Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0B059202.283ON40340318730.0
KAFR0H033402.283ON36734211811e-161
Suva_14.3112.283ON38933711831e-161
Skud_14.2982.283ON38933111761e-160
Smik_14.2962.283ON38933011591e-157
YNL035C2.283ON38933311581e-157
ZYRO0A01804g2.283ON37634011401e-155
NDAI0G006302.283ON39734711421e-155
KLTH0G10296g2.283ON42634011441e-155
NCAS0G038702.283ON38933911361e-154
Kpol_1003.342.283ON38833511301e-153
KLLA0E08449g2.283ON42233111231e-152
SAKL0E07766g2.283ON39834211171e-151
TDEL0G021402.283ON39233711031e-149
Kwal_27.115502.283ON40734010971e-148
TPHA0C033702.283ON41334310821e-145
KNAG0H020402.283ON39933210701e-144
Ecym_33212.283ON40933910551e-141
ADL218C2.283ON40334010431e-140
CAGL0G01628g2.283ON37633210201e-137
KNAG0E009806.9ON4141871354e-08
TBLA0A071206.9ON4071871311e-07
NDAI0K029006.9ON4381791302e-07
KAFR0L003206.9ON3911891274e-07
Suva_5.126.9ON4011801249e-07
CAGL0B03575g6.9ON4191851231e-06
KLTH0C11550g6.9ON398691212e-06
SAKL0F08404g7.231ON6432471223e-06
SAKL0E00814g6.9ON3981931194e-06
ACR017W6.9ON4231801194e-06
Skud_5.336.9ON4011811151e-05
KLLA0D00814g6.9ON4081701142e-05
ZYRO0F00462g6.9ON3931771132e-05
Ecym_30126.9ON3971851096e-05
Kpol_1045.786.9ON392631088e-05
NCAS0B078401.247ON5891251081e-04
CAGL0G04345g1.247ON7111781053e-04
KAFR0A064804.122ON5681791034e-04
YEL056W (HAT2)6.9ON4011821025e-04
TDEL0D013101.247ON7091371018e-04
Smik_5.316.9ON427182990.001
CAGL0H03729g1.399ON303134970.002
KLTH0E12694g8.548ON41874960.003
TDEL0F022304.122ON556168970.003
TDEL0G046206.9ON392187960.003
KLLA0A08822g4.122ON582145960.003
Ecym_55285.429ON471164950.004
KLTH0F16192g5.429ON462170940.004
KAFR0B003707.534ON461116940.005
ZYRO0D03828g1.247ON726137950.005
Kpol_487.71.399ON303134920.007
KLLA0E23541g8.548ON417168920.009
Suva_11.2681.247ON645106920.009
Kwal_47.175674.122ON590241920.009
TBLA0G014904.122ON732108920.010
KLTH0D05346g2.469ON507133910.011
Ecym_70388.544ON800190910.012
TPHA0B011201.247ON719188910.012
KNAG0C014101.247ON653132910.014
AEL246C8.544ON815190900.017
TPHA0M001906.9ON391191890.018
YJL112W (MDV1)1.247ON714128900.018
Kwal_27.126671.247ON721143900.018
TPHA0L016908.544ON832167890.020
ZYRO0F06776g8.651ON432166890.022
Skud_12.2858.435ON817147890.024
KLTH0E15576g1.247ON723137890.025
Kpol_1061.364.122ON589136880.025
Kpol_1041.202.401ON515182880.026
KNAG0F038707.534ON465106880.028
Ecym_43437.231ON583255880.029
TBLA0H030601.247ON73083880.030
CAGL0A00605g4.122ON640109880.030
Kpol_1064.358.721ON453124870.034
ZYRO0A08690g2.401ON516115870.034
TBLA0I025708.435ON848117880.035
KNAG0B055504.122ON617163870.037
ACR097W8.631ON467108860.045
Suva_7.2794.122ON566109860.045
SAKL0C13266g3.25ON459121860.048
Kwal_47.173108.133ON55373860.048
Ecym_42558.324ON937118860.048
NCAS0F001906.9ON411123860.049
Kwal_26.77362.469ON507102860.049
Ecym_28087.534ON465151860.051
Kwal_55.214505.429ON503168860.051
SAKL0H22396g4.122ON555147860.051
TDEL0H003707.534ON465106850.055
TPHA0F007704.122ON631148860.056
TPHA0D028605.615ON325179850.057
ZYRO0A09636g8.435ON808124850.067
Kwal_55.220763.22ON128669850.075
YGL003C (CDH1)4.122ON566109840.092
KAFR0A006902.469ON508111830.095
Skud_11.2711.247ON646149840.097
TBLA0B046805.49ON1549173840.10
Skud_14.3211.399ON303162820.11
Kwal_56.239208.324ON937112830.11
TPHA0G018408.631ON43166820.12
CAGL0J01265g2.469ON517101830.12
KLTH0H05038g6.177ON995199830.12
Smik_13.2772.469ON513102820.13
CAGL0D05588g5.201ON477192820.14
ZYRO0A12980g8.544ON82490830.14
KNAG0E024702.469ON509123820.14
SAKL0D04796g1.247ON769140820.14
Suva_7.519na 1ON20562800.14
ZYRO0F09372g8.721ON448123820.15
YKR036C (CAF4)1.247ON643152820.15
KLTH0E08162g4.122ON556136820.16
NCAS0H024205.500ON1520100820.16
ACR085Cna 2ON95478820.16
YOR272W (YTM1)8.721ON460122810.16
KLTH0H12122g1.399ON303142810.17
SAKL0D08756g1.399ON303134810.17
Suva_13.3112.401ON510111810.17
Skud_7.2844.122ON566109810.17
Ecym_20243.22ON131768820.17
Kwal_0.2121.399ON30395800.18
KLLA0E04819g7.534ON459144810.18
TBLA0D048701.399ON327165810.18
AGR180W8.435ON806114820.18
KLLA0F19734g8.288ON113357820.18
KAFR0H031401.399ON303206800.19
ZYRO0G03146g2.469ON510101810.19
Kpol_1013.377.534ON468106810.19
KLLA0D04840g1.399ON30383800.20
TPHA0B042501.107ON507157810.20
KLTH0G12276g8.324ON937134810.20
Kwal_56.223456.9ON396211800.21
NDAI0G025808.324ON958130810.22
Smik_16.795.104ON59362810.23
KLTH0G13068g8.288ON110150810.23
YGR225W (AMA1)5.104ON59362800.23
Smik_7.2874.122ON566109800.24
Skud_13.2492.469ON513102800.24
Suva_7.5185.104ON59362800.25
AEL269C7.534ON455107800.25
TDEL0A074006.325ON901100800.26
KAFR0E031808.544ON814181800.26
TDEL0B020108.435ON805129800.27
KLTH0H02134g7.310ON129977800.28
CAGL0L03201g1.247ON579127800.29
KLLA0D16390g8.324ON936115800.30
YLR129W (DIP2)8.324ON943125800.31
NDAI0E015008.631ON42856790.32
TDEL0A024502.469ON510110790.32
Ecym_41348.435ON810114790.33
ZYRO0E04620g1.399ON303202780.33
Ecym_80901.247ON716136790.33
Suva_10.2228.324ON943126790.35
Ecym_31681.497ON1295136790.37
Skud_4.637.310ON1273161790.38
Skud_12.1988.324ON943125790.38
NCAS0C032608.324ON983130790.39
Ecym_24018.672ON42692780.41
Smik_14.821.107ON42292780.42
Suva_14.891.107ON422150780.43
SAKL0D03740g3.259ON478188780.44
Smik_11.2981.247ON662144780.45
YMR093W (UTP15)2.469ON513102780.45
NCAS0A055206.363ON671124780.46
KAFR0H022608.324ON938125780.47
Smik_12.1928.324ON943107780.55
SAKL0H07656g8.631ON426126770.56
KAFR0A006002.450ON89436780.56
KAFR0A041108.721ON460122770.56
KLLA0E07085g3.25ON452124770.56
Kpol_1016.111.247ON669140770.58
NCAS0B036908.288ON114554770.61
KNAG0G024508.324ON942279770.63
Suva_13.2702.469ON513102770.64
KLTH0A07282g6.363ON725110770.66
Skud_14.851.107ON42284760.66
Suva_14.3421.399ON303162760.67
NDAI0G024508.350ON96082770.67
NCAS0G036001.399ON327175760.69
Ecym_25236.363ON646109770.70
Kwal_23.64296.363ON750110770.70
TPHA0P014903.25ON459124760.70
Kwal_56.236858.288ON110239770.71
NCAS0F019702.401ON511192760.72
KLTH0F19338g3.22ON129069770.73
TDEL0A068906.276ON44753760.75
KAFR0E039005.429ON439125760.75
Suva_16.606.276ON52674760.79
NDAI0E009108.721ON464136760.80
ZYRO0D16742g7.231ON608223760.81
TPHA0J025406.239ON866174760.81
Smik_6.708.67ON783223760.81
KAFR0D030602.450ON82654760.84
Skud_15.4378.721ON461123760.84
KAFR0F010606.276ON553112760.84
Kwal_27.115858.435ON823114760.85
Kpol_1072.418.631ON42057750.89
NDAI0C026001.399ON303160750.90
TPHA0L021305.49ON1508149760.92
ZYRO0F07282g8.672ON427106750.94
Suva_4.537.310ON1271162760.94
TBLA0B043908.585ON33654750.95
TBLA0F024007.338ON298137740.99
KLTH0E10120g8.435ON826114751.0
Ecym_12931.399ON30396741.0
Smik_14.3221.399ON303162741.0
YNL006W (LST8)1.399ON303162741.0
ADR242C2.401ON521122751.0
ADL186C3.22ON136165751.0
SAKL0C13332g3.22ON135370751.1
KNAG0H016901.399ON303156741.1
YBR198C (TAF5)8.544ON798183751.1
KLTH0F19294g3.25ON451106751.1
TDEL0A057708.631ON43376741.1
TPHA0D044807.310ON134091751.1
CAGL0M02563g8.651ON457159741.1
KAFR0A064904.123ON434189741.1
ABL024W2.450ON73450751.2
ZYRO0F06314g8.631ON431195741.2
Kwal_56.244787.310ON129677751.2
KLLA0E20967g3.22ON132165751.2
YNL253W (TEX1)1.107ON422107741.2
Kpol_1024.428.544ON843185751.3
NCAS0J011004.123ON437116741.3
KNAG0I010508.288ON115957751.3
ZYRO0F09922g5.429ON455312741.3
AGL234W6.363ON629109741.3
NCAS0F014502.450ON90845741.3
Ecym_71055.201ON484192741.3
KNAG0E021802.401ON517194741.3
KNAG0G028208.721ON457137741.4
NCAS0E037507.310ON1276178741.4
Kpol_1060.246.276ON486125741.4
ZYRO0G10472g4.122ON560137741.4
Ecym_62288.721ON445119741.5
NDAI0E034408.435ON857121741.5
CAGL0C03608g6.363ON643124741.5
KAFR0G019708.631ON42556731.5
ZYRO0B15268g5.104ON603148741.5
KLLA0D06787g8.631ON43656731.5
NCAS0B004808.721ON456106731.5
NDAI0H027502.401ON512187731.5
SAKL0F15972g7.534ON470106731.5
KLLA0D15873g7.180ON43172731.6
Skud_16.326.276ON522119731.6
NCAS0C016808.672ON431102731.6
YDL195W (SEC31)7.310ON1273163741.6
NCAS0I024903.95ON62634731.7
Skud_13.2912.401ON509185731.7
Ecym_60672.401ON522196731.7
Suva_4.4278.585ON31548721.7
TPHA0L010808.435ON835119731.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0B05920
         (403 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...   726   0.0  
KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.2...   459   e-161
Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {...   460   e-161
Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {...   457   e-160
Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {...   451   e-157
YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON} ...   450   e-157
ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {...   443   e-155
NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {O...   444   e-155
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...   445   e-155
NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283    442   e-154
Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {O...   439   e-153
KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} simila...   437   e-152
SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} simila...   434   e-151
TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {O...   429   e-149
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...   427   e-148
TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {O...   421   e-145
KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.2...   416   e-144
Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}...   410   e-141
ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON} S...   406   e-140
CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {...   397   e-137
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...    57   4e-08
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...    55   1e-07
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9      55   2e-07
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...    54   4e-07
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)    52   9e-07
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...    52   1e-06
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...    51   2e-06
SAKL0F08404g Chr6 complement(640436..642367) [1932 bp, 643 aa] {...    52   3e-06
SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON...    50   4e-06
ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic ho...    50   4e-06
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)    49   1e-05
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...    49   2e-05
ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...    48   2e-05
Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON} s...    47   6e-05
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...    46   8e-05
NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa] ...    46   1e-04
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    45   3e-04
KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa] ...    44   4e-04
YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...    44   5e-04
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    44   8e-04
Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)    43   0.001
CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly ...    42   0.002
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...    42   0.003
TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.1...    42   0.003
TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9...    42   0.003
KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} simila...    42   0.003
Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {O...    41   0.004
KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} simi...    41   0.004
KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}...    41   0.005
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    41   0.005
Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON} c...    40   0.007
KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} simi...    40   0.009
Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {...    40   0.009
Kwal_47.17567 s47 complement(459443..461215) [1773 bp, 590 aa] {...    40   0.009
TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.1...    40   0.010
KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {...    40   0.011
Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to ...    40   0.012
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    40   0.012
KNAG0C01410 Chr3 (277054..279015) [1962 bp, 653 aa] {ON} Anc_1.2...    40   0.014
AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON} S...    39   0.017
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...    39   0.018
YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}  MDV1Perip...    39   0.018
Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]...    39   0.018
TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8....    39   0.020
ZYRO0F06776g Chr6 (555965..557263) [1299 bp, 432 aa] {ON} simila...    39   0.022
Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {...    39   0.024
KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]...    39   0.025
Kpol_1061.36 s1061 (100800..102569) [1770 bp, 589 aa] {ON} (1008...    39   0.025
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    39   0.026
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    39   0.028
Ecym_4343 Chr4 (733111..734862) [1752 bp, 583 aa] {ON} similar t...    39   0.029
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    39   0.030
CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON...    39   0.030
Kpol_1064.35 s1064 (64223..65584) [1362 bp, 453 aa] {ON} (64223....    38   0.034
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    38   0.034
TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.7...    39   0.035
KNAG0B05550 Chr2 (1080707..1082560) [1854 bp, 617 aa] {ON} Anc_4...    38   0.037
ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic ho...    38   0.045
Suva_7.279 Chr7 complement(484066..485766) [1701 bp, 566 aa] {ON...    38   0.045
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    38   0.048
Kwal_47.17310 s47 (345235..346896) [1662 bp, 553 aa] {ON} YER124...    38   0.048
Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...    38   0.048
NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}...    38   0.049
Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {O...    38   0.049
Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar...    38   0.051
Kwal_55.21450 s55 (842483..843994) [1512 bp, 503 aa] {ON} YDR364...    38   0.051
SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]...    38   0.051
TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}...    37   0.055
TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.1...    38   0.056
TPHA0D02860 Chr4 (596215..597192) [978 bp, 325 aa] {ON} Anc_5.61...    37   0.057
ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly...    37   0.067
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    37   0.075
YGL003C Chr7 complement(492474..494174) [1701 bp, 566 aa] {ON}  ...    37   0.092
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    37   0.095
Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {...    37   0.097
TBLA0B04680 Chr2 complement(1095348..1099997) [4650 bp, 1549 aa]...    37   0.10 
Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W...    36   0.11 
Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129...    37   0.11 
TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {O...    36   0.12 
CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa] ...    37   0.12 
KLTH0H05038g Chr8 complement(449230..452217) [2988 bp, 995 aa] {...    37   0.12 
Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093...    36   0.13 
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    36   0.14 
ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} simi...    37   0.14 
KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.4...    36   0.14 
SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} simila...    36   0.14 
Suva_7.519 Chr7 (900889..901503) [615 bp, 205 aa] {ON} YGR225W (...    35   0.14 
ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly...    36   0.15 
YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON} ...    36   0.15 
KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {...    36   0.16 
NCAS0H02420 Chr8 (477754..482316) [4563 bp, 1520 aa] {ON} Anc_5....    36   0.16 
ACR085C Chr3 complement(508364..511228) [2865 bp, 954 aa] {ON} N...    36   0.16 
YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}  YTM1Const...    36   0.16 
KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highl...    36   0.17 
SAKL0D08756g Chr4 complement(728765..729676) [912 bp, 303 aa] {O...    36   0.17 
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    36   0.17 
Skud_7.284 Chr7 complement(495549..497249) [1701 bp, 566 aa] {ON...    36   0.17 
Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON} ...    36   0.17 
Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LS...    35   0.18 
KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} simila...    36   0.18 
TBLA0D04870 Chr4 complement(1194448..1195431) [984 bp, 327 aa] {...    36   0.18 
AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic ...    36   0.18 
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    36   0.18 
KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON...    35   0.19 
ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {...    36   0.19 
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    36   0.19 
KLLA0D04840g Chr4 (413362..414273) [912 bp, 303 aa] {ON} highly ...    35   0.20 
TPHA0B04250 Chr2 complement(995664..997187) [1524 bp, 507 aa] {O...    36   0.20 
KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]...    36   0.20 
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...    35   0.21 
NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {O...    36   0.22 
Smik_16.79 Chr16 complement(149712..150310,150409..151591) [1782...    36   0.23 
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    36   0.23 
YGR225W Chr7 (945145..946327,946421..947019) [1782 bp, 593 aa] {...    35   0.23 
Smik_7.287 Chr7 complement(484376..486076) [1701 bp, 566 aa] {ON...    35   0.24 
Skud_13.249 Chr13 (427918..429459) [1542 bp, 513 aa] {ON} YMR093...    35   0.24 
Suva_7.518 Chr7 (899625..900807,900908..901506) [1782 bp, 593 aa...    35   0.25 
AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON} S...    35   0.25 
TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa] ...    35   0.26 
KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.5...    35   0.26 
TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {O...    35   0.27 
KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} simil...    35   0.28 
CAGL0L03201g Chr12 complement(368792..370531) [1740 bp, 579 aa] ...    35   0.29 
KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} simi...    35   0.30 
YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}  DIP2Nucle...    35   0.31 
NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {O...    35   0.32 
TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {O...    35   0.32 
Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}...    35   0.33 
ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly ...    35   0.33 
Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar t...    35   0.33 
Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129...    35   0.35 
Ecym_3168 Chr3 complement(318158..322045) [3888 bp, 1295 aa] {ON...    35   0.37 
Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W ...    35   0.38 
Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129...    35   0.38 
NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {O...    35   0.39 
Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}...    35   0.41 
Smik_14.82 Chr14 (149174..150442) [1269 bp, 422 aa] {ON} YNL253W...    35   0.42 
Suva_14.89 Chr14 (164766..166034) [1269 bp, 422 aa] {ON} YNL253W...    35   0.43 
SAKL0D03740g Chr4 (303240..304676) [1437 bp, 478 aa] {ON} simila...    35   0.44 
Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {...    35   0.45 
YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}  UTP15Nucl...    35   0.45 
NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa] ...    35   0.46 
KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {O...    35   0.47 
Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129...    35   0.55 
SAKL0H07656g Chr8 complement(659189..660469) [1281 bp, 426 aa] {...    34   0.56 
KAFR0A00600 Chr1 (108157..110841) [2685 bp, 894 aa] {ON} Anc_2.4...    35   0.56 
KAFR0A04110 Chr1 (826618..828000) [1383 bp, 460 aa] {ON} Anc_8.7...    34   0.56 
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    34   0.56 
Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON} (27192....    34   0.58 
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    34   0.61 
KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.3...    34   0.63 
Suva_13.270 Chr13 (435573..437114) [1542 bp, 513 aa] {ON} YMR093...    34   0.64 
KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {...    34   0.66 
Skud_14.85 Chr14 (158809..160077) [1269 bp, 422 aa] {ON} YNL253W...    34   0.66 
Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W...    34   0.67 
NDAI0G02450 Chr7 complement(557055..559937) [2883 bp, 960 aa] {O...    34   0.67 
NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON...    34   0.69 
Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {O...    34   0.70 
Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa] ...    34   0.70 
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    34   0.70 
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    34   0.71 
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    34   0.72 
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    34   0.73 
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    34   0.75 
KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {O...    34   0.75 
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    34   0.79 
NDAI0E00910 Chr5 complement(182574..183968) [1395 bp, 464 aa] {O...    34   0.80 
ZYRO0D16742g Chr4 complement(1385330..1387156) [1827 bp, 608 aa]...    34   0.81 
TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {...    34   0.81 
Smik_6.70 Chr6 (129582..131933) [2352 bp, 783 aa] {ON} YFL009W (...    34   0.81 
KAFR0D03060 Chr4 (604145..606625) [2481 bp, 826 aa] {ON} Anc_2.4...    34   0.84 
Skud_15.437 Chr15 (771566..772951) [1386 bp, 461 aa] {ON} YOR272...    34   0.84 
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    34   0.84 
Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222...    34   0.85 
Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {O...    33   0.89 
NDAI0C02600 Chr3 complement(605643..606554) [912 bp, 303 aa] {ON}      33   0.90 
TPHA0L02130 Chr12 complement(441224..445750) [4527 bp, 1508 aa] ...    34   0.92 
ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} simila...    33   0.94 
Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W (R...    34   0.94 
TBLA0B04390 Chr2 (1014987..1015997) [1011 bp, 336 aa] {ON} Anc_8...    33   0.95 
TBLA0F02400 Chr6 complement(590293..591189) [897 bp, 298 aa] {ON...    33   0.99 
KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly...    33   1.0  
Ecym_1293 Chr1 (595329..596240) [912 bp, 303 aa] {ON} similar to...    33   1.0  
Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W...    33   1.0  
YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protei...    33   1.0  
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    33   1.0  
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    33   1.0  
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    33   1.1  
KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.39...    33   1.1  
YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}  ...    33   1.1  
KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]...    33   1.1  
TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON} Anc_8...    33   1.1  
TPHA0D04480 Chr4 complement(970967..974989) [4023 bp, 1340 aa] {...    33   1.1  
CAGL0M02563g Chr13 complement(295156..296529) [1374 bp, 457 aa] ...    33   1.1  
KAFR0A06490 Chr1 complement(1314794..1316098) [1305 bp, 434 aa] ...    33   1.1  
ABL024W Chr2 (353682..355886) [2205 bp, 734 aa] {ON} Syntenic ho...    33   1.2  
ZYRO0F06314g Chr6 (526555..527850) [1296 bp, 431 aa] {ON} simila...    33   1.2  
Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa...    33   1.2  
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    33   1.2  
YNL253W Chr14 (170018..171286) [1269 bp, 422 aa] {ON}  TEX1Prote...    33   1.2  
Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa] ...    33   1.3  
NCAS0J01100 Chr10 (187994..189307) [1314 bp, 437 aa] {ON} Anc_4....    33   1.3  
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    33   1.3  
ZYRO0F09922g Chr6 complement(805666..807033) [1368 bp, 455 aa] {...    33   1.3  
AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic ho...    33   1.3  
NCAS0F01450 Chr6 complement(287070..289796) [2727 bp, 908 aa] {O...    33   1.3  
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    33   1.3  
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    33   1.3  
KNAG0G02820 Chr7 (623677..625050) [1374 bp, 457 aa] {ON} Anc_8.7...    33   1.4  
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    33   1.4  
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    33   1.4  
ZYRO0G10472g Chr7 complement(844939..846621) [1683 bp, 560 aa] {...    33   1.4  
Ecym_6228 Chr6 (425765..427102) [1338 bp, 445 aa] {ON} similar t...    33   1.5  
NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {O...    33   1.5  
CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} simila...    33   1.5  
KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {O...    33   1.5  
ZYRO0B15268g Chr2 complement(1243795..1244396,1244475..1245684) ...    33   1.5  
KLLA0D06787g Chr4 (586289..587599) [1311 bp, 436 aa] {ON} simila...    33   1.5  
NCAS0B00480 Chr2 (69598..70968) [1371 bp, 456 aa] {ON} Anc_8.721       33   1.5  
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    33   1.5  
SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} simi...    33   1.5  
KLLA0D15873g Chr4 (1334131..1335426) [1296 bp, 431 aa] {ON} simi...    33   1.6  
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    33   1.6  
NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672     33   1.6  
YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}  SEC31Comp...    33   1.6  
NCAS0I02490 Chr9 complement(465916..467796) [1881 bp, 626 aa] {O...    33   1.7  
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    33   1.7  
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    33   1.7  
Suva_4.427 Chr4 (751909..752856) [948 bp, 315 aa] {ON} YBR175W (...    32   1.7  
TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8....    33   1.7  
KNAG0D03460 Chr4 (622817..624055) [1239 bp, 412 aa] {ON} Anc_4.1...    33   1.7  
TPHA0C01150 Chr3 (263944..266007) [2064 bp, 687 aa] {ON} Anc_7.2...    33   1.8  
TBLA0E00760 Chr5 (158338..159492) [1155 bp, 384 aa] {ON}               33   1.8  
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    33   1.9  
TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1....    32   1.9  
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    33   1.9  
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    33   1.9  
TBLA0B04070 Chr2 complement(930877..932130) [1254 bp, 417 aa] {O...    32   2.0  
CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa] ...    32   2.0  
Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178...    32   2.0  
YGR145W Chr7 (781767..783890) [2124 bp, 707 aa] {ON}  ENP2Essent...    33   2.0  
TBLA0B05250 Chr2 (1235961..1240076) [4116 bp, 1371 aa] {ON} Anc_...    33   2.0  
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    33   2.1  
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    33   2.1  
NDAI0K01410 Chr11 (321553..324486) [2934 bp, 977 aa] {ON} Anc_2....    33   2.1  
NDAI0C05770 Chr3 complement(1328677..1329684) [1008 bp, 335 aa] ...    32   2.1  
YBR175W Chr2 (582408..583355) [948 bp, 315 aa] {ON}  SWD3Essenti...    32   2.1  
SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]...    33   2.1  
Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W ...    32   2.1  
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...    32   2.1  
SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {...    32   2.2  
KLLA0B12804g Chr2 (1117475..1120033) [2559 bp, 852 aa] {ON} simi...    33   2.2  
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    32   2.2  
SAKL0G01628g Chr7 complement(133626..136505) [2880 bp, 959 aa] {...    33   2.2  
CAGL0K00275g Chr11 complement(26129..28276) [2148 bp, 715 aa] {O...    32   2.2  
TDEL0H02130 Chr8 (362711..364465) [1755 bp, 584 aa] {ON} Anc_7.2...    32   2.2  
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    32   2.3  
Smik_2.315 Chr2 (568572..569519) [948 bp, 315 aa] {ON} YBR175W (...    32   2.3  
Kwal_27.12239 s27 complement(1143763..1144713) [951 bp, 316 aa] ...    32   2.3  
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    32   2.4  
AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homo...    32   2.5  
Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {...    32   2.5  
NCAS0B01910 Chr2 (312479..313456) [978 bp, 325 aa] {ON} Anc_8.585      32   2.5  
AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic ho...    32   2.6  
NCAS0A04400 Chr1 (888188..890743) [2556 bp, 851 aa] {ON} Anc_2.4...    32   2.7  
TBLA0B03570 Chr2 complement(828308..829684) [1377 bp, 458 aa] {O...    32   2.7  
TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON} Anc_7...    32   2.7  
TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa] ...    32   2.8  
ZYRO0G10406g Chr7 complement(839502..840677) [1176 bp, 391 aa] {...    32   2.8  
TPHA0L00250 Chr12 complement(30772..32421) [1650 bp, 549 aa] {ON...    32   2.8  
SAKL0E03520g Chr5 complement(283754..286654) [2901 bp, 966 aa] {...    32   2.8  
SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa...    32   2.8  
Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {...    32   2.9  
Suva_7.74 Chr7 complement(141302..142891) [1590 bp, 529 aa] {ON}...    32   3.0  
NCAS0A01850 Chr1 complement(356138..358243) [2106 bp, 701 aa] {O...    32   3.1  
Smik_7.83 Chr7 complement(140174..141754) [1581 bp, 526 aa] {ON}...    32   3.1  
Skud_15.379 Chr15 (681934..683211) [1278 bp, 425 aa] {ON} YOR212...    32   3.1  
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    32   3.2  
Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W (R...    32   3.2  
CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some sim...    32   3.2  
Skud_7.83 Chr7 complement(151496..153076) [1581 bp, 526 aa] {ON}...    32   3.2  
NDAI0H02240 Chr8 complement(545073..546617) [1545 bp, 514 aa] {O...    32   3.3  
TBLA0F04240 Chr6 (1043577..1045760) [2184 bp, 727 aa] {ON} Anc_6...    32   3.3  
Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON...    32   3.4  
KAFR0F03340 Chr6 (656751..657980) [1230 bp, 409 aa] {ON} Anc_4.1...    32   3.4  
Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON...    32   3.5  
YGL190C Chr7 complement(145809..147389) [1581 bp, 526 aa] {ON}  ...    32   3.5  
NDAI0J00330 Chr10 (54580..55998) [1419 bp, 472 aa] {ON} Anc_7.534      32   3.7  
Kwal_26.7655 s26 complement(460957..463188) [2232 bp, 743 aa] {O...    32   3.8  
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    32   3.9  
YIL046W Chr9 (268651..270573) [1923 bp, 640 aa] {ON}  MET30F-box...    32   4.0  
YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splic...    32   4.0  
NDAI0J01850 Chr10 (461283..463010) [1728 bp, 575 aa] {ON} Anc_4....    32   4.0  
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...    32   4.0  
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    32   4.0  
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    32   4.0  
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    32   4.1  
Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W...    32   4.3  
KLTH0D10186g Chr4 (845352..846617) [1266 bp, 421 aa] {ON} simila...    32   4.4  
TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {O...    32   4.4  
KNAG0E02400 Chr5 (477698..480430) [2733 bp, 910 aa] {ON} Anc_2.4...    32   4.4  
SAKL0C03344g Chr3 (315639..317087) [1449 bp, 482 aa] {ON} weakly...    32   4.5  
TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.3...    32   4.6  
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    32   4.6  
KLLA0A09471g Chr1 complement(827264..831784) [4521 bp, 1506 aa] ...    32   4.6  
Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa] ...    32   4.6  
KAFR0G03590 Chr7 (740652..741776) [1125 bp, 374 aa] {ON} Anc_6.1...    31   4.6  
NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON} Anc_2...    31   4.7  
NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {O...    32   4.8  
SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]...    31   4.8  
Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON...    32   4.9  
AFR382W Chr6 (1125152..1129018) [3867 bp, 1288 aa] {ON} Syntenic...    32   4.9  
Kwal_33.15591 s33 (1174119..1176263) [2145 bp, 714 aa] {ON} YKL2...    31   5.0  
Smik_15.454 Chr15 (782403..783788) [1386 bp, 461 aa] {ON} YOR272...    31   5.1  
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    32   5.1  
Smik_6.248 Chr6 (401099..403222) [2124 bp, 707 aa] {ON} YGR145W ...    31   5.1  
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    31   5.3  
Kpol_282.7 s282 complement(16621..19011) [2391 bp, 796 aa] {ON} ...    31   5.6  
NCAS0J01110 Chr10 (189535..191322) [1788 bp, 595 aa] {ON}              31   5.6  
Skud_7.467 Chr7 (764555..766681) [2127 bp, 708 aa] {ON} YGR145W ...    31   5.6  
NDAI0F00770 Chr6 (185453..188332) [2880 bp, 959 aa] {ON} Anc_5.6...    31   5.7  
CAGL0M06193g Chr13 (643917..644867) [951 bp, 316 aa] {ON} simila...    31   5.8  
Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W...    31   5.8  
KLTH0A04114g Chr1 complement(344618..346594) [1977 bp, 658 aa] {...    31   5.9  
SAKL0A06534g Chr1 complement(584399..586162) [1764 bp, 587 aa] {...    31   6.0  
TPHA0G02500 Chr7 (515975..518812) [2838 bp, 945 aa] {ON} Anc_2.4...    31   6.0  
SAKL0F11154g Chr6 (870446..871981) [1536 bp, 511 aa] {ON} simila...    31   6.0  
YDL139C Chr4 complement(211375..212046) [672 bp, 223 aa] {ON}  S...    30   6.1  
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...    31   6.1  
Kpol_1018.164 s1018 (420666..423203) [2538 bp, 845 aa] {ON} (420...    31   6.1  
NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {O...    31   6.3  
NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340     31   6.3  
YER124C Chr5 complement(407342..409063) [1722 bp, 573 aa] {ON}  ...    31   6.4  
AAL009C Chr1 complement(325785..326696) [912 bp, 303 aa] {ON} Sy...    31   6.5  
NDAI0H02330 Chr8 complement(564240..567221) [2982 bp, 993 aa] {O...    31   6.9  
KNAG0H00180 Chr8 complement(26550..27719) [1170 bp, 389 aa] {ON}...    31   7.1  
KNAG0A07710 Chr1 complement(1220868..1225226) [4359 bp, 1452 aa]...    31   7.3  
KLTH0E13552g Chr5 complement(1202406..1203356) [951 bp, 316 aa] ...    30   7.3  
ZYRO0F03784g Chr6 (314914..317247) [2334 bp, 777 aa] {ON} simila...    31   7.3  
CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 ...    31   7.3  
NDAI0K02350 Chr11 complement(524551..526932) [2382 bp, 793 aa] {...    31   7.4  
NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25      31   7.6  
TDEL0E01960 Chr5 (369744..371102) [1359 bp, 452 aa] {ON} Anc_5.4...    30   7.8  
TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {O...    30   7.9  
ZYRO0C11308g Chr3 complement(874724..877390) [2667 bp, 888 aa] {...    31   8.0  
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    30   8.1  
Skud_6.63 Chr6 (118478..120823) [2346 bp, 781 aa] {ON} YFL009W (...    31   8.2  
YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}  ...    31   8.2  
Kwal_47.17555 s47 complement(453984..455237) [1254 bp, 417 aa] {...    30   8.4  
KLLA0C16533g Chr3 complement(1448866..1450404) [1539 bp, 512 aa]...    30   8.4  
TDEL0A05290 Chr1 complement(933493..934452) [960 bp, 319 aa] {ON...    30   8.5  
NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201     30   8.6  
TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.2...    30   8.7  
Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR1...    30   8.8  
NCAS0A14030 Chr1 complement(2760841..2762415) [1575 bp, 524 aa] ...    30   8.9  
ZYRO0D07744g Chr4 (674077..678654) [4578 bp, 1525 aa] {ON} simil...    31   9.0  
ZYRO0C11242g Chr3 complement(871160..872170) [1011 bp, 336 aa] {...    30   9.2  
Kpol_1041.35 s1041 complement(87507..89612) [2106 bp, 701 aa] {O...    30   9.3  
AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic h...    30   9.4  
YOR212W Chr15 (742910..744181) [1272 bp, 423 aa] {ON}  STE4G pro...    30   9.5  
ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa] ...    30   9.6  
TPHA0F03030 Chr6 complement(661801..663549) [1749 bp, 582 aa] {O...    30   9.6  
Ecym_7373 Chr7 complement(776909..779269) [2361 bp, 786 aa] {ON}...    30   9.8  
Skud_9.123 Chr9 (237466..239385) [1920 bp, 639 aa] {ON} YIL046W ...    30   10.0 

>TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa]
           {ON} Anc_2.283 YNL035C
          Length = 403

 Score =  726 bits (1873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/403 (89%), Positives = 361/403 (89%)

Query: 1   MSVIPINLTSFGSNNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSIND 60
           MSVIPINLTSFGSNNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSIND
Sbjct: 1   MSVIPINLTSFGSNNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSIND 60

Query: 61  FEIVNNNYNGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTEL 120
           FEIVNNNYNGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTEL
Sbjct: 61  FEIVNNNYNGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTEL 120

Query: 121 SGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTET 180
           SGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTET
Sbjct: 121 SGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTET 180

Query: 181 EEEDSLHQVINYSSIHSCGWLSSRRIFTLSHMETFAIHQLNDKSEVLKEPKPIEFGDIRN 240
           EEEDSLHQVINYSSIHSCGWLSSRRIFTLSHMETFAIHQLNDKSEVLKEPKPIEFGDIRN
Sbjct: 181 EEEDSLHQVINYSSIHSCGWLSSRRIFTLSHMETFAIHQLNDKSEVLKEPKPIEFGDIRN 240

Query: 241 DWGCNYVIDVYPGYIATGKTEESKGQLKISPFNNEKIDLAEDNNIIIPQAHGDEVIRDVF 300
           DWGCNYVIDVYPGYIATGKTEESKGQLKISPFNNEKIDLAEDNNIIIPQAHGDEVIRDVF
Sbjct: 241 DWGCNYVIDVYPGYIATGKTEESKGQLKISPFNNEKIDLAEDNNIIIPQAHGDEVIRDVF 300

Query: 301 INPNDPSNMYSCGEDGNVKLWKIDTTTKSLKIPEHFFDYSLRXXXXXXXXXXXXXXXXXM 360
           INPNDPSNMYSCGEDGNVKLWKIDTTTKSLKIPEHFFDYSLR                 M
Sbjct: 301 INPNDPSNMYSCGEDGNVKLWKIDTTTKSLKIPEHFFDYSLRLNVLDEINENDDDIEVDM 360

Query: 361 GTENTEPGVSEGXXXXXXXXXXXXXXXXXXXXXXXXXARFKPY 403
           GTENTEPGVSEG                         ARFKPY
Sbjct: 361 GTENTEPGVSEGKHKKSHKKEKKSKKSKKKSSKHSKKARFKPY 403

>KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.283
           YNL035C
          Length = 367

 Score =  459 bits (1181), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 217/342 (63%), Positives = 275/342 (80%), Gaps = 4/342 (1%)

Query: 1   MSVIPINLTSFGSNNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSIND 60
           MS   +   SFGS+NWCLKF+PLYN+GLLTSLSNGE+ +LDW+T       KI + SIN 
Sbjct: 1   MSYSLVQEQSFGSDNWCLKFQPLYNHGLLTSLSNGEVKLLDWETLNPVRNFKIDQVSINS 60

Query: 61  FEIVNNNYNGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTEL 120
            +++NN+YN  SL  TAT  SVKIYD+KSNDCI TITN+K SPFLSLDS H+M+ACGTEL
Sbjct: 61  MKLINNDYNNASLFATATLNSVKIYDIKSNDCIATITNDKKSPFLSLDSRHDMLACGTEL 120

Query: 121 SGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTET 180
            GVDAELYIYD+R+W +P++SFVDSHHDDITDIKFHP+DS  L+SGSTDGYTN+YDLT+ 
Sbjct: 121 QGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDLTQQ 180

Query: 181 EEEDSLHQVINYSSIHSCGWLSSRRIFTLSHMETFAIHQLNDKSEVLKEPKPIEFGDIRN 240
           EE+D+L+QVINY+SIHSCGWLS RRI+TLSHMETF+I +LND+++ L+EP+P++FGDIR+
Sbjct: 181 EEDDALYQVINYASIHSCGWLSPRRIYTLSHMETFSISELNDRTDELREPQPLDFGDIRD 240

Query: 241 DWGCNYVIDVYPGYIATGKTEESKGQLKISPFNNEKIDLAEDNNIIIPQAHGDEVIRDVF 300
            W C+YVID+YPGYIATG+++E  G L+I P + E ++ ++   I I +AH DEVIRDVF
Sbjct: 241 QWNCDYVIDIYPGYIATGRSQEGNGNLQIIPMDGETVESSK--AITIDRAHSDEVIRDVF 298

Query: 301 INPNDPSNMYSCGEDGNVKLWKIDTTTKSLKIPEHFFDYSLR 342
           I  N  + +YSCGEDG VK WK    ++S  + E F+DYS R
Sbjct: 299 IPRNHHNVLYSCGEDGTVKSWK-SPHSQSTAL-EEFWDYSQR 338

>Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score =  460 bits (1183), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 207/337 (61%), Positives = 270/337 (80%), Gaps = 4/337 (1%)

Query: 6   INLTSFGSNNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVN 65
           ++L SFGS NWCLK +P Y +GLLT LSNGEI +LDW T +   KI+  ET+IND +I++
Sbjct: 7   VDLNSFGSENWCLKLQPAYKHGLLTGLSNGEICLLDWNTGKPLQKIRASETAINDMKIID 66

Query: 66  NNYNGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDA 125
           +++  G+L+ +A+ +SVK++D++SNDC+  I NE NSPFLSLDS H ++ACGTEL G+DA
Sbjct: 67  SDFVAGNLISSASIDSVKVFDIRSNDCVAKINNETNSPFLSLDSRHGLLACGTELQGIDA 126

Query: 126 ELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDS 185
            ++IYD+R WD P+RS VDSHHDD+T IKFHP+D  VL+SGSTDGYTNIYDL + +EED+
Sbjct: 127 AIHIYDVRKWDAPLRSLVDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDDEEDA 186

Query: 186 LHQVINYSSIHSCGWLSSRRIFTLSHMETFAIHQLNDKSEVLKEPKPIEFGDIRNDWGCN 245
           LHQVINY+SIHSCGWLS +RI+TLSHMETF+IH+LNDKS+ LKEP+P++FGDIR  W C+
Sbjct: 187 LHQVINYASIHSCGWLSPKRIYTLSHMETFSIHELNDKSDELKEPQPLDFGDIRKAWNCD 246

Query: 246 YVIDVYPGYIATGKTEESKGQLKISPFNNEKIDLAEDNNIIIPQAHGDEVIRDVFINPND 305
           YV+DVYPG+IATGKT+E  G+L++ PF +EKID    N I+IP AHGDEV+RDVF++  +
Sbjct: 247 YVVDVYPGFIATGKTQEGAGELRLLPFKDEKIDTG--NGIVIPHAHGDEVVRDVFVSEQN 304

Query: 306 PSNMYSCGEDGNVKLWKIDTTTKSLKIPEHFFDYSLR 342
              +YSCGEDG VK+WK   +   L  P  F+DYS R
Sbjct: 305 TDVLYSCGEDGCVKIWK--NSLGCLNTPASFWDYSER 339

>Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score =  457 bits (1176), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 206/331 (62%), Positives = 262/331 (79%), Gaps = 4/331 (1%)

Query: 10  SFGSNNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNNNYN 69
           SFGS NWCLK +P Y YGLLT LSNGEI +LDW + Q   KIK  ETSIND +++++++ 
Sbjct: 11  SFGSENWCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETSINDLKVIDSDFA 70

Query: 70  GGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYI 129
            G L+ +A+ ++VK++D+++N C+  I NE NSPF+SLDS H ++ACGTEL G+DA +YI
Sbjct: 71  AGHLVSSASIDAVKVFDIRTNACVAKIHNEANSPFISLDSRHGLLACGTELQGIDAAVYI 130

Query: 130 YDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSLHQV 189
           YDIR WD P+RS +DSHHDD+T IKFHP+D  VL+SGSTDGYTNIYDL + EEED+LHQV
Sbjct: 131 YDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNIYDLKQDEEEDALHQV 190

Query: 190 INYSSIHSCGWLSSRRIFTLSHMETFAIHQLNDKSEVLKEPKPIEFGDIRNDWGCNYVID 249
           INY+SIHSCGWLS +RI+TLSHMETFAIH+LNDKS+  KEP+P +FGDIR  W C+YV+D
Sbjct: 191 INYASIHSCGWLSQKRIYTLSHMETFAIHELNDKSDEFKEPRPADFGDIREAWNCDYVVD 250

Query: 250 VYPGYIATGKTEESKGQLKISPFNNEKIDLAEDNNIIIPQAHGDEVIRDVFINPNDPSNM 309
           VYPG IATGKT+E  G+L++ PF +EK+D   +N I+IP+AHGDEV+RDVFI+      +
Sbjct: 251 VYPGLIATGKTQEGAGELRLLPFRDEKVD--AENEIVIPRAHGDEVVRDVFISALQSDLL 308

Query: 310 YSCGEDGNVKLWKIDTTTKSLKIPEHFFDYS 340
           YSCGEDG VK+WK       L  PE F+DYS
Sbjct: 309 YSCGEDGFVKIWK--NNLGPLNTPESFWDYS 337

>Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score =  451 bits (1159), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 201/330 (60%), Positives = 265/330 (80%), Gaps = 4/330 (1%)

Query: 11  FGSNNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNNNYNG 70
           FGS NWCLK +P Y +GLLT LSNGEI +LDW T +    IK  ET+IND ++++++++ 
Sbjct: 12  FGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNIKASETAINDLKVIDSDFSA 71

Query: 71  GSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYIY 130
           G L+ +A+ ++VK++D+++N CI TI NE NSPFLSLDS H ++ACGTEL G+DA ++IY
Sbjct: 72  GHLVSSASIDAVKVFDIRTNSCIATIQNESNSPFLSLDSRHGLLACGTELQGIDAAVHIY 131

Query: 131 DIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSLHQVI 190
           DIR WDTP+RS +DSHHDD+T IKFHP+D  +L+SGSTDGYTNIYDL + EEED+LHQVI
Sbjct: 132 DIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEEDALHQVI 191

Query: 191 NYSSIHSCGWLSSRRIFTLSHMETFAIHQLNDKSEVLKEPKPIEFGDIRNDWGCNYVIDV 250
           NY+SIHSCGWLS +RI+TLSHMETFAIH+LNDKS+ L+EP+P++FGD+R  W C+YV+D+
Sbjct: 192 NYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELREPQPLDFGDVRKAWDCDYVVDI 251

Query: 251 YPGYIATGKTEESKGQLKISPFNNEKIDLAEDNNIIIPQAHGDEVIRDVFINPNDPSNMY 310
           YPG IATGKT+E+ G+L++ PF NEKI    +   +IP AHGDEV+RD+FI+ +    +Y
Sbjct: 252 YPGLIATGKTQENAGELRLIPFKNEKI--YTEKCFVIPHAHGDEVVRDIFISAHQSDMLY 309

Query: 311 SCGEDGNVKLWKIDTTTKSLKIPEHFFDYS 340
           SCGEDG VK+WK  +T   L  PE F+DYS
Sbjct: 310 SCGEDGYVKIWK--STQGPLNTPETFWDYS 337

>YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON}
           Putative protein of unknown function with similarity to
           proteins containing WD-40 domains; green fluorescent
           protein (GFP)-fusion protein localizes to the nucleus;
           YNL035C is not an essential gene
          Length = 389

 Score =  450 bits (1158), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 204/333 (61%), Positives = 267/333 (80%), Gaps = 4/333 (1%)

Query: 10  SFGSNNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNNNYN 69
           SFGS NWCLK +P Y +GLLT LSNGEI +LDW T +   KIK  ET+IND +++ ++++
Sbjct: 11  SFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWSTGKSVQKIKASETAINDMKVIGSDFS 70

Query: 70  GGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYI 129
            G L+ +A+ ++VK++D+++ND I  I NE NSPF+SLDS H ++ACGTEL G+DA +YI
Sbjct: 71  AGHLVSSASIDAVKVFDIRTNDRIAQIQNEANSPFISLDSRHGLLACGTELQGIDAAVYI 130

