++   Q+ +G+   HS N  + HRD+K E
Sbjct: 188 ELYLVLEYVDGGELFDYLVSR--GKLPEREAIHYFKQIVEGVSYCHSFN--ICHRDLKPE 243

Query: 164 NVLISS-NGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNT--TAQYRCPEML--DLY 218
           N+L+   N + K+ DFG ++ +  P K           ++K +  +  Y  PE++    Y
Sbjct: 244 NLLLDKKNKKIKIADFG-MAALELPNK-----------LLKTSCGSPHYASPEIVMGRPY 291

Query: 219 RGQPINEKSDIWALGVFLYKICYYTTPFENGGERAIL----HARYQYPQYPMYSSRLKNL 274
            G P    SD+W+ G+ L+ +     PF +   + +L      +YQ P      +R  NL
Sbjct: 292 HGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPMNLSLEAR--NL 345

Query: 275 IRMMLMEKPEQRPNVCQVLEE--VSSMQGIPCPLPNFYLQRQQATQLMMNNTNGSIY 329
           I  +L+  PE+R    ++LE   +     +P    N  L++ +   +    +N  ++
Sbjct: 346 ISKILVIDPEKRITTQEILEHPLIKKYDNLPV---NKMLRKMKGDSMTRGKSNSDLH 399

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score = 82.0 bits (201), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 77/277 (27%), Positives = 126/277 (45%), Gaps = 35/277 (12%)

Query: 27  YLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLKGKPH-- 84
           +L  GGFA+ +Q++           +A  K  I  EK    T +  +  +Q+ K   H  
Sbjct: 96  FLGEGGFARCFQIKDESGKIFAAKTVA--KISIKSEK----TRKKLLSEIQIHKSMRHFN 149

Query: 85  VVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQG 144
           VV +ID         D T  V  L+E CP G L++ +  R    + E EV   M Q+   
Sbjct: 150 VVQFIDC------FEDDT-NVYILLEICPNGSLMELLKKR--RTVTEPEVRYFMTQICGA 200

Query: 145 IVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKN 204
           I  MHS    +IHRD+K+ N+    N   K+ DFG  + +     N  E  +        
Sbjct: 201 IKYMHSRR--VIHRDLKLGNIFFDKNYNLKIGDFGLAAVL----ANDRERKYTV-----C 249

Query: 205 TTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPFENGG-----ERAILHARY 259
            T  Y  PE+L + +    + + DIW++GV +Y +     PF++       ER I +  +
Sbjct: 250 GTPNYIAPEVL-MGKHSGHSYEVDIWSIGVMIYALLIGKPPFQSKDVNMIYER-IKNRDF 307

Query: 260 QYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEV 296
            +P+    S+  K LI  +L   P +RP++ ++++ V
Sbjct: 308 AFPKDKYISNEAKTLIHDILSTDPLERPSIEEIIDYV 344

>Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (REAL)
          Length = 1360

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 66/231 (28%), Positives = 101/231 (43%), Gaps = 29/231 (12%)

Query: 66   LNTLRAEVEAMQLLKGKPHVVGYIDSNAARSIS--NDGTYEVLQLMEFCPGGGLIDFMNT 123
            L T+ +E++ M  L   PH       N  R +    D  Y  ++       G +  F   
Sbjct: 1147 LGTIPSEIQIMATLNKTPH------ENILRLLDFFEDDDYYYIETPVHGETGCIDLFDLI 1200

Query: 124  RLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSG 183
              +  + E E   I+ QV  GI  +H  +  ++HRDIK ENV++ S G  K+ DFGS + 
Sbjct: 1201 EFKTNMTECEAKLIVKQVVAGIKHLH--DQGIVHRDIKDENVIVDSKGFVKIIDFGSAAY 1258

Query: 184  IIRPPKNTEEFNFVQQDIMKNTTAQYRCPEML--DLYRGQPINEKSDIWALGVFLYKICY 241
            +   P +     FV        T  Y  PE+L  + Y G+P     DIWA+G+ LY + +
Sbjct: 1259 VKSGPFDV----FV-------GTIDYAAPEVLGGNPYEGKP----QDIWAIGILLYTVVF 1303

Query: 242  YTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQV 292
               PF N  E  IL    ++      S     LI+ +L     +RP +  +
Sbjct: 1304 KENPFYNIDE--ILEGDLKFNNAEEVSEDCIELIKSILNRCVPKRPTIDDI 1352

>ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 774

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 81/299 (27%), Positives = 134/299 (44%), Gaps = 38/299 (12%)

Query: 27  YLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLKGKPH-- 84
           +L  GGFA+ +Q++ +         +A L   I  EK    T +  +  +Q+ K   H  
Sbjct: 150 FLGEGGFARCFQIRDDSGKLFAAKTVAKLS--IKTEK----TRKKLLSEIQIHKSMKHQN 203

Query: 85  VVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQG 144
           +V +ID         D T  V  L+E CP G L++ +  R Q  L E EV     Q+   
Sbjct: 204 IVQFIDC------FEDDT-NVYILLEICPNGSLMELLKKRKQ--LTEPEVRFFTTQICGA 254

Query: 145 IVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKN 204
           I  MHS    +IHRD+K+ N+    N   K+ DFG  + +     N  E  F        
Sbjct: 255 IKYMHSRR--VIHRDLKLGNIFFDRNYNLKIGDFGLAAVL----ANDRERKFTV-----C 303

Query: 205 TTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPFE----NGGERAILHARYQ 260
            T  Y  PE+L + +    + + D+W++GV +Y +     PF+    N     I    + 
Sbjct: 304 GTPNYIAPEVL-MGKHSGHSYEVDVWSIGVMVYALLVGKPPFQAKDVNTIYERIKCCDFI 362

Query: 261 YPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQGIPCPLPNFYLQRQQATQL 319
           +P+    S   K L++ +L   P +RP++ ++++ V   +GI  P    Y+Q    T++
Sbjct: 363 FPKEKPISHEAKVLVQDLLSLDPLERPSISEIMDYV-WFRGIFPP----YIQSNVMTEV 416

>NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON}
           Anc_3.92
          Length = 1116

 Score = 81.6 bits (200), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 55/188 (29%), Positives = 92/188 (48%), Gaps = 24/188 (12%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLN------IMNQVTQGIVAMHSLNPPLIHRDIK 161
           L+E+ P G L+  M        K+F  LN         Q+   I  MHS    +IHRDIK
Sbjct: 251 LLEYAPNGDLLSLM--------KKFGSLNEECCCYYGAQIIDAIKFMHSKG--IIHRDIK 300

Query: 162 IENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEML-DLYRG 220
            EN+L+  + + K+ DFG+   +   P  T  ++ + +      TA+Y  PE+L D Y  
Sbjct: 301 PENILLDKDMKVKITDFGTAKILDNKPPGT-SYDLLTRSKSFVGTAEYVSPELLNDNY-- 357

Query: 221 QPINEKSDIWALGVFLYKICYYTTPFENGGERAILHA--RYQYPQYPMYSSRLKNLIRMM 278
              + +SDIWA G  ++++     PF+   E        + QY     + + +++L++ +
Sbjct: 358 --TDARSDIWAFGCIVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPTVVRDLVKRI 415

Query: 279 LMEKPEQR 286
           L++ PEQR
Sbjct: 416 LIKAPEQR 423

>KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar to
           uniprot|P08458 Saccharomyces cerevisiae YDR523C SPS1
           dispensable for mitosis involved in middle/late stage of
           meiosis required for spore wall formation
           serine/threonine kinase homologous to Ste20p expressed
           in middle/late meiosis
          Length = 512

 Score = 80.5 bits (197), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 92/190 (48%), Gaps = 18/190 (9%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLI 167
           +MEFC GG   D +    ++RL E +V  I+ +V  G+  +HS     IHRDIK  N+L+
Sbjct: 113 VMEFCGGGSCADLLKHLPEHRLSENKVAYIIREVLFGLDYLHSQKK--IHRDIKAANILL 170

Query: 168 SSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKS 227
           + +GE K+ DFG    I+   K T    FV        T  +  PE++   +    NEK+
Sbjct: 171 TDDGEVKLGDFGVSGQIMATLKRT---TFV-------GTPYWMAPEII-AKKDNGYNEKA 219

Query: 228 DIWALGVFLYKICYYTTPFENGGERAILHARYQYPQYPMYSSRL----KNLIRMMLMEKP 283
           DIW+LG+   ++     P+       +L       + P    R     ++ I + L++ P
Sbjct: 220 DIWSLGITAIELLTGQPPYAKHDPMKVL-VNIPLRKPPKLQGRFTGSARDFIALCLIKDP 278

Query: 284 EQRPNVCQVL 293
           + RP+  ++L
Sbjct: 279 DLRPSAAELL 288

>KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1095

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 94/190 (49%), Gaps = 17/190 (8%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLI 167
           L+E+CP G  +  M  +    L E        QV   I  +H+    +IHRDIK EN+L+
Sbjct: 256 LLEYCPNGDFLSLM--KKYGSLNETVACYYSAQVIDAIDYLHTNG--IIHRDIKPENILL 311

Query: 168 SSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKS 227
               + K+ DFG+    I       +F+ + +      TA+Y  PE+L+      ++ + 
Sbjct: 312 DKEFKIKLTDFGTAK--ILDSSTNNKFDLLTRSKSFVGTAEYVAPELLN---DSFVDYRC 366

Query: 228 DIWALGVFLYKICYYTTPFENGGE----RAILHARYQYPQ-YPMYSSRLKNLIRMMLMEK 282
           D+WA G  LY++     PF+   E    + ++  +Y +   +P+    +++L++ +L++ 
Sbjct: 367 DVWAFGCILYQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLI---IRDLVKKILVKD 423

Query: 283 PEQRPNVCQV 292
             QRP++ Q+
Sbjct: 424 LNQRPSISQI 433

>KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 872

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 59/211 (27%), Positives = 98/211 (46%), Gaps = 40/211 (18%)

Query: 104 EVLQ-------LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLI 156
           EVLQ       ++E+  GG    ++  +   RLKE     +  Q+  G+  MHS    L+
Sbjct: 112 EVLQNSKYIGIVLEYASGGEFYKYIQKK--RRLKESAACRLFAQLISGVYYMHSKG--LV 167

Query: 157 HRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQ--YRCPEM 214
           HRD+K+EN+L+  N    + DFG V+  +  P+N         ++MK +     Y  PE+
Sbjct: 168 HRDLKLENLLLDKNENLLITDFGFVNEFL--PEN---------ELMKTSCGSPCYAAPEL 216

Query: 215 LDLYRGQPIN-EKSDIWALGVFLYKICYYTTPFENGGE-----------RAILHARYQYP 262
           +   R  P    K+DIW+ GV +Y +     P+++  E           R I     ++P
Sbjct: 217 VVTAR--PYEARKADIWSCGVIMYAMLAGYLPWDDDPENPDGDDIGKLYRYITRTPLKFP 274

Query: 263 QYPMYSSRLKNLIRMMLMEKPEQRPNVCQVL 293
            Y     R  +L+R +L+  P++R  + Q L
Sbjct: 275 DYIAPVPR--DLLRAILVADPKKRITIAQTL 303

>KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1104

 Score = 81.3 bits (199), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 60/221 (27%), Positives = 105/221 (47%), Gaps = 26/221 (11%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLI 167
           L E+  GG L+D++       L+E      +  +   +  +H  N  ++HRD+KIEN++I
Sbjct: 200 LFEYVSGGQLLDYIIQ--HGSLRERHARKFVRGIASALQYLHLNN--IVHRDLKIENIMI 255

Query: 168 SSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQP-INEK 226
           S++GE K+ DFG +S +    K    F           +  +  PE+L   +  P I  +
Sbjct: 256 STSGEIKIIDFG-LSNLYDNKKQLHTF---------CGSLYFAAPELL---KANPYIGPE 302

Query: 227 SDIWALGVFLYKICYYTTPFENGGERAILH-----ARYQYPQYPMYSSRLKNLIRMMLME 281
            DIW+ GV +Y +     PF++    ++LH      + +YPQ+   S    +L+  ML+ 
Sbjct: 303 VDIWSFGVVIYVLVCGKVPFDDENA-SVLHEKIKKGKVEYPQH--LSIECISLLSKMLVV 359

Query: 282 KPEQRPNVCQVLEEVSSMQGIPCPLPNFYLQRQQATQLMMN 322
            P +R ++ QV       +G   P P++   R   T  M++
Sbjct: 360 DPLKRASLKQVCNHQWMQRGFDFPPPSYIPHRVPLTVEMLD 400

>Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}
           (4910..5845,5849..7711) [2799 nt, 933 aa]
          Length = 932

 Score = 80.9 bits (198), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 56/177 (31%), Positives = 83/177 (46%), Gaps = 19/177 (10%)

Query: 117 LIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVC 176
           L DF+  +  +++ E E   I  Q+  GI  +H L   +IHRDIK EN++I S G  +V 
Sbjct: 766 LFDFIEKK--DKIDEVEQKLIFKQIVAGIKHIHGLG--IIHRDIKTENIIIDSEGCVQVI 821

Query: 177 DFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEK-SDIWALGVF 235
           DFGS +     P             + + T  Y  PE+L   +G+P   K  D+WALG+ 
Sbjct: 822 DFGSAAYATNGPFQ-----------VFHGTIDYASPEVL---KGEPYEGKPQDVWALGIL 867

Query: 236 LYKICYYTTPFENGGERAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQV 292
           LY I +  TPF +  E                S + + LI  ML +K   RP + ++
Sbjct: 868 LYIITFKQTPFNSVAEIIENELEIDPAHSENVSDQCRVLIHKMLDKKAWARPKISEI 924

>KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa]
           {ON} weakly similar to uniprot|P34244 Saccharomyces
           cerevisiae YKL101W HSL1 Nim1p-related protein kinase
           that regulates the morphogenesis and septin checkpoints
           associates with the assembled septin filament required
           along with Hsl7p for bud neck recruitment
           phosphorylation and degradation of Swe1p
          Length = 1267

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 56/211 (26%), Positives = 96/211 (45%), Gaps = 40/211 (18%)

Query: 101 GTYEVLQ-------LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNP 153
           G YEV +       ++E+  GG L D++ ++   +L E E ++   Q+ Q +   H  N 
Sbjct: 138 GLYEVWENKSELYLVLEYVEGGELFDYLVSK--GKLPESEAIHYFKQIVQAVAYCHGFN- 194

Query: 154 PLIHRDIKIENVLISSNGE-YKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTA---QY 209
            + HRD+K EN+L+       K+ DFG  +                 D +  T+     Y
Sbjct: 195 -ICHRDLKPENLLLDKKKRSIKIADFGMAA-------------LETSDKLLETSCGSPHY 240

Query: 210 RCPEML--DLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAIL----HARYQYPQ 263
             PE++    Y G P    SD+W+ G+ L+ +     PF +   + +L      +YQ PQ
Sbjct: 241 ASPEIVLGRKYHGSP----SDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQ 296

Query: 264 YPMYSSRLKNLIRMMLMEKPEQRPNVCQVLE 294
           +   S   K+LI  +L+  P +R  + Q+L+
Sbjct: 297 W--LSVEAKDLISRILVVDPNRRITIDQILQ 325

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score = 80.9 bits (198), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 57/199 (28%), Positives = 94/199 (47%), Gaps = 31/199 (15%)

Query: 104 EVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIE 163
           E+  ++E+  GG L D++ ++   +L E E ++   Q+  GI   HS N  + HRD+K E
Sbjct: 209 ELYLVLEYVDGGELFDYLVSK--GKLTESEAVHYFKQIINGISYCHSFN--ICHRDLKPE 264

Query: 164 NVLISSNGEY-KVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTA--QYRCPEML--DLY 218
           N+L+       K+ DFG  +              V   +++ +     Y  PE++    Y
Sbjct: 265 NLLLDKKRRIIKIADFGMAALQ------------VSNRLLQTSCGSPHYASPEIVMGKCY 312

Query: 219 RGQPINEKSDIWALGVFLYKICYYTTPFENGGERAIL----HARYQYPQYPMYSSRLKNL 274
            G P    SDIW+ G+ L+ +     PF +   + +L    + RYQ P Y   S   KNL
Sbjct: 313 NGAP----SDIWSCGIILFALLTGHLPFNDDNIKKLLIKVQNGRYQMPSY--ISQEAKNL 366

Query: 275 IRMMLMEKPEQRPNVCQVL 293
           I  +L+  P +R +  Q+L
Sbjct: 367 ISRILVVDPSKRISTEQIL 385

>YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}
           PKH1Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis; activates Ypk1p and Ykr2p, components of
           signaling cascade required for maintenance of cell wall
           integrity; redundant with Pkh2p
          Length = 766

 Score = 80.5 bits (197), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 91/192 (47%), Gaps = 15/192 (7%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLI 167
           L+E+ P G  +  +  +    L E       +Q+   + ++H++   +IHRDIK EN+L+
Sbjct: 202 LLEYAPHGDFLGLI--KKYGSLNETCARYYASQIIDAVDSLHNIG--IIHRDIKPENILL 257

Query: 168 SSNGEYKVCDFGSVSGIIRPPKNTEE----FNFVQQDIMKNTTAQYRCPEML-DLYRGQP 222
             N + K+ DFG+   +   P NT +    F+   +      TA+Y  PE+L D Y    
Sbjct: 258 DKNMKVKLTDFGTAKILPEEPSNTADGKPYFDLYAKSKSFVGTAEYVSPELLNDNY---- 313

Query: 223 INEKSDIWALGVFLYKICYYTTPFENGGERAILHA--RYQYPQYPMYSSRLKNLIRMMLM 280
            + + DIWA G  LY++     PF+   E        + QY     +   +K+L++ +L+
Sbjct: 314 TDSRCDIWAFGCILYQMLAGKPPFKAANEYLTFQKVMKIQYAFTAGFPQIVKDLVKKLLV 373

Query: 281 EKPEQRPNVCQV 292
             P  R  + Q+
Sbjct: 374 RDPNDRLTIKQI 385

>CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {ON}
           similar to uniprot|Q12236 Saccharomyces cerevisiae
           YOL100w PKH2
          Length = 965

 Score = 80.5 bits (197), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 74/293 (25%), Positives = 138/293 (47%), Gaps = 33/293 (11%)

Query: 13  TKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAE 72
           T +  GI        L  G ++Q++ +  +  +      +  L +  + ++  +  +  E
Sbjct: 109 TIIRKGIKDFKFGDMLGDGSYSQVF-LATSKTDSSKTYAVKVLNKEYLIKQKKVKYVNIE 167

Query: 73  VEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEF 132
             A+Q LK    V G I  N + +  ++    +  L+E+ P G   DF++      +K+F
Sbjct: 168 KTALQNLKS---VTGVI--NLSFTFQDEAN--LYFLLEYAPNG---DFLSL-----IKKF 212

Query: 133 EVLN------IMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGI-I 185
             LN         Q+   I +MHS    +IHRDIK EN+L+  N + K+ DFG+   +  
Sbjct: 213 GTLNEECTIYYSAQIIDAIGSMHSHG--IIHRDIKPENILLDGNMKIKLTDFGTAKLLQK 270

Query: 186 RPPKNTE-EFNFVQQDIMKNTTAQYRCPEML-DLYRGQPINEKSDIWALGVFLYKICYYT 243
           +  KN +  +N + +      TA+Y  PE+L D Y     + K DIWA G  +Y++    
Sbjct: 271 KSDKNGKPHYNLLTRSSSFVGTAEYVSPELLSDNY----TDYKCDIWAFGCLVYQMIAGK 326

Query: 244 TPFENGGERAILHA--RYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLE 294
            PF+   E        + Q+     + + +++L++ +L+++PE+R  + Q+ E
Sbjct: 327 PPFKATNEYLTFQKVMKVQFAFTAGFPTIIRDLVKNILVKQPEKRLTIPQIKE 379

>Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON}
           (48405..49868) [1464 nt, 488 aa]
          Length = 487

 Score = 79.7 bits (195), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 73/274 (26%), Positives = 126/274 (45%), Gaps = 28/274 (10%)

Query: 23  SIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLKGK 82
           SI + +  G F  +Y+      +  NG  +A     +   +  ++ L  E+  +  L+  
Sbjct: 16  SIQECVGRGNFGDVYKAF----DKTNGAIVAVKVVNLEHTEEDIDLLAQEIFFLAELRS- 70

Query: 83  PHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVT 142
           P++  YI +     +S      +  +ME+C GG   D + T   N L E +V  I  +V 
Sbjct: 71  PYITNYI-TTMIEDVS------MWIVMEYCGGGACSDLIKTVYINGLPENKVGFITREVL 123

Query: 143 QGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIM 202
           +G+  +H      IHRDIK  N+L++  G+ K+ DFG VSG IR     +   FV     
Sbjct: 124 KGLKYLHDQKK--IHRDIKAANILLTDEGKVKLGDFG-VSGQIR--ATMKRGTFV----- 173

Query: 203 KNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAILHA--RYQ 260
              T  +  PE+++       NEK+DIW+LG+ +Y++     P        ++ +  R +
Sbjct: 174 --GTPYWMAPEVVN-KESNGYNEKADIWSLGITVYELLKGLPPLSKCDPMKVMVSLPRRK 230

Query: 261 YPQ-YPMYSSRLKNLIRMMLMEKPEQRPNVCQVL 293
            P+ +  YS   K  +   L++ P  RP+   +L
Sbjct: 231 PPKLHGQYSDVAKGFVAACLVKDPNLRPSAEMLL 264

>Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {ON}
           YDR490C (REAL)
          Length = 758

 Score = 80.1 bits (196), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 52/196 (26%), Positives = 91/196 (46%), Gaps = 15/196 (7%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLI 167
           L+E+ P G  +  +  +    L E       +Q+   + ++HS+   +IHRDIK EN+L+
Sbjct: 202 LLEYAPHGDFLGLI--KKYGSLNEICARYYASQIIDAVDSLHSIG--IIHRDIKPENILL 257

Query: 168 SSNGEYKVCDFGSVSGIIRPPKNTEE----FNFVQQDIMKNTTAQYRCPEML-DLYRGQP 222
             + + K+ DFG+   +   P N  +    F+   +      TA+Y  PE+L D Y    
Sbjct: 258 DKDMKVKLTDFGTAKILPEQPSNAADGKPCFDLYAKSKSFVGTAEYVSPELLNDSY---- 313

Query: 223 INEKSDIWALGVFLYKICYYTTPFENGGERAILHA--RYQYPQYPMYSSRLKNLIRMMLM 280
            + + DIWA G  LY++     PF+   E        + QY     +   +K+L++ +L+
Sbjct: 314 TDSRCDIWAFGCILYQMLAGKPPFKAANEYLTFQKVMKIQYAFTAGFPQIVKDLVKKLLV 373

Query: 281 EKPEQRPNVCQVLEEV 296
             P  R  + Q+   V
Sbjct: 374 RDPNDRLAIEQIKAHV 389

>TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1218

 Score = 80.5 bits (197), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 57/222 (25%), Positives = 106/222 (47%), Gaps = 26/222 (11%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLI 167
           L E+  GG L+D++       L+E         +   +  +H  N  ++HRD+KIEN++I
Sbjct: 256 LFEYVSGGQLLDYIIQ--HGSLREHHARKFTRGIASALQYLHGNN--IVHRDLKIENIMI 311

Query: 168 SSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQP-INEK 226
           S++G+ K+ DFG +S +    K    F           +  +  PE+L   +  P +  +
Sbjct: 312 STSGDIKIIDFG-LSNLYDSKKQLNTF---------CGSLYFAAPELL---KANPYVGPE 358

Query: 227 SDIWALGVFLYKICYYTTPFENGGERAILH-----ARYQYPQYPMYSSRLKNLIRMMLME 281
            DIW+ GV LY +     PF++    ++LH      +  YPQ+   S  + +L+  ML+ 
Sbjct: 359 VDIWSFGVVLYVLACGKVPFDDENS-SVLHEKIKQGKVDYPQH--LSIEVISLLSKMLVV 415

Query: 282 KPEQRPNVCQVLEEVSSMQGIPCPLPNFYLQRQQATQLMMNN 323
            P++R ++ Q++      +G     P++   R   +  M+N+
Sbjct: 416 DPKKRASLQQIVNHPWMTRGFDTKAPSYLPLRVPMSIDMINH 457

>AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL100W
           (PKH2) and YDR490C (PKH1)
          Length = 1033

 Score = 80.5 bits (197), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 102/201 (50%), Gaps = 38/201 (18%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLN---IMNQVTQGIVAMHSLNP-PLIHRDIKIE 163
           L+E+ P G   DF++      +K F  L+         Q + A+H L+   +IHRD+K E
Sbjct: 279 LLEYAPNG---DFLSV-----MKRFGTLSEECTKYYGAQILDAIHHLHKQGIIHRDVKPE 330

Query: 164 NVLISSNGEYKVCDFGSVSGIIRPPK------NTEEFNFVQQDIMKNTTAQYRCPEML-D 216
           N+L+    + K+ DFG+   I R  +      NT   +FV        TA+Y  PE+L D
Sbjct: 331 NILLDKTMKIKLTDFGTAKLIGREDENKPYDLNTRSKSFV-------GTAEYVSPELLND 383

Query: 217 LYRGQPINEKSDIWALGVFLYKICYYTTPFENGGE----RAILHARYQYPQ-YPMYSSRL 271
            Y    ++ + DIWA G  L+++     PF+   E    + ++  +Y +   +PM    L
Sbjct: 384 NY----VDSRCDIWAFGCILFQMVAGKPPFKATNEYLTFQKVMRVQYAFTAGFPMI---L 436

Query: 272 KNLIRMMLMEKPEQRPNVCQV 292
           ++LI+ +L++KPEQR  + Q+
Sbjct: 437 RDLIKQLLVKKPEQRLTILQI 457

>AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR523C
           (SPS1)
          Length = 440

 Score = 79.3 bits (194), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 68/277 (24%), Positives = 130/277 (46%), Gaps = 28/277 (10%)

Query: 21  QVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLK 80
           Q  I++ +  G F  +Y+ +    N I  + +  L+    P    ++ L  E+  +  L+
Sbjct: 19  QYEILQCIGRGNFGDVYKARDLTSNEIVAIKVVNLEDTDEP----IDLLAQEIFFLSELR 74

Query: 81  GKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQ 140
             P++  Y       +   D +  ++  ME+C GG   + +    ++++ E +   I+++
Sbjct: 75  S-PYITNY-----KTAFLVDVSMWIV--MEYCGGGSCAELLKYTPEHKVTEEQCAFIVSE 126

Query: 141 VTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQD 200
           V  G+  +HS     IHRDIK  N+L++ NG  K+ DFG VSG +   +  + F      
Sbjct: 127 VLIGLDYLHSQRK--IHRDIKSANILLTDNGHVKLGDFG-VSGQMMVTRKRDTF------ 177

Query: 201 IMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAILHA--R 258
                T  +  PE++D  + Q  NE +DIW+LG+ + ++     P +       L A  +
Sbjct: 178 ---VGTPFWMAPEVIDRNK-QGYNEMADIWSLGITVIELLMGHPPLDKYDAMKALMAIPK 233

Query: 259 YQYPQY-PMYSSRLKNLIRMMLMEKPEQRPNVCQVLE 294
              P+    +SS  ++ +   L++ P QRP   ++L+
Sbjct: 234 RDPPKLDKRFSSHARDFVAQCLIKDPSQRPTAAELLK 270

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score = 80.5 bits (197), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 94/201 (46%), Gaps = 33/201 (16%)

Query: 104 EVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIE 163
           E+  ++E+  GG L D++ +R   +L E E ++   Q+ QG+   H  N  + HRD+K E
Sbjct: 141 ELYLVLEYVEGGELFDYLISR--GKLPEQEAVHYFKQIVQGVSYCHHFN--ICHRDLKPE 196

Query: 164 NVLISS-NGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTA---QYRCPEML--DL 217
           N+L+   N   K+ DFG  +                 D +  T+     Y  PE++    
Sbjct: 197 NLLLDKKNLSVKIADFGMAA-------------LETTDKLLETSCGSPHYASPEIVMGQK 243

Query: 218 YRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAIL----HARYQYPQYPMYSSRLKN 273
           Y G P    SD+W+ G+ L+ +     PF +   + +L      +YQ PQ    S+  K+
Sbjct: 244 YHGSP----SDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMPQN--ISNEAKD 297

Query: 274 LIRMMLMEKPEQRPNVCQVLE 294
           LI  +L+  P  R  + +VLE
Sbjct: 298 LIAKILIVDPAMRITIDEVLE 318

>Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR096W
           (REAL)
          Length = 1160

 Score = 80.5 bits (197), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 61/220 (27%), Positives = 109/220 (49%), Gaps = 24/220 (10%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLI 167
           L E+  GG L+D++       LKE         +   +  +H+ N  ++HRD+KIEN++I
Sbjct: 208 LFEYVSGGQLLDYIIQ--HGSLKEHHARKFARGIASALQYLHANN--IVHRDLKIENIMI 263

Query: 168 SSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQP-INEK 226
           SS+GE K+ DFG +S I         F++ +Q      +  +  PE+L   + QP    +
Sbjct: 264 SSSGEIKIIDFG-LSNI---------FDYRKQLHTFCGSLYFAAPELL---KAQPYTGPE 310