Query: 130 YDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSLHQV 189
           YDIR WDTP+RS +DSHHDD+T IKFHP+D  +L+SGSTDGYTNIYDL + EEED+LHQV
Sbjct: 131 YDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQDEEEDALHQV 190

Query: 190 INYSSIHSCGWLSSRRIFTLSHMETFAIHQLNDKSEVLKEPKPIEFGDIRNDWGCNYVID 249
           INY+SIHSCGWLS +RIFTLSHMETFAIH+LNDKS+ LKEP+P++FGD+R  W C+YV+D
Sbjct: 191 INYASIHSCGWLSPKRIFTLSHMETFAIHELNDKSDELKEPQPLDFGDVREIWNCDYVVD 250

Query: 250 VYPGYIATGKTEESKGQLKISPFNNEKIDLAEDNNIIIPQAHGDEVIRDVFINPNDPSNM 309
           +YPG IATGKT+E+ G+L + PF +EK+D   +N I+IP AHGDEV+RD+FI     + +
Sbjct: 251 IYPGLIATGKTQENCGELCLLPFKDEKVD--TENGIVIPHAHGDEVVRDIFIPAQHSNML 308

Query: 310 YSCGEDGNVKLWKIDTTTKSLKIPEHFFDYSLR 342
           YSCGEDG VK+W  +     L IPE+F+DYS +
Sbjct: 309 YSCGEDGCVKIW--ENKQGPLDIPENFWDYSKK 339

>ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 376

 Score =  443 bits (1140), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 201/340 (59%), Positives = 264/340 (77%), Gaps = 4/340 (1%)

Query: 1   MSVIPINLTSFGSNNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSIND 60
           MS   +N  SFG+NNWCL  +P Y + LL SLSNG++  LDW+T +    IK GE ++N 
Sbjct: 1   MSYSLVNSESFGNNNWCLNLQPAYQHSLLASLSNGQVHQLDWQTGKSIAHIKTGEVAVNK 60

Query: 61  FEIVNNNYNGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTEL 120
            +++NN++   S   TAT  +VKI+D++SN+C+ TI+N+KN+PFLSLDS HNM+ACGTEL
Sbjct: 61  LKLINNDHENESTYATATMGAVKIWDIRSNNCLATISNDKNAPFLSLDSRHNMLACGTEL 120

Query: 121 SGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTET 180
           SG DAEL+IYD+R WD+P+RS VDSHHDDITDI FHP+D  VLMSGSTDGYTNIYDL + 
Sbjct: 121 SGSDAELHIYDVRKWDSPLRSLVDSHHDDITDIAFHPSDPNVLMSGSTDGYTNIYDLRQA 180

Query: 181 EEEDSLHQVINYSSIHSCGWLSSRRIFTLSHMETFAIHQLNDKSEVLKEPKPIEFGDIRN 240
           EEED+LHQVIN++SIHSCGWL+ RRIFTLSHMETF+IH+LNDKS+  KEP+P+EF D+R 
Sbjct: 181 EEEDALHQVINFASIHSCGWLAPRRIFTLSHMETFSIHELNDKSDEAKEPRPVEFNDVRE 240

Query: 241 DWGCNYVIDVYPGYIATGKTEESKGQLKISPFNNEKIDLAEDNNIIIPQAHGDEVIRDVF 300
            WGC+YV+D++PGY+A G ++E  G+L+I PF  E++D   +N I I  AHGDEV+RDVF
Sbjct: 241 SWGCDYVVDIHPGYVACGNSQEGIGKLRILPFQGEQVDT--NNAIDINAAHGDEVVRDVF 298

Query: 301 INPNDPSNMYSCGEDGNVKLWKIDTTTKSLKIPEHFFDYS 340
           +   +   +YSCGEDG+VK W  +  +  L + + F+DYS
Sbjct: 299 VPARNSKLLYSCGEDGSVKTW--ENKSGPLNVTDEFWDYS 336

>NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {ON}
           Anc_2.283 YNL035C
          Length = 397

 Score =  444 bits (1142), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 217/347 (62%), Positives = 270/347 (77%), Gaps = 9/347 (2%)

Query: 1   MSVIP---INLTSFGSNNWCLKFKPLYNY-GLLTSLSNGEISILDWKTNQIKDKIKIGET 56
           MS+ P   +N  SFGSNNWC KF+PL    GLL SLSNGEI  LD+ T Q K  I++   
Sbjct: 1   MSISPYSLLNSHSFGSNNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSIRVSNL 60

Query: 57  SINDFEIVNNNYNGGSLMVTATNESVKIYDLKSNDC-IKTITNEKNSPFLSLDSLHNMMA 115
           SIND +I+N++++ GSL  TAT ESVKI+D+ SN+  I T+ N+KN PFLSLDS H ++A
Sbjct: 61  SINDLKILNSDFHCGSLFSTATAESVKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLA 120

Query: 116 CGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIY 175
            GTEL GVDA++ IYDIR WDTP+RS +DSHHDD+T +KFHP+D  VL+SGSTDGYTN+Y
Sbjct: 121 MGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVY 180

Query: 176 DLTETEEEDSLHQVINYSSIHSCGWLSSRRIFTLSHMETFAIHQLNDKSEVLKEPKPIEF 235
           DLT+ +E+D+LHQV+NY+SIHSCGWLS  RIFTLSHMETFAIH+LNDKSE LKEP+P++F
Sbjct: 181 DLTQQDEDDALHQVMNYASIHSCGWLSPNRIFTLSHMETFAIHELNDKSEELKEPQPLDF 240

Query: 236 GDIRNDWGCNYVIDVYPGYIATGKTEESKGQLKISPFNNEKIDLAEDNNIIIPQAHGDEV 295
           GD+R  WGC+YVIDVYPGYIA GK++E  GQLK+ P N E I + +  +++IP AHGDEV
Sbjct: 241 GDVREKWGCDYVIDVYPGYIAAGKSQEGNGQLKLIPTNGENISVKD--SVVIPSAHGDEV 298

Query: 296 IRDVFINPNDPSNMYSCGEDGNVKLWKIDTTTKSLKIPEHFFDYSLR 342
           IRDVFI P+    +YSCGEDG V LWK      +L +PE F+DYS R
Sbjct: 299 IRDVFIPPSHSELVYSCGEDGFVNLWK--NNNGALNVPEQFWDYSKR 343

>KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 426

 Score =  445 bits (1144), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 203/340 (59%), Positives = 263/340 (77%), Gaps = 4/340 (1%)

Query: 1   MSVIPINLTSFGSNNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSIND 60
           MS   +    FG NNWCLK +P+YN GLLTSLSNG + ++DW T++   +I+   TS+ND
Sbjct: 20  MSYSKLESIEFGPNNWCLKLQPIYNSGLLTSLSNGRVELIDWATHKSILQIQTHATSVND 79

Query: 61  FEIVNNNYNGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTEL 120
             I+NN+   GSL+ TA  ++VKIYDLKSNDC+ T+ N K++PFLSLDS H ++ CGTEL
Sbjct: 80  MVIINNDRMNGSLIATAAEDAVKIYDLKSNDCVATLKNGKSAPFLSLDSRHGLLGCGTEL 139

Query: 121 SGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTET 180
           SGVDAEL++YDIRSW  P+RS VDSHHDDIT IKFHP+D  VL+SGSTDGY NIYDLT+ 
Sbjct: 140 SGVDAELHVYDIRSWQQPLRSLVDSHHDDITSIKFHPSDPNVLLSGSTDGYVNIYDLTQQ 199

Query: 181 EEEDSLHQVINYSSIHSCGWLSSRRIFTLSHMETFAIHQLNDKSEVLKEPKPIEFGDIRN 240
           EE+D+LHQVIN++SIHSCGWLS +RI+TLSHMET+ IH+LNDK +   EPKP++FGD+R 
Sbjct: 200 EEDDALHQVINFASIHSCGWLSPKRIYTLSHMETYGIHELNDKRDEPTEPKPVDFGDVRK 259

Query: 241 DWGCNYVIDVYPGYIATGKTEESKGQLKISPFNNEKIDLAEDNNIIIPQAHGDEVIRDVF 300
            W CNYVIDVYPG+IATGK+EE +G+LK+ P ++EK +L   + I IP AH DEV+RDV 
Sbjct: 260 PWDCNYVIDVYPGFIATGKSEEGRGELKLIPLDHEKPELQ--SAITIPSAHDDEVVRDVL 317

Query: 301 INPNDPSNMYSCGEDGNVKLWKIDTTTKSLKIPEHFFDYS 340
           +       +YSCGEDG++K+WK  ++   L +P+ F+ YS
Sbjct: 318 VPFQHEDLLYSCGEDGSLKVWK--SSAGPLNVPQEFWQYS 355

>NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283
          Length = 389

 Score =  442 bits (1136), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 212/339 (62%), Positives = 259/339 (76%), Gaps = 6/339 (1%)

Query: 6   INLTSFGSNNWCLKFKPLY--NYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEI 63
           +N  SFGSNNW LK +PL   N GLLTSLSNGE+  LD  T     K  I ETSIND ++
Sbjct: 8   VNSRSFGSNNWALKLQPLQHGNNGLLTSLSNGEVHYLDPSTLTTIQKYNISETSINDLQL 67

Query: 64  VNNNYNGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGV 123
           +N+N     L  TAT+ SVKI+D+ S   + TI ++ N PF SLDS H ++ACGTEL GV
Sbjct: 68  INHNPTSSPLFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLDSRHGLLACGTELKGV 127

Query: 124 DAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEE 183
           DA +YIYDIR WD P+RS VDSHHDD+T +K+HPND  +L+SGSTDGYTN+YDL+E EEE
Sbjct: 128 DAAIYIYDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSEAEEE 187

Query: 184 DSLHQVINYSSIHSCGWLSSRRIFTLSHMETFAIHQLNDKSEVLKEPKPIEFGDIRNDWG 243
           DSLHQVIN++SIHSCGWLS RRIFTLSHMETFAIH+LNDKS+ LKEP+PI+ GD+R  WG
Sbjct: 188 DSLHQVINFASIHSCGWLSPRRIFTLSHMETFAIHELNDKSDTLKEPQPIDMGDVREKWG 247

Query: 244 CNYVIDVYPGYIATGKTEESKGQLKISPFNNEKIDLAEDNNIIIPQAHGDEVIRDVFINP 303
           C+YV+DVYPG+IATGK++E +G+LK+ P  +E IDL   N+I+IP AH DEVIRDV+I  
Sbjct: 248 CDYVVDVYPGFIATGKSQERQGELKLIPLQDETIDLT--NSIVIPGAHDDEVIRDVYIPS 305

Query: 304 NDPSNMYSCGEDGNVKLWKIDTTTKSLKIPEHFFDYSLR 342
           +D   MY+CGEDGNVKLWK       L +PE  +DYS R
Sbjct: 306 HDSVMMYTCGEDGNVKLWK--NNNGPLNVPEQLWDYSKR 342

>Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {ON}
           complement(85833..86999) [1167 nt, 389 aa]
          Length = 388

 Score =  439 bits (1130), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 203/335 (60%), Positives = 267/335 (79%), Gaps = 6/335 (1%)

Query: 10  SFGSNNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNNNYN 69
           S G  +WCL+ +PLY +GLL+SLSNG++++LDW T      +K G TSIN   +++++Y+
Sbjct: 11  SLGRTDWCLELQPLYRHGLLSSLSNGDVNLLDWNTGNCIRTVKAGNTSINRMRVLDSDYD 70

Query: 70  GGSLMVTATNESVKIYDLK--SNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAEL 127
            GS+   A N++VK+ DL+   N  +  + NEK +PFLSLDS H M+ACGTELSGVDAE+
Sbjct: 71  NGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACGTELSGVDAEI 130

Query: 128 YIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSLH 187
           +IYDIR++D P+R  VDSHHDD+TDIKFHP+D  VL+SGSTDGYTN+YDLT+ EEED+LH
Sbjct: 131 HIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEEDALH 190