Query: 227 SDIWALGVFLYKICYYTTPFENGGERAILHARYQYPQ--YPMYSS--RLKNLIRMMLMEK 282
            DIW+ G+ LY +     PF++    +ILH + +  +  YP + S   +  L RM++++ 
Sbjct: 311 VDIWSFGIVLYVLVCGKVPFDDENS-SILHEKIKKGKVDYPSHLSIEAISLLTRMIVID- 368

Query: 283 PEQRPNVCQVLEEVSSMQGIPCPLPNFYLQRQQATQLMMN 322
           P +R  +  V++     +G     P++   R   T  M++
Sbjct: 369 PLKRATLKNVVDHPWMNRGYDFKTPSYVPNRVPITPEMLD 408

>KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {ON}
           Anc_6.262 YPL236C
          Length = 387

 Score = 78.6 bits (192), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 65/270 (24%), Positives = 117/270 (43%), Gaps = 58/270 (21%)

Query: 83  PHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQN--RLKEFEVLNIMNQ 140
           P+++  +DS   +    DG+  VL L+ + P G L D ++  L +  R+ E EV+ +M  
Sbjct: 117 PYIMQCLDSQVIQR--RDGSKTVLILLPYLPLGSLRDAIDRNLLDGIRMSESEVIRVMIG 174

Query: 141 VTQGIVAMH----------SLNP------------------------------------- 153
             +G++ +H          S+ P                                     
Sbjct: 175 TCRGLLYLHDPTSRGNLGSSMGPQNGMDAVSMTLSDDAAMLLDGTPFEMDMLSSHSMKMD 234

Query: 154 PLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPE 213
              H +IK  N+L SS+G   + + GS+  +    +N +    +++   ++ T  Y  PE
Sbjct: 235 SYAHMNIKPSNILFSSDGLPVITELGSLQKLDLKIENVKMLKSIKEWTEEHCTVYYMPPE 294

Query: 214 MLDLYRGQPINEKSDIWALGVFLYKICYYTTPF-------ENGGERAILHARYQYPQYPM 266
           +L+L  G  ++   DIW+LG  LY + +  +PF       E   +  I  ARY +P+  +
Sbjct: 295 LLNLKVGTVLDCSVDIWSLGCTLYTLLFGISPFKREEQVNEVPLKYGISKARYSFPEGHV 354

Query: 267 YSSRLKNLIRMMLMEKPEQRPNVCQVLEEV 296
           YS +L ++I   L   P  RP V ++L ++
Sbjct: 355 YSKKLVSVIETCLQVNPTMRPTVNELLGQL 384

>TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {ON}
           Anc_2.496 YHL007C
          Length = 915

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 73/279 (26%), Positives = 123/279 (44%), Gaps = 52/279 (18%)

Query: 30  SGGFAQIYQVQVNPPNPINGMNLAC--LKRVIVPEKSGLNTLRAEVEAMQLLKGKPH--V 85
           SGG    Y+V  N    I  MNL     K +I+ E             + ++KG  H  +
Sbjct: 634 SGGVYTAYEVGTNASVAIKQMNLEKQPKKELIINE-------------ILVMKGSKHQNI 680

Query: 86  VGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGI 145
           V +IDS   +        ++  +ME+  GG L D +   +   L E ++  +  +  +G+
Sbjct: 681 VNFIDSYVLKG-------DLWVVMEYMEGGSLTDVVTHCI---LTEAQIGAVCRETLRGL 730

Query: 146 VAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNT 205
             +HS    +IHRDIK +N+L+S NGE K+ DFG  + I        E N  +  ++   
Sbjct: 731 QFLHSKG--VIHRDIKSDNILLSMNGEIKLTDFGFCAQI-------NEINLKRTTMVG-- 779

Query: 206 TAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAILHARY------ 259
           T  +  PE++      P   K DIW+LG+ + ++     P+ N      L A Y      
Sbjct: 780 TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLN---ETPLRALYLIATNG 833

Query: 260 --QYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEV 296
             +  +  + S  LK+ +   L   P+ R +  ++L +V
Sbjct: 834 TPKLKEPEVLSPELKSFLAWCLNVNPDTRASATELLRDV 872

>NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON} 
          Length = 1258

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 76/301 (25%), Positives = 135/301 (44%), Gaps = 38/301 (12%)

Query: 21  QVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLK 80
           ++  IK +     A +++ Q  PP P N   +A  ++ +  E S       E    Q+L 
Sbjct: 188 EICAIKIVNRATKAFLHKEQSMPP-PKNEQEIAERQKRLEKEISRDKRTVREASLGQILY 246

Query: 81  GKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQ 140
             PH+    +     ++SN        L E+  GG L+D++       L+E         
Sbjct: 247 -HPHICRLFE---MCTMSN----HFYMLFEYVSGGQLLDYIIQ--HGSLREHHARKFARG 296

Query: 141 VTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQD 200
           +   +  +H  N  ++HRD+KIEN++IS++GE K+ DFG +S +    K    F      
Sbjct: 297 IASALQYLHLNN--IVHRDLKIENIMISNSGEIKIIDFG-LSNVFDNRKQLHTF------ 347

Query: 201 IMKNTTAQYRCPEMLDL--YRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAILH-- 256
                +  +  PE+L    Y G  +    D+W+ G+ LY +     PF++    ++LH  
Sbjct: 348 ---CGSLYFAAPELLKAHPYTGPEV----DVWSFGIVLYVLVCGKVPFDDENS-SVLHEK 399

Query: 257 ---ARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQGIPCPLPNFYLQR 313
               + +YP +   S  + +L+  M++  P +R ++ QV+E     +G   P P  YL R
Sbjct: 400 IRQGKVEYPNH--LSIEVISLLSKMIVVDPAKRASLRQVVEHPWMTRGYDFP-PLSYLPR 456

Query: 314 Q 314
           +
Sbjct: 457 R 457

>KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {ON}
           Anc_8.668 YPL150W
          Length = 879

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 48/156 (30%), Positives = 73/156 (46%), Gaps = 32/156 (20%)

Query: 104 EVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIE 163
           +V   +E+CPG  L D +      R+   E   +  Q+   +   HSLN   +HRD+K+E
Sbjct: 106 KVWMALEYCPGKELYDHL--LFSKRIPIAECTELFAQIVGAVYYAHSLN--CVHRDLKLE 161

Query: 164 NVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNT------TAQYRCPEMLDL 217
           N+L+  +G  K+ DFG                F ++ + ++T      T  Y  PE+++ 
Sbjct: 162 NILLDKHGRAKLTDFG----------------FTRECMTRSTLETVCGTTVYMAPELIER 205

Query: 218 --YRGQPINEKSDIWALGVFLYKICYYTTPFENGGE 251
             Y G  I    DIWALGV LY + Y   PF+   E
Sbjct: 206 KSYDGFKI----DIWALGVILYTMIYGAMPFDEDDE 237

>TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.406
           YHR102W
          Length = 975

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/232 (26%), Positives = 111/232 (47%), Gaps = 29/232 (12%)

Query: 69  LRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNR 128
           ++ E++ +  LK  P++  Y  S    +        +  +ME+C GG +   +      +
Sbjct: 85  IQREIQFLVSLKQVPNITRYYASYLKDT-------SLWIIMEYCAGGSVRTLLR---PGK 134

Query: 129 LKEFEVLNIMNQVTQGIVAMHSLNPP-LIHRDIKIENVLISSNGEYKVCDFGSVSGIIRP 187
           + E  +  IM ++   +VA+H ++   +IHRDIK  N+LI++ G  K+CDFG  + + + 
Sbjct: 135 IDEKYIAVIMREL---LVALHYIHKDNVIHRDIKAANLLITNEGNVKLCDFGVAAQLNQ- 190

Query: 188 PKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPF- 246
                  N +++  M   T  +  PE+  +  G   + K+DIW++G+  Y+I     PF 
Sbjct: 191 -------NTMRRQTMAG-TPYWMAPEV--IMEGISYDTKADIWSVGITAYEIATGNPPFC 240

Query: 247 ENGGERAILHARYQYP---QYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEE 295
           E    RA+       P   +   +   LK  I M L E P++RP   ++L E
Sbjct: 241 EMEALRAMQVISKSKPARLEGKNHDPLLKEFIAMCLDEDPQERPTADKLLHE 292

>SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weakly
           similar to uniprot|P47116 Saccharomyces cerevisiae
           YJR059W PTK2 Putative serine/threonine protein kinase
           involved in regulation of ion transport across plasma
           membrane enhances spermine uptake
          Length = 818

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 79/175 (45%), Gaps = 29/175 (16%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLI 167
           +ME+CPGG L   +      R    E   +  QVTQG+  MH  N  ++HRDIK ENVLI
Sbjct: 372 VMEYCPGGDLHSLITRTGWKRSPLKERFCLFKQVTQGLRFMH--NQGVVHRDIKPENVLI 429

Query: 168 SSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRC---------PEMLDL- 217
           S +G  K+ DFG             ++     D + +    + C         PE++ L 
Sbjct: 430 SKDGIAKLTDFG-----------ISDWAHEDPDDLNSPMRVFDCYVGSPPFSPPEVMALK 478

Query: 218 -YRGQPINE----KSDIWALGVFLYKICYYTTPFENGGERAILHARYQYPQYPMY 267
             +G  +      K D WALG+ L+ + Y  TPF +  E +  H R     Y M+
Sbjct: 479 NAKGDAVKPYDPFKMDCWALGMILFALVYQATPFLS-AESSNAHYREYILSYDMF 532

>SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa]
           {ON} similar to uniprot|Q12236 YOL100W Saccharomyces
           cerevisiae YOL100W PKH2 Serine/threonine protein kinase
           involved in sphingolipid-mediated signaling pathway that
           controls endocytosis
          Length = 1071

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 56/196 (28%), Positives = 100/196 (51%), Gaps = 29/196 (14%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLN------IMNQVTQGIVAMHSLNPPLIHRDIK 161
           L+E+ P G   DF++      +K+F  LN         Q+   I  +H     ++HRDIK
Sbjct: 259 LLEYAPNG---DFLSV-----MKKFGSLNEECCRYYGAQMLDAIDFIHKNG--VVHRDIK 308

Query: 162 IENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQ 221
            EN+L+  + + K+ DFG+   + R  K+   +N +++      TA+Y  PE+L+     
Sbjct: 309 PENILLDEHMKVKLTDFGTAKLLDRDEKSG--YNLLKKSRSFVGTAEYVSPELLN---DN 363

Query: 222 PINEKSDIWALGVFLYKICYYTTPFENGGE----RAILHARYQYPQ-YPMYSSRLKNLIR 276
            +N K DIWA G  LY++     PF+   E    + ++  +Y +   +P+    +++L++
Sbjct: 364 CVNYKCDIWAFGCILYQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLV---IRDLVK 420

Query: 277 MMLMEKPEQRPNVCQV 292
            +L++ PE R N  QV
Sbjct: 421 QLLVKSPEARLNASQV 436

>TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa]
           {ON} Anc_1.24 YDR523C
          Length = 468

 Score = 78.6 bits (192), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 73/283 (25%), Positives = 129/283 (45%), Gaps = 30/283 (10%)

Query: 23  SIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLKGK 82
           SI + +  G F  +Y+        +  + +  L+         +N L  E+  +  LK  
Sbjct: 18  SIKQCVGRGNFGDVYKACEKVSGKVVAVKVVNLEHT----DEDINLLAQEIFFLAELKS- 72

Query: 83  PHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVT 142
           P++  YI      +++ D +  ++  ME+C GG   D +       L E +   I  +V 
Sbjct: 73  PYITNYI-----TTMTEDVSMWII--MEYCGGGSCADLLRNIYNCGLPESKSAYITREVL 125

Query: 143 QGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIM 202
           +G+  +H      IHRDIK  N+L++  G+ K+ DFG VSG IR     +   FV     
Sbjct: 126 KGLEYLHEQKK--IHRDIKAANILLTDEGKVKLGDFG-VSGQIRA--TLKRGTFV----- 175

Query: 203 KNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAI---LHARY 259
              T  +  PE++        +EK+DIW+LG+ +Y++   + P        +   L  R 
Sbjct: 176 --GTPFWMAPEVVS-KDSDGYDEKADIWSLGITVYELLKGSPPLYKCDPMKVMVNLPKRK 232

Query: 260 QYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVL--EEVSSMQ 300
               +  YSS  K+ +   L++ P+ RP+  ++L  E V+++Q
Sbjct: 233 PPVLHGHYSSAAKHFVASCLVKNPKNRPSAVELLNSEFVTNLQ 275

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 75/274 (27%), Positives = 123/274 (44%), Gaps = 29/274 (10%)

Query: 27  YLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLKGKPHVV 86
           +L  GGFA+ +Q   +         +A L   I  EK+    L +E++  + +K   ++V
Sbjct: 88  FLGEGGFARCFQFNDDSGKIFAAKTVAKLS--IKSEKTR-RKLLSEIQIHKSMKN-VNIV 143

Query: 87  GYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIV 146
            +ID         D T  V  L+E CP G L+D +  R    L E EV     Q+   I 
Sbjct: 144 QFIDC------FEDDT-NVYILLEICPNGSLMDLLKKR--KSLTEPEVRFFTTQICGAIK 194

Query: 147 AMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTT 206
            MHS    +IHRD+K+ N+    +   K+ DFG  + +     N  E  +         T
Sbjct: 195 YMHSRR--VIHRDLKLGNIFFDKDYNLKIGDFGLAAVL----ANDRERKYTV-----CGT 243

Query: 207 AQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAILH----ARYQYP 262
             Y  PE+L + +    + + DIW++GV LY +     PF++     I        + +P
Sbjct: 244 PNYIAPEVL-MGKHTGHSYEVDIWSIGVMLYALLIGKPPFQSKDVNTIYERIKCCDFTFP 302

Query: 263 QYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEV 296
           +    S   K LI+ +L   P +RP+V ++++ V
Sbjct: 303 KDKYISPEAKILIQDLLSLDPLERPSVDEIIDYV 336

>YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}
           HSL1Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints; associates with
           the assembled septin filament; required along with Hsl7p
           for bud neck recruitment, phosphorylation, and
           degradation of Swe1p
          Length = 1518

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 55/200 (27%), Positives = 99/200 (49%), Gaps = 31/200 (15%)

Query: 104 EVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIE 163
           E+  ++E+  GG L D++ ++   +L E E ++   Q+ +G+   HS N  + HRD+K E
Sbjct: 188 ELYLVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQIVEGVSYCHSFN--ICHRDLKPE 243

Query: 164 NVLISS-NGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTA--QYRCPEML--DLY 218
           N+L+   N   K+ DFG ++ +  P K           ++K +     Y  PE++    Y
Sbjct: 244 NLLLDKKNRRIKIADFG-MAALELPNK-----------LLKTSCGSPHYASPEIVMGRPY 291

Query: 219 RGQPINEKSDIWALGVFLYKICYYTTPFENGGERAIL----HARYQYPQYPMYSSRLKNL 274
            G P    SD+W+ G+ L+ +     PF +   + +L      +YQ P     SS  ++L
Sbjct: 292 HGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPSN--LSSEARDL 345

Query: 275 IRMMLMEKPEQRPNVCQVLE 294
           I  +L+  PE+R    ++L+
Sbjct: 346 ISKILVIDPEKRITTQEILK 365

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 79/287 (27%), Positives = 128/287 (44%), Gaps = 38/287 (13%)

Query: 27  YLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLKGKPH-- 84
           +L  GGFA+ +Q++ +         +A  K  I  EK    T +  +  +Q+ K   H  
Sbjct: 84  FLGEGGFARCFQIKDDSGKIFAAKTVA--KISIKSEK----TRKKLLSEIQIHKSMRHFN 137

Query: 85  VVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQG 144
           +V +ID         D T  V  L+E CP G L+D +  R    L E EV     Q+   
Sbjct: 138 IVQFIDC------FEDDT-NVYILLEICPNGSLMDLLKRR--KVLTEPEVRFFTTQIVGA 188

Query: 145 IVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKN 204
           +  MHS    +IHRD+K+ N+    +   K+ DFG  + +          N  ++     
Sbjct: 189 VKYMHSRR--VIHRDLKLGNIFFDKHYNLKIGDFGLAAVLA---------NDRERKYTVC 237

Query: 205 TTAQYRCPEML-DLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAILHAR----- 258
            T  Y  PE+L   + G   + + DIW+ GV +Y +     PF+   E  I++ R     
Sbjct: 238 GTPNYIAPEVLTGKHTGH--SYEVDIWSCGVMIYALLIGKPPFQ-AKEVNIIYERIKCGD 294

Query: 259 YQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQGIPCP 305
           Y +P+    S     LIR +L   P +RP++ ++++ V   +GI  P
Sbjct: 295 YVFPRDKCISQEALTLIRDILSIDPLERPSLDEIIDYV-WFRGIFPP 340

>SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {ON}
           weakly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141C Hypothetical ORF
          Length = 919

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/208 (28%), Positives = 103/208 (49%), Gaps = 36/208 (17%)

Query: 104 EVLQ-------LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLI 156
           EVLQ       ++E+  GG    ++  +   RLKE     +  Q+  G+  MHS    L+
Sbjct: 115 EVLQNSKYIGIVLEYASGGEFYRYIQKK--RRLKEHAACRLFAQLISGVHYMHSKG--LV 170

Query: 157 HRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQ--YRCPEM 214
           HRD+K+EN+L+  N    + DFG V+          EFN  + ++MK +     Y  PE+
Sbjct: 171 HRDLKLENLLLDKNENLLITDFGFVN----------EFNH-KNELMKTSCGSPCYAAPEL 219

Query: 215 LDLYRGQPIN-EKSDIWALGVFLYKICYYTTPFENGGE-------RAILHARYQYP-QYP 265
             +   +P    K+DIW+ GV +Y +     P+++  E         + H   + P ++P
Sbjct: 220 --VVTTKPYEARKADIWSCGVIMYAMLAGYLPWDDDSENPEGDDIAKLYHYITKTPLKFP 277

Query: 266 MYSSRL-KNLIRMMLMEKPEQRPNVCQV 292
            Y + + ++L+R +L+  P++R N+ QV
Sbjct: 278 EYINPVPRDLLRRILVSNPKKRLNLRQV 305

>KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2.479
           YKL101W
          Length = 1448

 Score = 79.7 bits (195), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 60/232 (25%), Positives = 110/232 (47%), Gaps = 35/232 (15%)

Query: 69  LRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNR 128
           +  E+  M+L+   P+V+G  +    +S       E+  ++E+  GG L D++ +R   +
Sbjct: 166 IEREIVIMKLI-SHPNVMGLYEVWENKS-------ELFLVLEYVDGGELFDYLVSR--GK 215

Query: 129 LKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSN-GEYKVCDFGSVSGIIRP 187
           L E E ++   Q+ +G+   HS N  + HRD+K EN+L+       K+ DFG ++ +  P
Sbjct: 216 LSEREAVHYFKQIIEGVSYCHSFN--ICHRDLKPENLLLDKKINTIKIADFG-MAALELP 272

Query: 188 PKNTEEFNFVQQDIMKNTTAQYRCPEML--DLYRGQPINEKSDIWALGVFLYKICYYTTP 245
            K           +    +  Y  PE++    Y G P    SD+W+ G+ L+ +     P
Sbjct: 273 NKLL---------VTSCGSPHYASPEIVMGKSYHGSP----SDVWSCGIILFALLTGHLP 319

Query: 246 FENGGERAIL----HARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVL 293
           F +   + +L      ++Q PQ    S   ++LI  +L+  PE+R  +  +L
Sbjct: 320 FNDDSIKKLLLKVQSGKFQMPQN--ISLEAEDLISRILVVDPEKRIQINDIL 369

>Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W
           (REAL)
          Length = 1076

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 61/222 (27%), Positives = 105/222 (47%), Gaps = 27/222 (12%)

Query: 69  LRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNR 128
           ++ E++ +  LK  P++  Y  S    +        +  LME+C GG L   +      +
Sbjct: 66  VQREIQFLASLKQMPNITRYYGSYLKDT-------SLWILMEYCAGGSLRSLLR---PGK 115

Query: 129 LKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPP 188
           + E  +  IM ++   +  +H  N  +IHRDIK  NVLI++ G  K+CDFG  + +    
Sbjct: 116 IDEKYIGVIMRELLVALKCIHKDN--VIHRDIKAANVLITNEGSVKLCDFGVAAQV---- 169

Query: 189 KNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPF-E 247
               + +  +Q +    T  +  PE+  +  G   + K DIW+LG+  Y+I     P+ +
Sbjct: 170 ---NQTSLRRQTMAG--TPYWMAPEV--IMEGVYYDTKVDIWSLGITTYEIATGNPPYCD 222

Query: 248 NGGERA---ILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQR 286
               RA   I+ ++    +   YSS LK  I + L E P++R
Sbjct: 223 VEALRAMQLIIKSKPPRLEGRSYSSSLKEFIALCLDEDPKER 264

>TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1.271
            YJL095W
          Length = 1434

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 69/279 (24%), Positives = 126/279 (45%), Gaps = 41/279 (14%)

Query: 31   GGFAQIYQVQVNPPNPINGMNLACLKRVIVPE-----KSGLNTLRAEVEAMQLLKGKPH- 84
            G F  ++ + +N    I    +  +K++ VP      ++ LNT+ A    +  LK   H 
Sbjct: 1144 GSFGAVF-LSLN----ITTGEMMAVKQIEVPSYGSQSETMLNTVEAMKSEVSTLKDLDHL 1198

Query: 85   -VVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQ 143
             +V Y+      +I     Y +   +E+  GG +   +  R+  R  +  + ++ NQV +
Sbjct: 1199 NIVQYLGFEMKHNI-----YSLF--LEYVAGGSVGSLI--RMYGRFDDKLIRHLTNQVLE 1249

Query: 144  GIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMK 203
            G+  +HS    ++HRD+K +N+L+  +G  K+ DFG +S      K +E+  +   ++  
Sbjct: 1250 GLSYLHSQG--ILHRDMKADNLLLDQDGICKISDFG-IS------KKSEDI-YSNSEMTM 1299

Query: 204  NTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAILHARYQYPQ 263
              T  +  PEM+D  +G   N K DIW+LG  + ++     P+ N      ++   Q   
Sbjct: 1300 RGTVFWMAPEMVDTKQG--YNAKVDIWSLGCVVLEMFAGKRPWSNFEVVTAMYKIGQSKS 1357

Query: 264  YP--------MYSSRLKNLIRMMLMEKPEQRPNVCQVLE 294
             P        + S   KN +       P++RP   Q+LE
Sbjct: 1358 APPIPEDTKDLISPTAKNFLNQCFHIDPKERPTAGQLLE 1396

>KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON}
           Anc_4.384 YHR205W
          Length = 775

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 67/285 (23%), Positives = 126/285 (44%), Gaps = 33/285 (11%)

Query: 8   NYDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLN 67
           NY    K + G     +++ L  G F Q+YQV+      I  M +   K+VIV +    +
Sbjct: 354 NYSSIKKRHYGPQDFEVLRLLGKGTFGQVYQVRKKDTKRIYAMKVLS-KKVIVKKNEVAH 412

Query: 68  TLRAEVEAMQLLKGK--PHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRL 125
           T+  E   +    G   P +VG          S     ++  + ++  GG L  F + + 
Sbjct: 413 TI-GERNILATTAGDSCPFIVGL-------KFSFQTPADLYLVTDYMSGGEL--FWHLQK 462

Query: 126 QNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGII 185
           + R  E+     + ++   +  +H  +  +++RD+K EN+L+ +NG   +CDFG     +
Sbjct: 463 EGRFAEYRAKFYIAELVLALEYLH--DNDIVYRDLKPENILLDANGNIALCDFGLSKADL 520

Query: 186 RPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTP 245
           +   NT    F         T +Y  PE+L    G    +  D W+LGV ++++C   +P
Sbjct: 521 KDRTNT----FCG-------TTEYLAPELLLDETG--YTKMVDFWSLGVLIFEMCCGWSP 567

Query: 246 -FENGGER---AILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQR 286
            F    +R    I   + ++P+  + S   ++ ++ +L   P+ R
Sbjct: 568 FFAEDNQRMYQKIAFGKVKFPR-DVLSPEGRSFVKGLLNRNPKHR 611

>CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q01919 Saccharomyces cerevisiae YOR233w KIN4
           ser/thr protein kinase or and similar to uniprot|Q03002
           Saccharomyces cerevisiae YPL141c
          Length = 661

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 62/240 (25%), Positives = 113/240 (47%), Gaps = 38/240 (15%)

Query: 104 EVLQ-------LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLI 156
           EVLQ       ++E+  GG    ++  + + RLKE     +  Q+  G+  MHS N  L+
Sbjct: 120 EVLQNSKYIGIVLEYASGGEFYKYI--QRKRRLKESTACRLFAQLISGVTYMHSKN--LV 175

Query: 157 HRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQ--YRCPEM 214
           HRD+K+EN+L+  N    + DFG V+  +  P N         + MK +     Y  PE+
Sbjct: 176 HRDLKLENLLLDKNENLVITDFGFVNEFL--PDN---------EYMKTSCGSPCYAAPEL 224

Query: 215 LDLYRGQPINEKSDIWALGVFLYKICYYTTPFENGG---ERAILHARYQYP-----QYPM 266
           +   R   +  K+D+W+ G+ LY +     P+++     E   +   YQY      ++P 
Sbjct: 225 VISTRPY-VARKADVWSCGIILYAMLAGYLPWDDDSTNPEGDDIGKLYQYITRTPLKFPE 283

Query: 267 YSSRL-KNLIRMMLMEKPEQRPNVCQVLEEVSSMQGIPCPLPNFYLQRQQATQLMMNNTN 325
           Y + + ++L+R +L+  P +R N    ++ +   + +    P   +   Q  +L+ N+ N
Sbjct: 284 YITPIPRDLLRKILVPDPNKRVN----MQYIHRHEWLKPHRPFLAVSTSQWDKLIKNSAN 339

>CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa] {ON}
            similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095w BCK1
          Length = 1447

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 76/282 (26%), Positives = 128/282 (45%), Gaps = 47/282 (16%)

Query: 31   GGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAE-VEAMQ----LLKGKPH- 84
            G F  +Y + +N    I    +  +K+V VP+    N L  + VEA++     LK   H 
Sbjct: 1160 GSFGAVY-LSLN----ITTGEMMAVKQVEVPKYGTQNELVKDMVEALKSEVATLKDLDHL 1214

Query: 85   -VVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQ 143
             +V Y+ S    +I     Y +   +E+  GG +   +  RL  R  E  + ++  QV  
Sbjct: 1215 NIVQYLGSEIRGNI-----YSLF--LEYVAGGSVGSLI--RLYGRFDEKLIRHLNTQVLS 1265

Query: 144  GIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMK 203
            G+  +HS    ++HRD+K +N+L+  +G  K+ DF    GI +  KN     +   D+  
Sbjct: 1266 GLKYLHSKG--ILHRDMKADNLLLDEDGICKISDF----GISKKSKNI----YSNSDMTM 1315

Query: 204  NTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAILHARYQY-- 261
              T  +  PEM+D  +G   + K DIW+LG  + ++     P+ N     ++ A +Q   
Sbjct: 1316 RGTVFWMAPEMVDTKQG--YSAKVDIWSLGCVVLEMFAGKRPWSN---LEVVAAMFQIGK 1370

Query: 262  ----PQYP-----MYSSRLKNLIRMMLMEKPEQRPNVCQVLE 294
                P  P     + SS+ K+ +       PE+RP    +LE
Sbjct: 1371 SKSAPPIPDDTIQLISSKGKDFLSKCFEIDPEKRPTADDLLE 1412

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/207 (28%), Positives = 96/207 (46%), Gaps = 34/207 (16%)

Query: 101 GTYEVLQ-------LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNP 153
           G YEV +       ++E+  GG L D++ +R   RL E E ++   Q+ QG+   H+ N 
Sbjct: 180 GLYEVWENKSELYLVLEYVDGGELFDYLVSR--GRLCEREAVHYFKQIIQGVSYCHAFN- 236

Query: 154 PLIHRDIKIENVLISS-NGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCP 212
            + HRD+K EN+L+   N   K+ DFG  +         E  N + Q      +  Y  P
Sbjct: 237 -ICHRDLKPENLLLDKKNSTIKIADFGMAA--------LEVSNKLLQ--TSCGSPHYASP 285

Query: 213 EML--DLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAIL----HARYQYPQYPM 266
           E++    Y G P    SD+W+ G+ L+ +     PF +   + +L      +YQ PQ   
Sbjct: 286 EIVMGKQYHGGP----SDVWSCGIILFALLTGHLPFNDDSIKKLLLKVQSGKYQMPQN-- 339

Query: 267 YSSRLKNLIRMMLMEKPEQRPNVCQVL 293
            S   ++LI  +L   P +R    ++L
Sbjct: 340 LSKEAQDLIAKILTVNPAKRLTTEEIL 366

>SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102W KIC1 Protein kinase of the PAK/Ste20 kinase
           family required for cell integrity possibly through
           regulating 1 6-beta-glucan levels in the wall physically
           interacts with Cdc31p (centrin) which is a component of
           the spindle pole body
          Length = 885