Query: 188 QVINYSSIHSCGWLSSRRIFTLSHMETFAIHQLNDKSEVLKEPKPIEFGDIRNDWGCNYV 247
           QVINY S+HSCGWLS +RI+TLSHMETFAIH+LN+KS+ L EPKP++FGDIR  W C+YV
Sbjct: 191 QVINYESVHSCGWLSPKRIYTLSHMETFAIHELNNKSDELTEPKPLDFGDIRGTWDCDYV 250

Query: 248 IDVYPGYIATGKTEESKGQLKISPFNNEKIDLAEDNNIIIPQAHGDEVIRDVFINPNDPS 307
           +DVYPGYIA GK+EE+ G LKI PF+NE +++  +++I IP AHGDEV+RDVFI+P   +
Sbjct: 251 VDVYPGYIAVGKSEENNGNLKIIPFHNELLNI--NDSISIPNAHGDEVVRDVFISPKSQN 308

Query: 308 NMYSCGEDGNVKLWKIDTTTKSLKIPEHFFDYSLR 342
            MYSCGEDG+VK WKI+    SL++P  F+DYS +
Sbjct: 309 IMYSCGEDGSVKTWKIE--NNSLQVPPGFWDYSTQ 341

>KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 422

 Score =  437 bits (1123), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 197/331 (59%), Positives = 264/331 (79%), Gaps = 4/331 (1%)

Query: 11  FGSNNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNNNYNG 70
           F  NNWCLK +PLY +GL+TS+S+G + +LDW   +    I+   TSIND +++N++++ 
Sbjct: 11  FEENNWCLKLQPLYQHGLMTSISDGSVHLLDWGNLKTISSIQCHTTSINDMKVINSDFDT 70

Query: 71  GSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYIY 130
           G++  TA  + VK++D+++ + + ++ N+K SPF SLDS HNM+ACGTEL   DAEL+IY
Sbjct: 71  GAVFATAAEDGVKVWDIRARNNVASLQNDKASPFFSLDSRHNMLACGTELKDYDAELHIY 130

Query: 131 DIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSLHQVI 190
           DIR+W  P+RSFVDSHHDDITDIKFHP DS +LMSGSTDGY NIYDLT+ +EED+LHQVI
Sbjct: 131 DIRNWTKPVRSFVDSHHDDITDIKFHPCDSNLLMSGSTDGYVNIYDLTQDDEEDALHQVI 190

Query: 191 NYSSIHSCGWLSSRRIFTLSHMETFAIHQLNDKSEVLKEPKPIEFGDIRNDWGCNYVIDV 250
           N++SIHSCGWL  +RI++LSHMETF IH+LNDKS+ + EPKP+EFGD+R+ WGC+YVID+
Sbjct: 191 NFASIHSCGWLGPKRIWSLSHMETFGIHELNDKSDEMIEPKPLEFGDVRDKWGCDYVIDI 250

Query: 251 YPGYIATGKTEESKGQLKISPFNNEKIDLAEDNNIIIPQAHGDEVIRDVFINPNDPSNMY 310
           YP +IATGKT ES+G+LKI PF NE++D++  + ++IP AHG+EVIRDV I  N  S +Y
Sbjct: 251 YPSFIATGKTHESQGELKIIPFQNEQVDVS--SALVIPDAHGNEVIRDVLIPKNQTSLLY 308

Query: 311 SCGEDGNVKLWKIDTTTKSLKIPEHFFDYSL 341
           SCGEDG V +WK   TT SL +P +F+DY+L
Sbjct: 309 SCGEDGYVNVWK--DTTNSLNVPHNFWDYTL 337

>SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 398

 Score =  434 bits (1117), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 198/342 (57%), Positives = 264/342 (77%), Gaps = 4/342 (1%)

Query: 1   MSVIPINLTSFGSNNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSIND 60
           MS   ++  SFG  NWCL+ +PLYN GLLTSLSNG I ++DW T +I  +      SI++
Sbjct: 1   MSYSKLHTASFGCENWCLQLQPLYNRGLLTSLSNGHIHLVDWCTGEIIHEFAAHSASISN 60

Query: 61  FEIVNNNYNGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTEL 120
            +++NN +    L  +A+ +SVKI+D++++ C+ T+ N+K++PFLSLDS H+M+ACGTEL
Sbjct: 61  LKVLNNEFTNSDLFASASKDSVKIFDVRTSSCVATLHNDKSAPFLSLDSRHDMLACGTEL 120

Query: 121 SGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTET 180
           SGVDAEL+IYDI+    P+RSFVDSHHDDITD KFHP D  VLMSGSTDGY NIYDLT +
Sbjct: 121 SGVDAELHIYDIKKLSKPLRSFVDSHHDDITDTKFHPGDPGVLMSGSTDGYVNIYDLTNS 180

Query: 181 EEEDSLHQVINYSSIHSCGWLSSRRIFTLSHMETFAIHQLNDKSEVLKEPKPIEFGDIRN 240
           +EED+LHQVIN++S+HSCGWL+ RRI+TLSHMETFAIH+LNDKS+ L+EPKP+EFGD+R 
Sbjct: 181 DEEDALHQVINFASVHSCGWLAPRRIYTLSHMETFAIHELNDKSDDLREPKPVEFGDVRQ 240

Query: 241 DWGCNYVIDVYPGYIATGKTEESKGQLKISPFNNEKIDLAEDNNIIIPQAHGDEVIRDVF 300
            WGC+Y+I++ PG+IA G+++E++G+LK+  FN+EK+D    N + IPQAHGDE+IRDV 
Sbjct: 241 PWGCDYIININPGFIAAGRSQETQGELKLIAFNDEKVDTT--NVLTIPQAHGDEIIRDVL 298

Query: 301 INPNDPSNMYSCGEDGNVKLWKIDTTTKSLKIPEHFFDYSLR 342
           I       +YSCGEDG + +WK  + T  L I   F+DYS R
Sbjct: 299 IPDQTTDMLYSCGEDGCLNIWK--SQTGPLNISRDFWDYSKR 338

>TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {ON}
           Anc_2.283 YNL035C
          Length = 392

 Score =  429 bits (1103), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 195/337 (57%), Positives = 261/337 (77%), Gaps = 4/337 (1%)

Query: 6   INLTSFGSNNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVN 65
           ++   FGS+NWCL  +P YN+ LLTSLSNGE+  +DW T +     + G +SIN  +I++
Sbjct: 7   LHTQDFGSDNWCLGLQPFYNHHLLTSLSNGEVHHIDWVTGKSVRVDQAGNSSINKLKIID 66

Query: 66  NNYNGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDA 125
           +N+N GS    A+N+SV I D++S D + ++ N+KN+PFLSLDS H M+ACGTELSGVDA
Sbjct: 67  SNFNEGSSYAVASNDSVNILDVRSRDKLASLKNDKNAPFLSLDSRHGMLACGTELSGVDA 126

Query: 126 ELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDS 185
           EL+IYD+R+W TPIRSFVDSHHDD+TDI+FHP+D  VL+SGSTDGYTN+YDL + EE+D+
Sbjct: 127 ELHIYDVRNWSTPIRSFVDSHHDDVTDIRFHPSDRNVLLSGSTDGYTNVYDLKQQEEDDA 186

Query: 186 LHQVINYSSIHSCGWLSSRRIFTLSHMETFAIHQLNDKSEVLKEPKPIEFGDIRNDWGCN 245
           LHQVINY+SIHSCGWLS +RIFTLSHMET A+H+LNDKS+ L+EP+P++FGDIR  WGC+
Sbjct: 187 LHQVINYASIHSCGWLSPKRIFTLSHMETLAMHELNDKSDELREPQPLDFGDIREKWGCS 246

Query: 246 YVIDVYPGYIATGKTEESKGQLKISPFNNEKIDLAEDNNIIIPQAHGDEVIRDVFINPND 305
           YV+D+YPGY+A G ++E    LK+    NE+I+   + +++IP AHG+EV+RDV I P +
Sbjct: 247 YVVDLYPGYVAVGSSQERSSFLKLMALENEQIET--EKSLVIPSAHGEEVVRDVLIPPQN 304

Query: 306 PSNMYSCGEDGNVKLWKIDTTTKSLKIPEHFFDYSLR 342
            + +YSCGEDG VK+WK  T      I   F+DYS +
Sbjct: 305 CNMLYSCGEDGTVKIWK--TKDTGFHIEPGFWDYSKK 339

>Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035C -
           Hypothetical ORF [contig 27] FULL
          Length = 407

 Score =  427 bits (1097), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 194/340 (57%), Positives = 259/340 (76%), Gaps = 4/340 (1%)

Query: 1   MSVIPINLTSFGSNNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSIND 60
           MS   ++  +FG++NWCLK +PLYN GLL SLSNG + ++DW  N+   +I+   T+I+D
Sbjct: 1   MSYSKVDSINFGADNWCLKLQPLYNRGLLASLSNGSVQLIDWVKNKQISQIQAHGTTISD 60

Query: 61  FEIVNNNYNGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTEL 120
             ++NN+ N G L+ TA  +SVKI+DL+S+D + T+ NEK++PFLSLDS H M+ACGTEL
Sbjct: 61  MVVLNNDRNNGFLIATAAEDSVKIFDLRSSDTVATLKNEKSAPFLSLDSRHGMLACGTEL 120

Query: 121 SGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTET 180
           SGVDAEL+IYD+++W  P+RS VDSHHDDIT+IKFHP D  VL+SGSTDGY NIYDLT+ 
Sbjct: 121 SGVDAELHIYDMKAWHQPLRSLVDSHHDDITNIKFHPTDPNVLLSGSTDGYVNIYDLTQP 180

Query: 181 EEEDSLHQVINYSSIHSCGWLSSRRIFTLSHMETFAIHQLNDKSEVLKEPKPIEFGDIRN 240
           EE+D+LHQVIN++SIHS GW + +RI+TLSHMETF IH+LNDK E   EP P +FGDIR 
Sbjct: 181 EEDDALHQVINFASIHSSGWCAPKRIYTLSHMETFGIHELNDKLEEPTEPHPKDFGDIRQ 240

Query: 241 DWGCNYVIDVYPGYIATGKTEESKGQLKISPFNNEKIDLAEDNNIIIPQAHGDEVIRDVF 300
            WGC+YV+DVYPG+IATGK++E +G++K+ PF  E +DL  D+ + IP AHGDEV+RDV 
Sbjct: 241 SWGCDYVVDVYPGFIATGKSQEGQGEVKLIPFTGEDLDL--DSAVTIPSAHGDEVVRDVL 298

Query: 301 INPNDPSNMYSCGEDGNVKLWKIDTTTKSLKIPEHFFDYS 340
           +       +Y+CGEDG V  WK  +    L +P+ F+ Y+
Sbjct: 299 VPFQHEDMLYTCGEDGCVNAWK--SNRGPLNVPQEFWSYA 336

>TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {ON}
           Anc_2.283 YNL035C
          Length = 413

 Score =  421 bits (1082), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 194/343 (56%), Positives = 265/343 (77%), Gaps = 7/343 (2%)

Query: 1   MSVIPINLTSFGSNNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSIND 60
           MS   +N  +FG++NWCL+ KPLY+ GLL S SNG ++++DW +  I  K ++GET+IN 
Sbjct: 1   MSAKLVNQITFGNDNWCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNINS 60

Query: 61  FEIVNNNYNGGSLMVTATNESVKIYDLKSNDC-IKTITNEKNSPFLSLDSLHNMMACGTE 119
             ++NN++  G +    +  SVKIYD+++ D  + TI N+KNS FLSL+S H+M+ CGTE
Sbjct: 61  LRVINNDFENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDMLVCGTE 120

Query: 120 LSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTE 179
           L+GVDAE++IYD+R +  P+R+FVDSHHDDITDIKFHP+D  +L+SGSTDGYTNIYDL +
Sbjct: 121 LTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNIYDLAQ 180