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 61/225 (27%), Positives = 107/225 (47%), Gaps = 33/225 (14%)

Query: 69  LRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNR 128
           ++ E++ +  LK  P++  Y  S    +       ++  +ME+C GG L   +      +
Sbjct: 69  VQKEIQFLSSLKQVPNITHYYGSYLYDT-------KLWIIMEYCAGGSLRTLLR---PGK 118

Query: 129 LKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPP 188
           + E  +  IM ++   ++ +H  N  +IHRDIK  NVLI+++G  K+CDFG  +      
Sbjct: 119 IDEKYIGVIMRELLVALLYIHKDN--VIHRDIKAANVLITNDGRVKLCDFGVAA------ 170

Query: 189 KNTEEFNFVQQDIMKNTTAQ---YRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTP 245
                    Q ++ + T A    +  PE+  +  G   + K DIW+LG+  Y+I     P
Sbjct: 171 ------QLTQSNVRRQTMAGTPYWMAPEV--IMEGVYYDTKVDIWSLGITTYEITTGNPP 222

Query: 246 F-ENGGERAI-LHARYQYPQYP--MYSSRLKNLIRMMLMEKPEQR 286
           + +    RA+ L  + + P+     YS  LK  I + L E P++R
Sbjct: 223 YCDVEALRAMQLITKSKPPRLEGRQYSPLLKEFIALCLDEDPKER 267

>Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074
           aa] {ON} YHR102W (REAL)
          Length = 1074

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 93/191 (48%), Gaps = 20/191 (10%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLI 167
           +ME+C GG L   +      ++ E  +  IM +V   +  +H  N  +IHRDIK  NVLI
Sbjct: 98  IMEYCAGGSLRSLLR---PGKIDEKYIGVIMREVLVALKCIHKDN--VIHRDIKAANVLI 152

Query: 168 SSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKS 227
           ++ G  K+CDFG  + +        + +  +Q +    T  +  PE+  +  G   + K 
Sbjct: 153 TNEGNVKLCDFGVAAQV-------NQTSLRRQTMAG--TPYWMAPEV--IMEGVYYDTKV 201

Query: 228 DIWALGVFLYKICYYTTPF-ENGGERA---ILHARYQYPQYPMYSSRLKNLIRMMLMEKP 283
           DIW+LG+  Y+I     P+ E    RA   I+ ++    +   YS  LK  I + L E P
Sbjct: 202 DIWSLGITTYEIATGNPPYCEVEALRAMQLIIKSKPPRLEGRSYSPSLKEFIALCLDEDP 261

Query: 284 EQRPNVCQVLE 294
           ++R +   +L+
Sbjct: 262 KERLSADDLLK 272

>TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5.406
           YHR102W
          Length = 1036

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 64/251 (25%), Positives = 119/251 (47%), Gaps = 29/251 (11%)

Query: 62  EKSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFM 121
           E   +  ++ EV+ +  LK  P+++ Y  S    +        +  +M++C GG +   +
Sbjct: 82  ESDEVEDVQREVQFLSSLKQFPNIIRYFGSYLKDT-------NLWIIMDYCAGGSIRTLL 134

Query: 122 NTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSV 181
                 ++ E  +  IM ++   +  +H  N  +IHRDIK  NVL+++ G+ K+CDFG V
Sbjct: 135 R---PGKIDEKYIGIIMREILIALQYIHKDN--VIHRDIKAANVLVTNEGKVKLCDFG-V 188

Query: 182 SGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICY 241
           +  +   K       +++  M   T  +  PE+  +  G   + K+DIW+LG+  Y+I  
Sbjct: 189 AAQLNQTK-------LRRQTMAG-TPYWMAPEV--IMEGAYYDTKADIWSLGITAYEIAT 238

Query: 242 YTTPF-ENGGERA---ILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNV--CQVLEE 295
              P+ E    RA   I  ++    +   YS+ LK  I + L E P++R +    Q  + 
Sbjct: 239 GNPPYCEIEALRAMQLITKSKPARLEGRSYSTSLKEFIALCLDEDPKERLSAEELQKTKF 298

Query: 296 VSSMQGIPCPL 306
           + S + +P  +
Sbjct: 299 IKSQRAVPTTI 309

>Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON}
           (25064..28447) [3384 nt, 1128 aa]
          Length = 1127

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 106/226 (46%), Gaps = 35/226 (15%)

Query: 69  LRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTY----EVLQLMEFCPGGGLIDFMNTR 124
           ++ E++ +  LK  P++  Y            G+Y     +  +ME+C GG L   +   
Sbjct: 87  VQREIQFLASLKQVPNITRYY-----------GSYLQDTNLWIIMEYCAGGSLRTLLRPG 135

Query: 125 LQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGI 184
           +   + E  +  IM ++   +  +H  N  +IHRDIK  NVLI++ G+ K+CDFG  + +
Sbjct: 136 M---IDEKYIGVIMRELLTALQCIHKDN--VIHRDIKAANVLITNEGKVKLCDFGVAAQL 190

Query: 185 IRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTT 244
                   + +  +Q +    T  +  PE+  +  G   + K DIW+LG+  Y+I     
Sbjct: 191 -------NQTSLRRQTMAG--TPYWMAPEV--IMEGVYYDTKVDIWSLGITAYEIATGNP 239

Query: 245 PF-ENGGERA---ILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQR 286
           P+ E    RA   I  ++    +   YSS LK  I + L E P++R
Sbjct: 240 PYCEIEALRAMQLITKSKPARLEGRQYSSGLKEFIALCLDEDPKER 285

>Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL101W
           (REAL)
          Length = 1518

 Score = 79.0 bits (193), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 54/199 (27%), Positives = 100/199 (50%), Gaps = 31/199 (15%)

Query: 104 EVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIE 163
           E+  ++E+  GG L D++ ++   +L E E ++   Q+ +G+   HS N  + HRD+K E
Sbjct: 188 ELYLVLEYVDGGELFDYLVSK--GKLPEREAIHYFKQIVEGVSFCHSFN--ICHRDLKPE 243

Query: 164 NVLISS-NGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNT--TAQYRCPEML--DLY 218
           N+L+   N + K+ DFG ++ +  P K           ++K +  +  Y  PE++    Y
Sbjct: 244 NLLLDKKNRKIKIADFG-MAALELPNK-----------LLKTSCGSPHYASPEIVMGRPY 291

Query: 219 RGQPINEKSDIWALGVFLYKICYYTTPFENGGERAIL----HARYQYPQYPMYSSRLKNL 274
            G P    SD+W+ G+ L+ +     PF +   + +L      +YQ P     S+  ++L
Sbjct: 292 HGGP----SDVWSCGIVLFALLTGHLPFNDDNIKKLLLKVQSGKYQMPMN--LSAEARDL 345

Query: 275 IRMMLMEKPEQRPNVCQVL 293
           I  +L+  PE+R    ++L
Sbjct: 346 ISKILVINPEKRITTQEIL 364

>CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {ON}
           similar to uniprot|P41808 Saccharomyces cerevisiae
           YPR054w SMK1 sporulation-specific MAP kinase or
           uniprot|Q00772 Saccharomyces cerevisiae YHR030c SLT2
           ser/thr
          Length = 432

 Score = 77.4 bits (189), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 78/321 (24%), Positives = 127/321 (39%), Gaps = 69/321 (21%)

Query: 24  IIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRV--IVPEKSGLNTLRAEVEAMQLLKG 81
           II+ L  G +  +   +    N         +K++  I   K  L     E++ M   KG
Sbjct: 71  IIQVLGKGSYGVVCSAKHKLDNEDQEQFTVAIKKITNIFYRKILLKRAIREIKFMNYFKG 130

Query: 82  KPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQV 141
             H+V  ID    +    DG Y   +L+++     L   +++ +Q  L EF + + + Q+
Sbjct: 131 HKHIVNLIDIEIVQDKPYDGLYCYQELIDY----DLARVIHSSVQ--LSEFHIQHFIYQI 184

Query: 142 TQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNT-----EEFNF 196
             G+  +HS +  +IHRD+K  N+L + NG  K+CDFG   G+ +   N      E  N+
Sbjct: 185 LCGVKYIHSAD--VIHRDLKPGNILCTVNGCLKICDFGLARGVAKQFVNKNSKPNEITNY 242

Query: 197 VQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAILH 256
           V        T  YR PE+  +       +  D+W++G  L +  Y   P   G +   +H
Sbjct: 243 V-------ATRWYRAPEL--ILSNNEYTKSVDMWSVGCILAEF-YGRRPIFMGKDS--IH 290

Query: 257 ARYQYPQ------------------------------------------YPMYSSRLKNL 274
             Y+  +                                          YPM S+   +L
Sbjct: 291 QVYEIKKILGTPSRSLLVKYGTLKAWNLFGHNSNHNLDNLKSGMPWSTVYPMASATALDL 350

Query: 275 IRMMLMEKPEQRPNVCQVLEE 295
           I  +L  +PE R NV Q LE 
Sbjct: 351 IDKLLQWEPESRLNVLQSLEH 371

>TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {ON}
           Anc_8.654 YPL141C
          Length = 1208

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 66/261 (25%), Positives = 127/261 (48%), Gaps = 48/261 (18%)

Query: 60  VPEKSGLNTLRAEVEAMQLLKGKPHVVG-YIDSNAARSISNDGTY---EVLQ-------L 108
           VP++  +  +R +     ++KG    +  Y + NA + +++       EVLQ       +
Sbjct: 100 VPKQVAIKLIRRDA----IVKGSEKEIKIYREINALKHLTHPNIVRLEEVLQNSKYIGIV 155

Query: 109 MEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLIS 168
           +E+  GG    ++  + + RLKE    N+ +Q+  G+  MH     L+HRD+K+EN+L+ 
Sbjct: 156 LEYASGGEFYKYI--QKKRRLKESVASNLFSQLVSGVYYMHCKG--LVHRDLKLENLLLD 211

Query: 169 SNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQ--YRCPEMLDLYRGQPINEK 226
             G   + DFG V+          EF+   + +MK +     Y  PE++   R      K
Sbjct: 212 KYGNLIITDFGFVN----------EFSKFSE-LMKTSCGSPCYAAPELVISTRPYEA-RK 259

Query: 227 SDIWALGVFLYKICYYTTPFE------NGGERAILHARY------QYPQYPMYSSRLKNL 274
           +DIW+ G+ L+ +     P++      +G + A L+ +Y      ++P+Y   S   ++L
Sbjct: 260 ADIWSCGIILFAMLAGYLPWDDDPKNPDGNDIAKLY-KYITTTPLKFPEY--ISPMARDL 316

Query: 275 IRMMLMEKPEQRPNVCQVLEE 295
           +R +L+  P++R  + Q+L+ 
Sbjct: 317 LRNILIPYPQKRATLKQILKH 337

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 73/277 (26%), Positives = 122/277 (44%), Gaps = 33/277 (11%)

Query: 26  KYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLKGKPH- 84
           ++L  GGFA+ +Q++           +A  K  I  EK    T R  +  +Q+ K   H 
Sbjct: 146 QFLGEGGFARCFQIKDESGKIFAAKTVA--KISIKTEK----TRRKLLSEIQIHKSMKHQ 199

Query: 85  -VVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQ 143
            +V ++D         +    V  L+  CP G L++ +  R    L E EV     Q+  
Sbjct: 200 NIVQFVDCF-------EDHINVYILLGMCPNGSLMELLKKR--KILTEPEVRFFTVQICG 250

Query: 144 GIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMK 203
            I  MHS    +IHRD+K+ N+    N   K+ DFG  + +          N  ++    
Sbjct: 251 AIKYMHSRR--VIHRDLKLGNIFFDENYNLKIGDFGLAAVLA---------NDRERKYTV 299

Query: 204 NTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPFE----NGGERAILHARY 259
             T  Y  PE+L L +    + + DIW++GV ++ +     PF+    N     I ++ Y
Sbjct: 300 CGTPNYIAPEVL-LGKHSGHSYEVDIWSIGVMIFALLIGKPPFQAKDVNTIYSRIKNSEY 358

Query: 260 QYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEEV 296
            +P     S   K LI+ +L+  P  RP++ +++E V
Sbjct: 359 TFPINKSISQEAKTLIQDILINDPIARPSINEIMEYV 395

>Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}
           complement(4365..7655) [3291 nt, 1097 aa]
          Length = 1096

 Score = 78.2 bits (191), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 103/202 (50%), Gaps = 35/202 (17%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLN------IMNQVTQGIVAMHSLNPPLIHRDIK 161
           L+E+ P G   DF++      +K+F  +N         Q+   I  +HS    +IHRDIK
Sbjct: 288 LLEYAPNG---DFLSL-----IKKFGSMNEDCASYYSAQIIDAIHFVHSRG--IIHRDIK 337

Query: 162 IENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNT-----TAQYRCPEML- 215
            EN+L+ S  + K+ DFG+ + I+ P  ++        D++  +     TA+Y  PE+L 
Sbjct: 338 PENILLDSEMKVKLTDFGT-AKILEPKSSSSSSKHETYDLLTRSKSFVGTAEYVSPELLN 396

Query: 216 DLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGE----RAILHARYQYPQ-YPMYSSR 270
           D Y     + + DIWA G  ++++     PF+   E    + ++  +Y +   +P+    
Sbjct: 397 DSY----ADSRCDIWAFGCIVFQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPLV--- 449

Query: 271 LKNLIRMMLMEKPEQRPNVCQV 292
           +++L++ +L++ PEQR  + Q+
Sbjct: 450 IRDLVKRILIKAPEQRLTISQI 471

>NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON}
           Anc_4.384
          Length = 749

 Score = 77.8 bits (190), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 66/283 (23%), Positives = 126/283 (44%), Gaps = 31/283 (10%)

Query: 9   YDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNT 68
           Y    K + G +   +++ L  G F Q+YQV+      I  M +   K+VIV +    +T
Sbjct: 331 YSSTKKRHYGPNDFEVLRLLGKGTFGQVYQVKKKDTKRIYAMKVLS-KKVIVKKNEVAHT 389

Query: 69  L-RAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQN 127
           +    +      K  P +VG          S     ++  + +F  GG L  F + + + 
Sbjct: 390 IGERNILVTTATKASPFIVGL-------KFSFQTPTDLYLVTDFMSGGEL--FWHLQKEG 440

Query: 128 RLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRP 187
           R  E      + ++   +  +H  +  +++RD+K EN+L+ +NG   +CDFG     ++ 
Sbjct: 441 RFTEERAKFYIAELVLALEYLHDND--IVYRDLKPENILLDANGNIALCDFGLSKADLKD 498

Query: 188 PKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPF- 246
             NT    F         T +Y  PE+L    G    +  D W+LGV ++++C   +PF 
Sbjct: 499 RTNT----FCG-------TTEYLAPELLLDEAG--YTKMVDFWSLGVLIFEMCCGWSPFF 545

Query: 247 -ENGGE--RAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQR 286
            E+  +  + I   + ++P+  + S   ++ ++ +L   P+ R
Sbjct: 546 AEDNQKMYQKIAFGKVKFPR-DVLSPEGRSFVKGLLNRNPKHR 587

>YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON}
           FRK1Protein kinase of unknown cellular role; similar to
           Kin4p; green fluorescent protein (GFP)-fusion protein
           localizes to the cytoplasm; interacts with rRNA
           transcription and ribosome biogenesis factors and the
           long chain fatty acyl-CoA synthetase Faa3
          Length = 865

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 60/208 (28%), Positives = 102/208 (49%), Gaps = 36/208 (17%)

Query: 104 EVLQ-------LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLI 156
           EVLQ       ++E+  GG    ++  +   RLKE     + +Q+  G+  +HS    L+
Sbjct: 117 EVLQNSRYIGIVLEYACGGEFYKYIQKK--RRLKEMNACRLFSQLISGVHYIHSKG--LV 172

Query: 157 HRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQ--YRCPEM 214
           HRD+K+EN+L+  N    + DFG V+          EF   + ++MK +     Y  PE+
Sbjct: 173 HRDLKLENLLLDKNENLVITDFGFVN----------EF-CSRNELMKTSCGSPCYAAPEL 221

Query: 215 LDLYRGQPIN-EKSDIWALGVFLYKICYYTTPFE---NGGERAILHARYQYP-----QYP 265
             +   +P    K+DIW+ GV LY I     P++   N  E + +   Y Y      ++P
Sbjct: 222 --VISAEPYEARKADIWSCGVILYAILAGYLPWDDDPNNPEGSDIGRLYNYINSTPLKFP 279

Query: 266 MYSSRL-KNLIRMMLMEKPEQRPNVCQV 292
            Y   + ++L+R ML+  P++R N+ Q+
Sbjct: 280 DYILPIPRDLLRRMLVSDPKKRINLKQI 307

>KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakly
           similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101W HSL1 Nim1p-related protein kinase that regulates
           the morphogenesis and septin checkpoints associates with
           the assembled septin filament required along with Hsl7p
           for bud neck recruitment phosphorylation and degradation
           of Swe1p
          Length = 1128

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 96/207 (46%), Gaps = 34/207 (16%)

Query: 101 GTYEVLQ-------LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNP 153
           G YEV +       ++E+  GG L D++ +R   RL E E ++   Q+ +G    HS N 
Sbjct: 121 GLYEVWENKLELFLVLEYVDGGELFDYLVSR--GRLSEKEAIHYFRQIIEGTAYCHSFN- 177

Query: 154 PLIHRDIKIENVLISS-NGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCP 212
            + HRD+K EN+L+   N   K+ DFG ++ +    K  E             +  Y  P
Sbjct: 178 -ICHRDLKPENLLLDKKNKRIKIADFG-MAALQTSNKLLE---------TSCGSPHYASP 226

Query: 213 EML--DLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAIL----HARYQYPQYPM 266
           E++    Y G P    SD+W+ G+ L+ +     PF +   + +L      +YQ PQ   
Sbjct: 227 EIVMGKTYNGGP----SDVWSCGIILFALLTGHLPFNDDNIKRLLLKVQAGKYQMPQ--A 280

Query: 267 YSSRLKNLIRMMLMEKPEQRPNVCQVL 293
            S   ++LI  +L+  P +R  +  +L
Sbjct: 281 ISLEAQDLISRILVVDPNKRITINDIL 307

>Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C -
           Hypothetical ORF [contig 67] FULL
          Length = 829

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 98/211 (46%), Gaps = 38/211 (18%)

Query: 104 EVLQ-------LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLI 156
           EVLQ       ++E+  GG    ++  +   RLKE     +  Q+  G+  MHS    L+
Sbjct: 112 EVLQNSKYIGIVLEYASGGEFYKYIQKK--RRLKEGPACRLFAQLISGVYYMHSKG--LV 167

Query: 157 HRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQ--YRCPEM 214
           HRD+K+EN+L+  N    + DFG V+  +  P+N         ++MK +     Y  PE+
Sbjct: 168 HRDLKLENLLLDKNENLLITDFGFVNEFL--PEN---------ELMKTSCGSPCYAAPEL 216

Query: 215 LDLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGE-----------RAILHARYQYPQ 263
           +   R      K+D+W+ GV LY +     P+++  E           R I     ++P 
Sbjct: 217 VVTARPYEA-RKADVWSCGVILYAMLAGYLPWDDDPENPDGDDIGKLYRYITRTPLKFPD 275

Query: 264 YPMYSSRLKNLIRMMLMEKPEQRPNVCQVLE 294
           Y     R  +L+R +L+  P++R  + + L+
Sbjct: 276 YIAPVPR--DLLREILIPDPKRRITISKTLK 304

>Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON}
           YHL007C (REAL)
          Length = 923

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 69/277 (24%), Positives = 123/277 (44%), Gaps = 50/277 (18%)

Query: 30  SGGFAQIYQVQVNPPNPINGMNLA--CLKRVIVPEKSGLNTLRAEVEAMQLLKGK--PHV 85
           SGG    Y++  N    I  MNL     K +I+ E             + ++KG   P++
Sbjct: 610 SGGVYTAYEIGTNVSVAIKQMNLEKQPKKELIINE-------------ILVMKGSKHPNI 656

Query: 86  VGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGI 145
           V +IDS   +        ++  +ME+  GG L D +   +   L E ++  +  +   G+
Sbjct: 657 VNFIDSYVLKG-------DLWVIMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLSGL 706

Query: 146 VAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNT 205
             +HS    ++HRDIK +N+L+S  G+ K+ DFG  + I        E N  +  ++   
Sbjct: 707 KFLHSKG--VLHRDIKSDNILLSMEGDIKLTDFGFCAQI-------NELNLKRTTMVG-- 755

Query: 206 TAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAILH-------AR 258
           T  +  PE++      P   K DIW+LG+ + ++     P+ N      L+        +
Sbjct: 756 TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPK 812

Query: 259 YQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEE 295
            + P+    SS LK  +   L  +PE+R +  ++L +
Sbjct: 813 LKEPEN--LSSSLKKFLDWCLCVEPEERASATELLHD 847

>Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON}
           (82874..86551) [3678 nt, 1226 aa]
          Length = 1225

 Score = 77.8 bits (190), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 102/209 (48%), Gaps = 28/209 (13%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLI 167
           L E+  GG L+D++       L+E         +   +  +H+ N  ++HRD+KIEN++I
Sbjct: 247 LFEYVSGGQLLDYIIQ--HGSLREHHARRFARGIASALQYLHANN--IVHRDLKIENIMI 302

Query: 168 SSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDL--YRGQPINE 225
           S++GE K+ DFG +S +    K    F           +  +  PE+L    Y G  +  
Sbjct: 303 STSGEIKLIDFG-LSNLYDNRKQLHTF---------CGSLYFAAPELLKANPYTGPEV-- 350

Query: 226 KSDIWALGVFLYKICYYTTPFENGGERAILH-----ARYQYPQYPMYSSRLKNLIRMMLM 280
             D+W+ GV LY +     PF++    ++LH      + +Y Q+   S  + +L+  ML+
Sbjct: 351 --DVWSFGVVLYVLVCGKVPFDDENS-SVLHEKIKQGKVEYSQH--LSIEVISLLSKMLV 405

Query: 281 EKPEQRPNVCQVLEEVSSMQGIPCPLPNF 309
             P++R ++ QV++    ++G     P++
Sbjct: 406 VDPKRRASLKQVVDHHWMVRGYDTAPPSY 434

>NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141
          Length = 905

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 82/332 (24%), Positives = 134/332 (40%), Gaps = 75/332 (22%)

Query: 13  TKLNVGIHQVSIIKYLTSGGFAQIYQVQ-VNPPNP-----------INGMNLACLKRVIV 60
           T + VG  +  + K +  G FA +++   + P +P           IN  N  C    IV
Sbjct: 29  TTIYVGSDRYIVDKEIGKGSFATVHRAHLITPTSPHLHQSVVDSSSIN--NPTCFAIKIV 86

Query: 61  PE-----KSGLNTLRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGG 115
           P      K  L  L  E+  ++ +   PH+V  ID           + +   +ME+C  G
Sbjct: 87  PRSKLKNKKLLENLEIEIAILKKI-SHPHIVKLIDFERT-------SKDFYLIMEYCSLG 138

Query: 116 GLIDFMNTRLQ----------------------NRLKEFEVLNIMNQVTQGIVAMHSLNP 153
            L   +  R Q                      N L +  +LN + Q++  +  + S N 
Sbjct: 139 DLTFLIKKRQQLIKNHPLLEKIFKKYPPPNEKYNGLHKAFILNYLQQLSSALKFLRSKN- 197

Query: 154 PLIHRDIKIENVLISS-----NGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQ 208
            L+HRDIK +N+L+S+     N      D G V     P     +F F +   + NT+  
Sbjct: 198 -LVHRDIKPQNLLLSAPLINYNDPKSFHDLGFVGIYNLPILKIADFGFAR--FLPNTSMA 254

Query: 209 --------YRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAILHARYQ 260
                   Y  PE+L+    Q  N K+D+W++G  LY++CY   PF+      +     +
Sbjct: 255 ETLCGSPLYMAPEILNY---QKYNAKADLWSVGTVLYEMCYGNPPFKASNHLELYKKIKK 311

Query: 261 ------YPQYPMYSSRLKNLIRMMLMEKPEQR 286
                 +P Y    + LK+LI  +L   P++R
Sbjct: 312 ANDLIYFPTYIEIDNNLKSLISKLLTFDPQER 343

>SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar to
           uniprot|Q751V1 Ashbya gossypii AFR724C AFR724Cp and some
           similarites with YDR523C uniprot|P08458 Saccharomyces
           cerevisiae YDR523C SPS1 dispensable for mitosis involved
           in middle/late stage of meiosis required for spore wall
           formation serine/threonine kinase homologous to Ste20p
           expressed in middle/late meiosis
          Length = 564

 Score = 77.0 bits (188), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 92/190 (48%), Gaps = 16/190 (8%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLI 167
           +ME+C GG   D +    +  L E +V  I  ++ +G+  +HS     IHRDIK  N+L+
Sbjct: 108 VMEYCGGGSCSDLLKCLPRGTLTEEKVAFITREILRGLEYLHSQRK--IHRDIKAANILL 165

Query: 168 SSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKS 227
           + +G+ K+ DFG VSG +   +  + F           T  +  PE++     Q  NEK+
Sbjct: 166 TDDGKVKLGDFG-VSGQMMATRRRDTF---------VGTPFWMAPEVIARSE-QGYNEKA 214

Query: 228 DIWALGVFLYKICYYTTPFENGGERAILH---ARYQYPQYPMYSSRLKNLIRMMLMEKPE 284
           DIW+LG+ ++++     P        +L    +R        YS  ++  + + L + P 
Sbjct: 215 DIWSLGITVFELLKGQPPLSQHDPMKVLMSIPSRRPPKLEDRYSHAIREFVSLCLNKDPA 274

Query: 285 QRPNVCQVLE 294
           +RP   ++L+
Sbjct: 275 KRPTASELLK 284

>KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1432

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 56/208 (26%), Positives = 100/208 (48%), Gaps = 34/208 (16%)

Query: 101 GTYEVLQ-------LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNP 153
           G +EV +       ++E+  GG L D++ ++   +L E+E ++   Q+ +G+   HS N 
Sbjct: 179 GLFEVWENKNDLFLVLEYVDGGELFDYLVSK--GKLPEWEAVHYFKQIIEGVAFCHSYN- 235

Query: 154 PLIHRDIKIENVLISS-NGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCP 212
            + HRD+K EN+L+   N   K+ DFG ++ +  P K  E             +  Y  P
Sbjct: 236 -ICHRDLKPENLLLDKKNKIIKIADFG-MAALELPNKLLE---------TSCGSPHYASP 284

Query: 213 EML--DLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAIL----HARYQYPQYPM 266
           E++    Y G P    SD+W+ G+ L+ +     PF +   R +L      R++ P+   
Sbjct: 285 EIVMGKPYHGGP----SDVWSCGIILFALLTGHLPFNDDNIRKLLLKVQSGRFRLPRN-- 338

Query: 267 YSSRLKNLIRMMLMEKPEQRPNVCQVLE 294
            S   ++LI  +L+  P QR  +  +L+
Sbjct: 339 ISLEAQDLIAKILVVNPRQRIKISDILK 366

>ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {ON}
           weakly similar to uniprot|Q03497 Saccharomyces
           cerevisiae YHL007C STE20 Signal transducing kinase of
           the PAK (p21-activated kinase) family involved in
           pheromone response and pseudohyphal/invasive growth
           pathways activated by Cdc42p binds Ste4p at a GBB motif
           present in noncatalytic domains of PAK kinases
          Length = 963

 Score = 77.4 bits (189), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 79/288 (27%), Positives = 126/288 (43%), Gaps = 55/288 (19%)

Query: 30  SGGFAQIYQVQVNPPNPINGMNLA--CLKRVIVPEKSGLNTLRAEVEAMQLLKGKPH--V 85
           SGG    Y++  N    I  MNL     K +I+ E             + ++KG  H  +
Sbjct: 666 SGGVYTAYELGTNASVAIKQMNLEKQPKKELIINE-------------IMVMKGSKHRNI 712

Query: 86  VGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGI 145
           V +IDS   +        ++  +ME+  GG L D +   +   L E ++  +  +   G+
Sbjct: 713 VNFIDSYLLKG-------DLWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLAGL 762

Query: 146 VAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNT 205
             +HS    +IHRDIK +N+L+S  GE K+ DFG  + I        E N  +  ++   
Sbjct: 763 QFLHSKG--VIHRDIKSDNILLSMTGEIKLTDFGFCAQI-------NEINLKRTTMVG-- 811

Query: 206 TAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGE-RAI-LHARYQYPQ 263
           T  +  PE++      P   K DIW+LG+ + ++     P+ N    RA+ L A    P+
Sbjct: 812 TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPK 868

Query: 264 YPM---YSSRLKNLIRMMLMEKPEQR---------PNVCQVLEEVSSM 299
                     L+N +   L  +P+QR         P V QV EE SS+
Sbjct: 869 LKEPDNLGEELQNFLDWCLTVEPDQRASSSQLLKDPFVTQVAEENSSL 916

>Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON}
           YHL007C (REAL)
          Length = 939

 Score = 77.4 bits (189), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 69/277 (24%), Positives = 123/277 (44%), Gaps = 50/277 (18%)