Query: 180 TEEEDSLHQVINYSSIHSCGWLSSRRIFTLSHMETFAIHQLNDKSEVLKEPKPIEFGDIR 239
            +E+++LHQVINY+SIHSCGWLS +RI+TLSHMETFAIH+LNDKS+ L EP+P++FGDIR
Sbjct: 181 EDEDEALHQVINYASIHSCGWLSPKRIYTLSHMETFAIHELNDKSDELTEPRPLDFGDIR 240

Query: 240 NDWGCNYVIDVYPGYIATGKTEESKGQLKISPFNNEKIDLAEDNNIIIPQAHGDEVIRDV 299
             W C+YV+D+YPGY+A GK+ E+ G+LKI  F NE ++   +N+IIIP AHGDEVIRDV
Sbjct: 241 GQWDCDYVVDLYPGYVAMGKSAENAGELKICGFENEIMN--TENHIIIPNAHGDEVIRDV 298

Query: 300 FINPNDPSN----MYSCGEDGNVKLWKIDTTTKSLKIPEHFFD 338
           FI P + +N    +YSCGEDGNV +W     +  L + + F++
Sbjct: 299 FIPPGNLNNHSDIIYSCGEDGNVNIWHAPRCSSILNVSKDFWN 341

>KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.283
           YNL035C
          Length = 399

 Score =  416 bits (1070), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 193/332 (58%), Positives = 260/332 (78%), Gaps = 5/332 (1%)

Query: 11  FGSNNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNNNYNG 70
           FGS NWC + +PLY  G+LTSLSNGE+ ++DWK+N+  +K K  ET+IN  +IVN +++ 
Sbjct: 12  FGSENWCFQIQPLYKAGILTSLSNGEVHLMDWKSNKSINKFKSDETAINALQIVNTDWHN 71

Query: 71  GSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYIY 130
            +  +TA+  +VK++D++SN CI TI NE  +PFLSLDS ++ +ACGTEL GVDA+L+I+
Sbjct: 72  ETRFITASMHAVKLFDVRSNACIGTIHNEVGAPFLSLDSRYDKIACGTELKGVDAQLHIF 131

Query: 131 DIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSLHQVI 190
           D+R  D P +S VDSHHDDIT IKFHP+D  VL+SGSTDGYTNIYDL++ EE+DSLHQVI
Sbjct: 132 DLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLSQEEEDDSLHQVI 191

Query: 191 NYSSIHSCGWLSSRRIFTLSHMETFAIHQLNDKSEVLKEPKPIEFGDIRNDWGCNYVIDV 250
           N++SIHSCGW++ +RI+TLSHMETFAIH+LN+KS+ L EP+P++FGDIR  WGC+YV+D+
Sbjct: 192 NFTSIHSCGWVNPKRIYTLSHMETFAIHELNNKSDELTEPQPLDFGDIRAAWGCDYVVDI 251

Query: 251 YPGYIATGKT-EESKGQLKISPFNNEKIDLAEDNNIIIPQAHGDEVIRDVFINPNDPSNM 309
           YPGY+ATGK+ EE KG+LK+ P   E + +  DN I IP AHGDEVIRDVFI   +   +
Sbjct: 252 YPGYVATGKSHEEGKGELKLIPLKGENVVI--DNTISIPSAHGDEVIRDVFIPEQNSEVV 309

Query: 310 YSCGEDGNVKLWKIDTTTKSLKIPEHFFDYSL 341
           YSCGEDG + +W+    +  L +PE F++Y +
Sbjct: 310 YSCGEDGYLNIWR--NNSGPLNVPEKFWNYDI 339

>Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL218C
          Length = 409

 Score =  410 bits (1055), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 190/339 (56%), Positives = 257/339 (75%), Gaps = 5/339 (1%)

Query: 1   MSVIPINLTSFGSNNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSIND 60
           MS    +  SFGS+NWCLK +PLY+ GLL++LSNG + ++DW +      I +  TSI+ 
Sbjct: 1   MSYTKCDTISFGSDNWCLKLQPLYSRGLLSALSNGHVHLIDWNSLTSIQDIPVHGTSISA 60

Query: 61  FEIVNNNYNGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTEL 120
            ++++N+ + G+  VTA+ +SVKI+DL+ N C+ T+ N KNSPF+SLDS H M+ACGTEL
Sbjct: 61  LKVLDNDVDSGNTFVTASEDSVKIFDLRLNQCVATVQNAKNSPFISLDSRHGMLACGTEL 120

Query: 121 SGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTET 180
           SG DAE+++YD++  D P+RSF DSHHDDITDIKFH +D  VL+SGSTDGY N+YDL + 
Sbjct: 121 SGTDAEIHLYDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQQ 180

Query: 181 EEEDSLHQVINYSSIHSCGWLSSRRIFTLSHMETFAIHQLNDKSEVLKEPKPIEFGDIRN 240
           EEE++LHQVIN++SIHSCGWLS +RI+ LSHMETF+IH+LNDKS+ L EPKP+EFGDIR 
Sbjct: 181 EEEEALHQVINFASIHSCGWLSPKRIWALSHMETFSIHELNDKSDELVEPKPLEFGDIRK 240

Query: 241 DWGCNYVIDVYPGYIATGKTEESKGQLKISPFNNEKIDLAEDNNIIIPQAHGDEVIRDVF 300
            W C+YV+D++PG I TG T+E +  L++ PF+NE++D    N+IIIP+AHGDEV+RD  
Sbjct: 241 PWNCDYVVDIFPGCIITGSTQE-QSMLQLLPFSNEEVDTT--NSIIIPRAHGDEVVRDAL 297

Query: 301 INPNDPSNMYSCGEDGNVKLWKIDTTTKSLKIPEHFFDY 339
           I+       YS GEDGN+ LWK  +   SL +P  F++Y
Sbjct: 298 IHKTTSELFYSGGEDGNIVLWK--SNRGSLNVPTEFWNY 334

>ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL035C
          Length = 403

 Score =  406 bits (1043), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 175/340 (51%), Positives = 252/340 (74%), Gaps = 4/340 (1%)

Query: 1   MSVIPINLTSFGSNNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSIND 60
           MS I     SFG++NWCL+ +PLY  G+L +LSNG + ++DW T +    +   E+SIN 
Sbjct: 1   MSYILQQKVSFGADNWCLRLRPLYQAGVLAALSNGHVHLVDWATGKSVLDVAAHESSING 60

Query: 61  FEIVNNNYNGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTEL 120
            +++++ ++ G++  TA ++ VK++D+++  C+ T+T+   +P LSLDS H M+A GTEL
Sbjct: 61  LQVLDSAHDRGTVFATAADDGVKLFDIRTRGCVATLTDANGAPALSLDSRHGMLAFGTEL 120

Query: 121 SGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTET 180
            GVDA + ++ +  W  P+R+FVDSHHDD+TD+KFHP DS +L+SGSTDGY N+YDL ++
Sbjct: 121 VGVDAVVSLFALGEWGRPLRAFVDSHHDDVTDVKFHPTDSNLLLSGSTDGYVNVYDLKQS 180

Query: 181 EEEDSLHQVINYSSIHSCGWLSSRRIFTLSHMETFAIHQLNDKSEVLKEPKPIEFGDIRN 240
           EE+++LHQVIN++SIHSCGWLS +RI++LSHMETFAIH+LNDKSE   EP+P  FGD+R 
Sbjct: 181 EEDEALHQVINFASIHSCGWLSPKRIWSLSHMETFAIHELNDKSEHANEPQPQLFGDVRE 240

Query: 241 DWGCNYVIDVYPGYIATGKTEESKGQLKISPFNNEKIDLAEDNNIIIPQAHGDEVIRDVF 300
            W C+YV+DVYPG+IA G T E+ G+L++ P  +E +D A  N I++PQAHGDEV+RDV 
Sbjct: 241 PWACDYVVDVYPGFIAAGSTRENAGELRLLPLRDECVDAA--NAIVLPQAHGDEVVRDVL 298

Query: 301 INPNDPSNMYSCGEDGNVKLWKIDTTTKSLKIPEHFFDYS 340
           +  + P  +YS GEDGN+ +WK  +T   L +P  F+DYS
Sbjct: 299 VPASSPELLYSAGEDGNMAIWK--STLGPLNVPVDFWDYS 336

>CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035c
          Length = 376

 Score =  397 bits (1020), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 191/332 (57%), Positives = 244/332 (73%), Gaps = 10/332 (3%)

Query: 11  FGSNNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNNNYNG 70
           FGSNNWCLK +P++N G+LTS+S+GE+ +L    ++ +D  K+GETSIN    V+   N 
Sbjct: 10  FGSNNWCLKLQPVHN-GILTSVSSGEVHLLGLDLSK-QDSFKVGETSINALSRVDGQEN- 66

Query: 71  GSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYIY 130
             L   +    VK++DL+ N  + T+  E  +  LSL S H M+A G+E  GVDA L+++
Sbjct: 67  --LFAASNGNKVKVFDLRENKEVATLEQENGANVLSLGSGHGMLAYGSEQQGVDAHLHLF 124

Query: 131 DIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSLHQVI 190
           DIR+W  P+RSFVDSH DDIT I FHP D+ VL+SGSTDGYTN+YDL E EEED+LHQVI
Sbjct: 125 DIRNWSKPVRSFVDSHQDDITSIAFHPADANVLLSGSTDGYTNVYDLLEPEEEDALHQVI 184

Query: 191 NYSSIHSCGWLSSRRIFTLSHMETFAIHQLNDKSEVLKEPKPIEFGDIRNDWGCNYVIDV 250
           NY+SIHSCGWL+ RRIFTLSHMETFAIH+LNDKSE L+EP+P++FGDIR  W CNYV+D+
Sbjct: 185 NYASIHSCGWLAPRRIFTLSHMETFAIHELNDKSEELREPQPLDFGDIRQPWDCNYVVDI 244

Query: 251 YPGYIATGKTEESKGQLKISPFNNEKIDLAEDNNIIIPQAHGDEVIRDVFINPNDPSNMY 310
           YPGYI+ G +EE KG L+I PF NE +  A+D  I I QAHGDE++RD +I P+    +Y
Sbjct: 245 YPGYISAGVSEEGKGALRIIPFRNEHVQ-AKD-TITISQAHGDEIVRDTYILPSQSDMLY 302

Query: 311 SCGEDGNVKLWKIDTTTKSLKIPEHFFDYSLR 342
           SCGEDG VK W+ D     L IPE F+DYS +
Sbjct: 303 SCGEDGQVKAWRNDI---KLDIPETFWDYSTK 331

>KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {ON}
           Anc_6.9 YEL056W
          Length = 414

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 87/187 (46%), Gaps = 15/187 (8%)

Query: 6   INLTSFGSNNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQ---IKDKIKIGETSINDFE 62
           I L     N + L F PL    LL+   +  +++ D  +++   ++    I    +ND +
Sbjct: 170 ITLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVTSDRNEPVQKWENIHSDIVNDCQ 229

Query: 63  IVNNNYNGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLH---NMMACGTE 119
              +N+        + + S++I+D + +  + TI   K  PF +L   H   N++A G  
Sbjct: 230 W--HNFQKSLFGTVSEDSSLQIHDTRESKPVATINGTK--PFNTLSFSHHSENLLATG-- 283

Query: 120 LSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTE 179
             GV++E+Y+YD R  + P+   +  H D +T + F   D  +++S   D    I+D+ +
Sbjct: 284 --GVNSEVYLYDRRYVEEPLH-LMSGHTDAVTSLDFSSQDDGIILSAGADKRVIIWDIND 340

Query: 180 TEEEDSL 186
              E  L
Sbjct: 341 IGAEQVL 347

>TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa]
           {ON} Anc_6.9 YEL056W
          Length = 407

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 89/187 (47%), Gaps = 19/187 (10%)