Query: 30  SGGFAQIYQVQVNPPNPINGMNLA--CLKRVIVPEKSGLNTLRAEVEAMQLLKGK--PHV 85
           SGG    Y++  N    I  MNL     K +I+ E             + ++KG   P++
Sbjct: 633 SGGVYTAYEIGTNVSVAIKQMNLEKQPKKELIINE-------------ILVMKGSRHPNI 679

Query: 86  VGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGI 145
           V +IDS   +        ++  +ME+  GG L D +   +   L E ++  +  +   G+
Sbjct: 680 VNFIDSYVLKG-------DLWVIMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLSGL 729

Query: 146 VAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNT 205
             +HS    ++HRDIK +N+L+S  G+ K+ DFG  + I        E N  +  ++   
Sbjct: 730 KFLHSKG--VLHRDIKSDNILLSMEGDIKLTDFGFCAQI-------NELNLKRTTMVG-- 778

Query: 206 TAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAILH-------AR 258
           T  +  PE++      P   K DIW+LG+ + ++     P+ N      L+        +
Sbjct: 779 TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPK 835

Query: 259 YQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEE 295
            + P+    SS LK  +   L  +PE+R +  ++L +
Sbjct: 836 LKEPEN--LSSSLKKFLDWCLCVEPEERASATELLHD 870

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score = 77.8 bits (190), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 99/207 (47%), Gaps = 34/207 (16%)

Query: 101 GTYEVLQ-------LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNP 153
           G YEV +       ++E+  GG L D++ +R   RL E E ++   Q+ +G    H  N 
Sbjct: 121 GLYEVWENKLELFLVLEYVDGGELFDYLVSR--GRLPEKEAIHYFRQIIEGTAYCHGFN- 177

Query: 154 PLIHRDIKIENVLISS-NGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCP 212
            + HRD+K EN+L+   N   K+ DFG ++ +    K  E             +  Y  P
Sbjct: 178 -ICHRDLKPENLLLDKKNKRIKIADFG-MAALQTSNKLLE---------TSCGSPHYASP 226

Query: 213 EML--DLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAIL----HARYQYPQYPM 266
           E++    Y G P    SD+W+ G+ L+ +     PF +   + +L      +YQ PQ   
Sbjct: 227 EIVMGKNYNGGP----SDVWSCGIILFALLTGHLPFNDDNIKRLLLKVQAGKYQMPQS-- 280

Query: 267 YSSRLKNLIRMMLMEKPEQRPNVCQVL 293
            SS  ++LI  +L+  P++R ++ ++L
Sbjct: 281 VSSGAQDLISRILVVDPDKRISINEIL 307

>TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]
           {ON} Anc_3.92 YDR490C
          Length = 1347

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 50/192 (26%), Positives = 92/192 (47%), Gaps = 15/192 (7%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLI 167
           L+E+   G L+  +  +      E   +    Q+   I  +HS+   +IHRDIK EN+L+
Sbjct: 337 LLEYASNGDLLTLL--KKYGSFDETSTIYFTAQIIDSIHYIHSMG--IIHRDIKPENILL 392

Query: 168 SSNGEYKVCDFGSVSGI----IRPPKNTEEFNFVQQDIMKNTTAQYRCPEML-DLYRGQP 222
           + + + K+ DFG+   +        ++   FN +++      TA+Y  PE+L D Y    
Sbjct: 393 TKDFKIKLTDFGTAKILDPSQPSQSQSQPHFNLLERSKSFVGTAEYVSPELLTDSY---- 448

Query: 223 INEKSDIWALGVFLYKICYYTTPFENGGERAILHA--RYQYPQYPMYSSRLKNLIRMMLM 280
            + + DIWA G  L+++     PF+   E        + QY     + + L++LI+ +L+
Sbjct: 449 TDSRCDIWAFGCILFQLIAGKPPFKATNEYLTFQKIIKLQYAFTAGFPTILRDLIKKILI 508

Query: 281 EKPEQRPNVCQV 292
           + P  R  + Q+
Sbjct: 509 KNPNNRLTIHQI 520

>YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}
           STE20Cdc42p-activated signal transducing kinase of the
           PAK (p21-activated kinase) family; involved in pheromone
           response, pseudohyphal/invasive growth, vacuole
           inheritance, down-regulation of sterol uptake; GBB motif
           binds Ste4p
          Length = 939

 Score = 77.4 bits (189), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 72/275 (26%), Positives = 123/275 (44%), Gaps = 46/275 (16%)

Query: 30  SGGFAQIYQVQVNPPNPINGMNLA--CLKRVIVPEKSGLNTLRAEVEAMQLLKGK--PHV 85
           SGG    Y++  N    I  MNL     K +I+ E             + ++KG   P++
Sbjct: 631 SGGVYTAYEIGTNVSVAIKQMNLEKQPKKELIINE-------------ILVMKGSKHPNI 677

Query: 86  VGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGI 145
           V +IDS   +        ++  +ME+  GG L D +   +   L E ++  +  +   G+
Sbjct: 678 VNFIDSYVLKG-------DLWVIMEYMEGGSLTDVVTHCI---LTEGQIGAVCRETLSGL 727

Query: 146 VAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNT 205
             +HS    ++HRDIK +N+L+S  G+ K+ DFG  + I        E N  +  ++   
Sbjct: 728 EFLHSKG--VLHRDIKSDNILLSMEGDIKLTDFGFCAQI-------NELNLKRTTMVG-- 776

Query: 206 TAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGE-RAI-LHARYQYPQ 263
           T  +  PE++      P   K DIW+LG+ + ++     P+ N    RA+ L A    P+
Sbjct: 777 TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPK 833

Query: 264 YPM---YSSRLKNLIRMMLMEKPEQRPNVCQVLEE 295
                  SS LK  +   L  +PE R +  ++L +
Sbjct: 834 LKEPENLSSSLKKFLDWCLCVEPEDRASATELLHD 868

>TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1745

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 60/234 (25%), Positives = 110/234 (47%), Gaps = 39/234 (16%)

Query: 69  LRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNR 128
           +  E+  M+L+   P+V+G  +    +S       E+  ++E+  GG L D++ +R   +
Sbjct: 146 IEREIVIMKLI-SHPNVMGLYEVWENKS-------ELYLVLEYVDGGELFDYLVSR--GK 195

Query: 129 LKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISS-NGEYKVCDFGSVSGIIRP 187
           L E E ++   Q+ QG+   H+ N  + HRD+K EN+L+   N   K+ DFG  +  +  
Sbjct: 196 LPEREAVHYFKQIIQGVAYCHAFN--ICHRDLKPENLLLDKKNKIIKIADFGMAALEV-- 251

Query: 188 PKNTEEFNFVQQDIMKNTTA---QYRCPEML--DLYRGQPINEKSDIWALGVFLYKICYY 242
                       D + +T+     Y  PE++    Y G P    +D+W+ G+ L+ +   
Sbjct: 252 -----------SDKLLSTSCGSPHYASPEIVMGKSYHGSP----TDVWSCGIILFALLTG 296

Query: 243 TTPFENGGERAILHARYQYPQYPM---YSSRLKNLIRMMLMEKPEQRPNVCQVL 293
             PF +   + +L  + Q   Y M    S   K+LI  +L+  P++R    ++L
Sbjct: 297 HLPFNHDNIKKLL-LKVQSGVYHMPSDLSPDAKDLISKILVVDPDKRLTTTEIL 349

>CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON}
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102w NRK1 ser/thr protein kinase
          Length = 1072

 Score = 77.4 bits (189), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 61/230 (26%), Positives = 112/230 (48%), Gaps = 27/230 (11%)

Query: 69  LRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNR 128
           ++ E++ +  LK  P++  Y  S   R  S      +  +ME+C GG L   +      +
Sbjct: 59  VQREIQFLASLKQIPNITRYYGS-YLRGTS------LWIIMEYCAGGSLRSLLR---PGK 108

Query: 129 LKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPP 188
           + E  +  IM ++   +  +H  N  +IHRDIK  NVLI++ G+ K+CDFG  + +    
Sbjct: 109 IDEKYIGVIMRELLVALKVIHKDN--VIHRDIKAANVLITNEGQVKLCDFGVAAQL---- 162

Query: 189 KNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPF-E 247
               + +  +Q +    T  +  PE+  +  G   + K DIW+LG+  Y+I     P+ +
Sbjct: 163 ---NQTSLRRQTMAG--TPYWMAPEV--IMEGVYYDTKVDIWSLGITAYEIATGNPPYCD 215

Query: 248 NGGERA---ILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLE 294
               RA   I+ ++    +   Y+ +LK  I + L E P++R +  ++L+
Sbjct: 216 VEALRAMQLIIKSKPPRLEERNYTPQLKEFIALCLDEDPQERLSAEELLK 265

>Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205W
           (REAL)
          Length = 815

 Score = 77.0 bits (188), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 66/283 (23%), Positives = 125/283 (44%), Gaps = 31/283 (10%)

Query: 9   YDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNT 68
           Y    K + G     +++ L  G F Q+YQV+      I  M +   K+VIV +    +T
Sbjct: 390 YKQTKKRHYGPQDFEVLRLLGKGTFGQVYQVKKKDTKRIYAMKVLS-KKVIVKKNEIAHT 448

Query: 69  L-RAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQN 127
           +    +      K  P +VG          S     ++  + ++  GG L  F + + + 
Sbjct: 449 IGERNILVTTASKSSPFIVGL-------KFSFQTPADLYLVTDYMSGGEL--FWHLQKEG 499

Query: 128 RLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRP 187
           R  E      + ++   +  +H  +  +++RD+K EN+L+ +NG   +CDFG     ++ 
Sbjct: 500 RFSEDRAKFYIAELVLALEHLHDND--IVYRDLKPENILLDANGNIALCDFGLSKADLKD 557

Query: 188 PKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPF- 246
             NT    F         T +Y  PE+L    G    +  D W+LGV ++++C   +PF 
Sbjct: 558 RTNT----FC-------GTTEYLAPELLLDETG--YTKMVDFWSLGVLIFEMCCGWSPFF 604

Query: 247 -ENGGE--RAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQR 286
            EN  +  + I   + ++P+  + S   ++ ++ +L   P+ R
Sbjct: 605 AENNQKMYQKIAFGKVKFPR-DVLSQEGRSFVKGLLNRNPKHR 646

>KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} similar
           to uniprot|Q03497 Saccharomyces cerevisiae YHL007C STE20
           Signal transducing kinase of the PAK (p21- activated
           kinase) family involved in pheromone response and
           pseudohyphal/invasive growth pathways activated by
           Cdc42p binds Ste4p at a GBB motif present in
           noncatalytic domains of PAK kinases
          Length = 989

 Score = 77.4 bits (189), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 75/275 (27%), Positives = 122/275 (44%), Gaps = 46/275 (16%)

Query: 30  SGGFAQIYQVQVNPPNPINGMNLA--CLKRVIVPEKSGLNTLRAEVEAMQLLKGKPH--V 85
           SGG    Y++  N    I  MNL     K +IV E             + ++KG  H  +
Sbjct: 709 SGGVYTAYELGTNASVAIKQMNLEKQPKKELIVNE-------------ILVMKGSKHNNI 755

Query: 86  VGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGI 145
           V +IDS   R        ++  +ME+  GG L D +   +   L E ++  +  +  +G+
Sbjct: 756 VNFIDSYLFRG-------DLWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVSRETLKGL 805

Query: 146 VAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNT 205
             +HS    +IHRDIK +N+L+S NG+ K+ DFG  + I        E N  +  ++   
Sbjct: 806 QFLHSKG--VIHRDIKSDNILLSMNGDIKLTDFGFCAQI-------NEVNLKRTTMVG-- 854

Query: 206 TAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGE-RAI-LHARYQYPQ 263
           T  +  PE++      P   K DIW+LG+ + ++     P+ N    RA+ L A    P+
Sbjct: 855 TPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPK 911

Query: 264 YPM---YSSRLKNLIRMMLMEKPEQRPNVCQVLEE 295
                  S ++   +   LM  PE R     +LE+
Sbjct: 912 LKDPGNLSHKMAMFLNWCLMVDPEDRGTAADLLED 946

>NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]
           {ON} Anc_3.92
          Length = 1113

 Score = 77.4 bits (189), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 53/190 (27%), Positives = 89/190 (46%), Gaps = 13/190 (6%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLI 167
           L+E+ P G  +  M  +    L E        Q+   I  MH+    +IHRDIK EN+L+
Sbjct: 247 LLEYAPNGDFLSVM--KKYGSLNEECACYYGAQILDAIGFMHTRG--IIHRDIKPENILM 302

Query: 168 SSNGEYKVCDFGSVSGIIRPP--KNTEEFNFVQQDIMKNTTAQYRCPEML-DLYRGQPIN 224
             + + K+ DFG+   +       N   +  + +      TA+Y  PE+L D Y     +
Sbjct: 303 DKDMKVKITDFGTAKILDEKTNGNNKTSYELLTRSKSFVGTAEYVSPELLNDNYS----D 358

Query: 225 EKSDIWALGVFLYKICYYTTPFENGGERAILHA--RYQYPQYPMYSSRLKNLIRMMLMEK 282
            + DIWA G  LY++     PF+   E        + QY     + + +++LI+ +L++ 
Sbjct: 359 SRCDIWAFGCILYQMIAGKPPFKATNEYLTFQKVMKVQYAFTAGFPTIIRDLIKRILLKV 418

Query: 283 PEQRPNVCQV 292
           PEQR  + Q+
Sbjct: 419 PEQRLTIGQI 428

>Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C
           (SPS1) - serine/threonine kinase homologous to Ste20p;
           expressed in middle/late meiosis [contig 123] FULL
          Length = 505

 Score = 76.3 bits (186), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 57/196 (29%), Positives = 91/196 (46%), Gaps = 31/196 (15%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLI 167
           +MEFC GG   D +    ++RL E +V  I+ +V  G+  +HS     IHRD+K  N+L+
Sbjct: 110 VMEFCGGGSCADLLKHLPEHRLPENKVAYIIREVLYGLEYLHSQRK--IHRDVKAANILL 167

Query: 168 SSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNT---TAQYRCPEMLDLYRGQPIN 224
           +  GE K+ DFG VSG I               + +NT   T  +  PE+  + R    +
Sbjct: 168 TDEGEVKLGDFG-VSGQI------------MATLKRNTFVGTPYWMAPEI--IARDNGYD 212

Query: 225 EKSDIWALGVFLYKICYYTTPFENGGERAILH-------ARYQYPQYPMYSSRLKNLIRM 277
           EK+DIW+LG+   ++     P+       +L         R Q      ++S  ++ I +
Sbjct: 213 EKADIWSLGITAMELLTGQPPYAKYDPMKVLMNIPLRKPPRLQ----GRFTSSARDFIAL 268

Query: 278 MLMEKPEQRPNVCQVL 293
            L + P  RP    +L
Sbjct: 269 CLTKDPALRPTASDLL 284

>ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q7LGU7 Saccharomyces cerevisiae YPL236C
           Hypothetical ORF
          Length = 369

 Score = 75.1 bits (183), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 81/334 (24%), Positives = 132/334 (39%), Gaps = 62/334 (18%)

Query: 15  LNVGIHQVSIIKYLTSGGFAQIYQVQ---VNPPNPINGMNLACLKRVIVP--EKSGLNTL 69
           L++   + SI K L    F+ IY VQ       +     NL  LKR+  P      ++  
Sbjct: 26  LSINGRRYSIKKLLGESNFSFIYLVQQIGSVTASSTPRTNLYALKRIRCPFGNIESISGA 85

Query: 70  RAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNR- 128
             EV+  +  +  P+++  +DS  A+    DG+  V  L+ + P G L D  +  L N  
Sbjct: 86  MKEVDNYKRFQ-SPYIIHLVDSQVAQQ--RDGSKTVYILLPYFPLGSLQDSTSRNLLNGT 142

Query: 129 -LKEFEVLNIMNQVTQGIVAMHS-----------------------------LNPPL--- 155
            + E E + I+  + +G+  +H                               + PL   
Sbjct: 143 FISEAECIRIVIGIARGLRCLHDPSARSQDAEQQQEHDAVSMSYSDEAAFLLEDTPLELD 202

Query: 156 -------------IHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIM 202
                         HRDIK  N+L SS+G   + + GS S          +   +Q  + 
Sbjct: 203 ILSSANTINSNFYAHRDIKPSNILFSSDGLPVISNLGSCSKADLSINTGMQLTELQAWVS 262

Query: 203 KNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPFE-----NGG--ERAIL 255
            + T  Y  PE+L +   + ++ K DIW+LG   Y + +  +PFE     +G   + AI 
Sbjct: 263 DHCTVAYTAPELLHITLNRSVDTKVDIWSLGCTCYFMLFGISPFEREEQISGASLKYAIG 322

Query: 256 HARYQYPQYPMYSSRLKNLIRMMLMEKPEQRPNV 289
              + +P    YS  L  LI   L   P  RP++
Sbjct: 323 TGNFSFPSQDRYSEGLLKLITKCLQVNPAARPDI 356

>Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W
           (REAL)
          Length = 824

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 66/283 (23%), Positives = 125/283 (44%), Gaps = 31/283 (10%)

Query: 9   YDPGTKLNVGIHQVSIIKYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNT 68
           Y    K + G     +++ L  G F Q+YQV+      I  M +   K+VIV +    +T
Sbjct: 399 YKQTKKRHYGPQDFEVLRLLGKGTFGQVYQVKKKDTQRIYAMKVLS-KKVIVKKNEIAHT 457

Query: 69  L-RAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQN 127
           +    +      K  P +VG          S     ++  + ++  GG L  F + + + 
Sbjct: 458 IGERNILVTTASKSSPFIVGL-------KFSFQTPTDLYLVTDYMSGGEL--FWHLQKEG 508

Query: 128 RLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRP 187
           R  E      + ++   +  +H  +  +++RD+K EN+L+ +NG   +CDFG     ++ 
Sbjct: 509 RFSEDRAKFYIAELVLALEHLHDND--IVYRDLKPENILLDANGNIALCDFGLSKADLKD 566

Query: 188 PKNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPF- 246
             NT    F         T +Y  PE+L    G    +  D W+LGV ++++C   +PF 
Sbjct: 567 RTNT----FC-------GTTEYLAPELLLDETG--YTKMVDFWSLGVLIFEMCCGWSPFF 613

Query: 247 -ENGGE--RAILHARYQYPQYPMYSSRLKNLIRMMLMEKPEQR 286
            EN  +  + I   + ++P+  + S   ++ ++ +L   P+ R
Sbjct: 614 AENNQKMYQKIAFGKVKFPR-DVLSQEGRSFVKGLLNRNPKHR 655

>Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}
           similar to Ashbya gossypii AAR009W
          Length = 451

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 85/297 (28%), Positives = 128/297 (43%), Gaps = 43/297 (14%)

Query: 26  KYLTSGGFAQIYQVQVNPPNPINGMNLACLKRVIVPEKSGLNTLRAEVEAMQLLKGKPHV 85
           K L +G F  + Q + N  N  +      LKR +  ++  LN L  E+  +Q L   PH+
Sbjct: 58  KTLGAGAFGVVRQAR-NSNNDEDVAVKILLKRALKGDE--LNMLYDELMILQKL-DHPHI 113

Query: 86  VGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGI 145
           V + D       S D  Y V QL     GG L D +  +   R  E + + I+ Q+ + I
Sbjct: 114 VKFKDWFE----SKDKFYIVTQL---ATGGELFDRILKK--GRFTETDAVKIVVQMLEAI 164

Query: 146 VAMHSLNPPLIHRDIKIENVLI---SSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIM 202
             MHS N  ++HRD+K ENVL    S + E  + DFG    +      + E + + +   
Sbjct: 165 EYMHSKN--VVHRDLKPENVLYLNPSDDSELVISDFGIAKQL------SSEDHLIHR--- 213

Query: 203 KNTTAQYRCPEMLDLY-RGQPINEKSDIWALGVFLYKICYYTTPFENGGERAILH--ARY 259
              +  Y  PE+L     G+P     DIW+LGV  Y +    +PF        L    R 
Sbjct: 214 AAGSMGYVAPEVLTTSGHGKP----CDIWSLGVITYTLLCGYSPFVAESSEGFLEEVTRS 269

Query: 260 QYP---QYPMYSS---RLKNLIRMMLMEKPEQRPNVCQVLEE---VSSMQGIPCPLP 307
           +YP     P ++S     K  I   L   P +RP   ++L++   +S  Q     LP
Sbjct: 270 KYPVTFHKPYWNSISVEAKEFILKALTLDPSERPTATELLQDTWIISKQQNTEDLLP 326

>Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {ON}
           YHL007C (STE20) - serine/threonine protein kinase
           [contig 55] FULL
          Length = 955

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 73/279 (26%), Positives = 119/279 (42%), Gaps = 52/279 (18%)

Query: 29  TSGGFAQIYQVQVNPPNPINGMNLAC--LKRVIVPEKSGLNTLRAEVEAMQLLKGKPH-- 84
            SGG    Y+V  N    I  MNL     K +I+ E             + ++K   H  
Sbjct: 677 ASGGVYTAYEVGTNASVAIKQMNLEKQPKKELIINE-------------ILVMKASKHAN 723

Query: 85  VVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQG 144
           +V +IDS   R        ++  +ME+  GG L D +   +   L E ++  +  +  +G
Sbjct: 724 IVNFIDSYLLRG-------DLWVVMEYMEGGSLTDVVTHCI---LTEGQIGAVSRETLKG 773

Query: 145 IVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKN 204
           +  +HS    +IHRDIK +NVL+S +GE K+ DFG  + I        E N  +  ++  
Sbjct: 774 LQFLHSKG--VIHRDIKSDNVLLSMSGEIKLTDFGFCAQI-------NEINLKRTTMV-- 822

Query: 205 TTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPFENGGERAILHARY----- 259
            T  +  PE++      P   K DIW+LG+ + ++     P+ N      L A Y     
Sbjct: 823 GTPYWMAPEVVSRKEYGP---KVDIWSLGIMIIEMIEGEPPYLN---ETPLRALYLIATN 876

Query: 260 ---QYPQYPMYSSRLKNLIRMMLMEKPEQRPNVCQVLEE 295
              +       S  LK+ +   L   P++R    Q+L +
Sbjct: 877 GTPELKDADSLSDDLKSFLGWCLHVNPDERATASQLLSD 915

>SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa]
           {ON} similar to uniprot|Q75DQ1 Ashbya gossypii ABL034W
           ABL034Wp and weakly similar to YKL101W uniprot|P34244
           Saccharomyces cerevisiae YKL101W HSL1 Nim1p-related
           protein kinase that regulates the morphogenesis and
           septin checkpoints associates with the assembled septin
           filament required along with Hsl7p for bud neck
           recruitment phosphorylation and degradation of Swe1p
          Length = 1377

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 54/198 (27%), Positives = 96/198 (48%), Gaps = 27/198 (13%)

Query: 104 EVLQLMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIE 163
           E+  ++E+  GG L D++ ++   +L E E ++   Q+ QG+   H+ N  + HRD+K E
Sbjct: 144 ELFLVLEYVEGGELFDYLVSK--GKLPEQEAVHYFRQIIQGVAYCHNYN--ICHRDLKPE 199

Query: 164 NVLISS-NGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQYRCPEML--DLYRG 220
           N+L+   N + K+ DFG  +         E  N + +      +  Y  PE++    Y G
Sbjct: 200 NLLVDKKNHQIKIADFGMAA--------LETTNKLLE--TSCGSPHYASPEIVMGKNYHG 249

Query: 221 QPINEKSDIWALGVFLYKICYYTTPFENGGERAIL----HARYQYPQYPMYSSRLKNLIR 276
            P    SD+W+ G+ L+ +     PF +   + +L      +Y  PQ    SS  ++LI 
Sbjct: 250 SP----SDVWSCGIILFALLTGHLPFNDDNIKKLLLKVQSGKYHMPQN--ISSEAQDLIS 303

Query: 277 MMLMEKPEQRPNVCQVLE 294
            +L+  P  R  + +VL+
Sbjct: 304 KILIVDPRGRITINEVLQ 321

>KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5.406
           YHR102W
          Length = 1008

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 67/259 (25%), Positives = 123/259 (47%), Gaps = 29/259 (11%)

Query: 69  LRAEVEAMQLLKGKPHVVGYIDSNAARSISNDGTYEVLQLMEFCPGGGLIDFMNTRLQNR 128
           ++ E++ +  LK  P++  Y  S    +        +  +ME+C GG L   +      +
Sbjct: 78  VQKEIQFLASLKQLPNITRYYGSYLKNT-------SLWIIMEYCGGGSLRSLLR---PGK 127

Query: 129 LKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLISSNGEYKVCDFGSVSGIIRPP 188
           + E  +  IM ++   +  +H  N  +IHRDIK  NVLI+++G  K+CDFG V+  +   
Sbjct: 128 IDEKYIGVIMREILIALKYIHKDN--VIHRDIKAANVLINNDGSIKLCDFG-VAAQLNQT 184

Query: 189 KNTEEFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEKSDIWALGVFLYKICYYTTPF-E 247
           K+       ++  M   T  +  PE+  +  G   + K+DIW+ G+  Y++     P+ +
Sbjct: 185 KS-------RRQTMAG-TPYWMAPEV--IMEGVYYDTKADIWSTGITAYEVTTGNPPYCD 234

Query: 248 NGGERAI-LHARYQYPQYPM--YSSRLKNLIRMMLMEKPEQRPNVCQVLEEVSSMQGIPC 304
               RA+ L A+ + P+     YS+ +K  I   L E P +RP   ++L+  ++      
Sbjct: 235 VEALRAMQLIAKSKPPRLEGRNYSALIKEFIATCLDEDPSERPTADELLK--TAFIKTYK 292

Query: 305 PLPNFYLQRQQATQLMMNN 323
           PLP   L+   +  L+  +
Sbjct: 293 PLPTSILKELISRYLLFRD 311

>ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {ON}
           some similarities with uniprot|Q03306 Saccharomyces
           cerevisiae YDR466W
          Length = 890

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 92/194 (47%), Gaps = 25/194 (12%)

Query: 108 LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLIHRDIKIENVLI 167
           +++F  GG L+  +N     +  E    + + Q+      +HS    +IHRD+K ENVL+
Sbjct: 92  VLDFAAGGELLSLLNR--VGKFTEPCARHFIAQLIDTTEFIHSQG--VIHRDLKPENVLL 147

Query: 168 SSNGEYKVCDFGSVSGIIRPPKNTE-EFNFVQQDIMKNTTAQYRCPEMLDLYRGQPINEK 226
             +G   V DFG+ + I +  +NTE   +FV        TA+Y  PE+L LY        
Sbjct: 148 HRDGRLMVTDFGTATNITK--ENTEGGASFV-------GTAEYVSPELL-LYNQ--CQFA 195

Query: 227 SDIWALGVFLYKICYYTTPFENGGERAILH-----ARYQYPQYPMYSSRLKNLIRMMLME 281
           SD+WALG  LY+      PF    E   LH        +YP        + +L+R +L  
Sbjct: 196 SDVWALGCMLYQFIEGVPPFRGENE---LHTFEKIVALEYPWANNNKGGVVSLVRRILTL 252

Query: 282 KPEQRPNVCQVLEE 295
            P QRP++  + ++
Sbjct: 253 DPSQRPSLTSIKQD 266

>Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {ON}
           complement(61987..64668) [2682 nt, 894 aa]
          Length = 893

 Score = 76.6 bits (187), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/210 (26%), Positives = 101/210 (48%), Gaps = 40/210 (19%)

Query: 104 EVLQ-------LMEFCPGGGLIDFMNTRLQNRLKEFEVLNIMNQVTQGIVAMHSLNPPLI 156
           EVLQ       ++E+  GG    ++  + + RLKE     +  Q+  G+  MHS    L+
Sbjct: 116 EVLQNSKYIGIVLEYASGGEFYRYI--QRKRRLKETAGCRLFTQLVSGVNYMHSKG--LV 171

Query: 157 HRDIKIENVLISSNGEYKVCDFGSVSGIIRPPKNTEEFNFVQQDIMKNTTAQ--YRCPEM 214
           HRD+K+EN+L+  +    + DFG V+  ++             D+MK +     Y  PE+
Sbjct: 172 HRDLKLENLLLDKHENLVITDFGFVNEFLK-----------DNDLMKTSCGSPCYAAPEL 220

Query: 215 LDLYRGQPIN-EKSDIWALGVFLYKICYYTTPFEN------GGERAILH-----ARYQYP 262
             +   +P    K+DIW+ G+ LY +     P+++      G + A L+        ++P
Sbjct: 221 --VISTKPYEARKADIWSCGIILYAMLAGYLPWDDDPQNPEGDDIARLYYFITRTSLKFP 278

Query: 263 QYPMYSSRLKNLIRMMLMEKPEQRPNVCQV 292
           +Y   S   ++L+R +L+  P +R N+ Q+
Sbjct: 279 EY--ISPIPRDLLRRLLVSDPRKRLNIRQI 306

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.129    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 71,741,398
Number of extensions: 3075495
Number of successful extensions: 20809
Number of sequences better than 10.0: 2012
Number of HSP's gapped: 19051
Number of HSP's successfully gapped: 2056
Length of query: 717
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 600
Effective length of database: 40,065,477
Effective search space: 24039286200
Effective search space used: 24039286200
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)