Query: 8   LTSFGSNNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSI-NDFEIVNN 66
           L+    N + L F PL    LL+S  +G ++   W   +    + + ETSI ND     N
Sbjct: 165 LSHHKENGYGLAFNPLDKGKLLSSSDDGSVAY--WNIQKSIPLLTLQETSIINDVRW--N 220

Query: 67  NYNGGSLMVTATNESVKIYDLKSNDC-IKTITNEK-------NSPFLSLDSLHNMMACGT 118
            +N         +  + + D+++N+  +K ++N         N+   S  S + M A   
Sbjct: 221 QFNQNLFGYVTESSCLNLKDVRNNNNDLKIVSNHDIKTPSAFNAMAFSFHSEYLMAA--- 277

Query: 119 ELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLT 178
             SG D+ +Y+YD R+ + P+  ++  H D +T + FH  +  +++SG +D    ++DL 
Sbjct: 278 --SGEDSLIYLYDTRNLNQPLH-YMRGHEDSVTSLDFHALNDGIVISGGSDKRVAVWDLK 334

Query: 179 ETEEEDS 185
           +  +E +
Sbjct: 335 QIGQEQT 341

>NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9
          Length = 438

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/179 (28%), Positives = 89/179 (49%), Gaps = 17/179 (9%)

Query: 14  NNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQI--KDKIKIGETSINDFEIVN----NN 67
           N + L F P     LL+   +G I++ D + N    K  +KI ++  ND  IVN    N 
Sbjct: 198 NGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHND--IVNDCKWNE 255

Query: 68  YNGGSLMVTATNESVKIYDLK-SNDCIKTI--TNEKNSPFLSLDSLHNMMACGTELSGVD 124
           +N       + + +++++D +  N  I +I  T+  N+   S  S + M A GT     D
Sbjct: 256 FNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGT-----D 310

Query: 125 AELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEE 183
           + +Y+YD R+   P+ S ++ H D IT+++F P+   VL+S   D    ++D+ +   E
Sbjct: 311 SLVYLYDSRNLSVPLYS-MNGHEDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAE 368

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 53/229 (23%), Positives = 91/229 (39%), Gaps = 57/229 (24%)

Query: 146 HHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEE--------DSLHQVINYSSIHS 197
           H ++   + F+PND   L+SGS DG   ++D+ E            DS+H  I    ++ 
Sbjct: 195 HKENGYGLSFNPNDKGKLLSGSDDGTIALWDIQENSTLAKKPLKIWDSVHNDI----VND 250

Query: 198 CGW--LSSRRIFTLSHMETFAIHQLNDKSEVLKEPK------PIEFGD----IRNDWGCN 245
           C W   +S    ++S   T  +H   +++ ++   K       + F      +    G +
Sbjct: 251 CKWNEFNSNVFASVSEDSTLQLHDQREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTD 310

Query: 246 YVIDVY-------PGYIATGKTEESKGQLKISPF---------NNEKI------------ 277
            ++ +Y       P Y   G  E+S   L+ SP          N+ ++            
Sbjct: 311 SLVYLYDSRNLSVPLYSMNGH-EDSITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQ 369

Query: 278 --DLAEDN--NIIIPQAHGDEVIRDVFINPNDPSNMYSCGEDGNVKLWK 322
             D AED    +I+  A     + D  INPN P  M S  E+  +++WK
Sbjct: 370 IPDDAEDGAPEVIMIHAGHRSAVNDFSINPNIPWLMASAEEENIIQVWK 418

>KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9
           YEL056W
          Length = 391

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 52/189 (27%), Positives = 97/189 (51%), Gaps = 21/189 (11%)

Query: 5   PINLTSFGSNN-WCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETS----IN 59
           P+   S+  +N + L F P+    LL++  +G I++ D    + +D ++  +++    IN
Sbjct: 143 PVKTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINA-ESEDPVETWQSTDNCIIN 201

Query: 60  DFEIVNNNYNGGSLMVTATNE--SVKIYDLKSNDCIKTITNEKNSPFLSLD-SLH--NMM 114
           D   +  ++   +L  T + E  ++ IYDL++ D + +I  E+  PF SL  S H  N+ 
Sbjct: 202 D---IKWHHFDATLFGTVSEEKNTLSIYDLRTKDKVTSIEMEQ--PFNSLAFSKHSKNLF 256

Query: 115 ACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNI 174
           +      G D  +Y+YD+R+    + S +  H   +T+++FH +   +L+S S D    I
Sbjct: 257 SAA----GTDQNVYLYDLRNTRKTLHS-MSGHEGPVTNLEFHDSVDGILVSSSEDRRIII 311

Query: 175 YDLTETEEE 183
           +DL E   E
Sbjct: 312 WDLMEIGSE 320

 Score = 33.5 bits (75), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 129 IYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEE 183
           I+D  S D+P++++   H D+   + F+P     L+S + DGY  +YD+    E+
Sbjct: 134 IFDRNSSDSPVKTY-SYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDINAESED 187

>Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 86/180 (47%), Gaps = 16/180 (8%)

Query: 14  NNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIK-IGETSINDFEIVNN----NY 68
           N + L F PL   GLL S S+     L W  N   D  + I   S    +IVN+    N+
Sbjct: 162 NGYALSFSPLVE-GLLLSGSDDHTVAL-WDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNF 219

Query: 69  NGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLH---NMMACGTELSGVDA 125
           N       + +  +KI DL+  +   T T +   PF +L   H   N++A     +G D+
Sbjct: 220 NKDLFGTVSEDSLLKINDLRVENTT-TGTAKCPEPFNTLAFSHHSSNLLAA----AGTDS 274

Query: 126 ELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDS 185
            +Y+YD+R+   P+   +  H D +T+++F P+   V++S  +D    ++DL +   E +
Sbjct: 275 HVYLYDLRNMKEPLH-HMSGHEDAVTNLEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQT 333

>CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056w HAT2
          Length = 419

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 83/185 (44%), Gaps = 19/185 (10%)

Query: 14  NNWCLKFKPLYNYGLLTSLSNGEISILDWKT--NQIKDKIKIGETSINDFEIVNNNYNGG 71
           N + L F     Y LL+   +  I++ D       IK  I   +   +    V  + +  
Sbjct: 181 NGYGLAFNANEKYSLLSGSDDSNIALWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEA 240

Query: 72  SLMVTATNES-VKIYDLKSNDCIKTITNEKN------SPFLSLDSLHNMMACGTELSGVD 124
            +  + + +S +K++D +S+  I  I  +K       SPF S     N+ A     +G D
Sbjct: 241 HIFGSVSEDSTMKLFDKRSSQIIHNINTKKPYNTLAFSPFSS-----NLFAA----AGTD 291

Query: 125 AELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEED 184
             +Y+YDIR    P+ +    H D +T I+F PN+  +L S  +D  T ++DL E   E 
Sbjct: 292 NLVYLYDIRDVSNPLYAMT-GHEDAVTAIEFDPNNDGILYSSGSDRRTIVWDLQEIGAEQ 350

Query: 185 SLHQV 189
           +  ++
Sbjct: 351 TQDEI 355

>KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} similar
           to uniprot|P39984 Saccharomyces cerevisiae YEL056W
          Length = 398

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 43/69 (62%), Gaps = 5/69 (7%)

Query: 121 SGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDL--- 177
           +G D+++ +YD+R  + PI S +  HHD +T ++F P+   +L SGS+D    I+DL   
Sbjct: 267 AGTDSQVQLYDLRKPEAPIHS-MSGHHDSVTSLEFAPHKDGILCSGSSDRRVLIWDLFQI 325

Query: 178 -TETEEEDS 185
             E ++ED+
Sbjct: 326 GAEQQQEDA 334

>SAKL0F08404g Chr6 complement(640436..642367) [1932 bp, 643 aa] {ON}
           similar to uniprot|P39014 Saccharomyces cerevisiae
           YIL046W MET30 F-box protein containing five copies of
           the WD40 motif controls cell cycle function sulfur
           metabolism and methionine biosynthesis as part of the
           ubiquitin ligase complex interacts with and regulates
           Met4p localizes within the nucleus
          Length = 643

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 64/247 (25%), Positives = 110/247 (44%), Gaps = 44/247 (17%)

Query: 105 LSLDSLHNMMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLM 164
           LSL   H  +  G+     D+ + I+D+ S     R  +  HHD +  + F   D + L+
Sbjct: 336 LSLQFNHRYLFTGS----YDSTVAIWDLCSGKLIRR--LTGHHDGVKSVYF---DDQKLI 386

Query: 165 SGSTDGYTNIYDL-------TETEEEDSLHQVINYSSIHSCGWLSSRRIFTLSHMETFAI 217
           +GS D    +++        T     DS+  V +Y  I   G  S+ +   + H+E+   
Sbjct: 387 TGSLDKTIRVWNYQTGACISTYRGHSDSVLSVDSYKKIIVSG--SADKTVKVWHVESRTC 444

Query: 218 HQLNDKSE----VLKEPKP-----------IEFGDIRNDWGCNYVIDVYPGYIATGKTEE 262
           + L   SE    V   PK            I   DIR+    N  I V+ G++  G+ ++
Sbjct: 445 YTLRGHSEWVNCVKLHPKSFTCFSGSDDTTIRMWDIRS----NTCIKVFKGHV--GQVQK 498

Query: 263 SKGQLKISPFNNEKIDLAEDNNIIIPQAHGDEVIRDVF--INPN--DPSNMYSCGEDGNV 318
               LKI    N  +D  E+   +IP+ +G+  + DV   ++PN   P+++ SC  D  +
Sbjct: 499 VI-PLKIVDVENLVVDKQEEAQELIPEPNGEGAVDDVTGTMDPNLPYPTHILSCSLDNTI 557

Query: 319 KLWKIDT 325
           KLW++ +
Sbjct: 558 KLWEVRS 564

>SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 398

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 95/193 (49%), Gaps = 18/193 (9%)

Query: 14  NNWCLKFKPLYNYGLLTSLSNGEISILD-WKTNQIKDK-IKIGETSINDFEIVNNNYNGG 71
           N + L F P     LL+   +G I++ +   TN    K +   E  +ND     + +N  
Sbjct: 163 NGYGLSFNPRTKGELLSCSDDGTIALWNVMGTNTSPSKAVTTHEDIVND--CTWHEFNEN 220

Query: 72  SLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLD-SLH--NMMACGTELSGVDAELY 128
                + +++++I+D ++N  +  +T   +SPF +LD S H  N+ A     +G D+ +Y
Sbjct: 221 LFGSVSEDKTLQIHDKRTNSTVHRLT--LSSPFNTLDFSKHSQNLFAA----AGTDSLVY 274

Query: 129 IYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDL----TETEEED 184
           +YD+R+    + + +  H D +T ++F P+   +L S  +D    ++DL    +E  +ED
Sbjct: 275 LYDLRNTADALHT-MSGHEDSVTSLEFSPHKDGILCSSGSDRRVLLWDLMQIGSEQAQED 333

Query: 185 SLHQVINYSSIHS 197
           +   V     +H+
Sbjct: 334 AADGVPELMMMHA 346

>ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL056W (HAT2)
          Length = 423

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 91/180 (50%), Gaps = 20/180 (11%)

Query: 14  NNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNN----NYN 69
           N + L F P  +  LL+   +  +++ D +  +   K K   TS +D  IVN+     + 
Sbjct: 188 NGYGLAFNPHISGELLSGSDDTTVALWDIEAAK---KPKSILTSHDD--IVNDVKWHEFE 242

Query: 70  GGSLMVTATNESVKIYDLKSN-DCIKTITNEKNSPFLSLD-SLH--NMMACGTELSGVDA 125
                  + +++++++D +   + +K +     SPF +L  S H  N++A     +GVD+
Sbjct: 243 SNVFGTVSEDKTLQVHDKRVRLEPVKKLPTA--SPFNTLSFSKHSRNLLAA----AGVDS 296

Query: 126 ELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDS 185
           ++Y+YD+R   +P+   +  H D +T ++F P+   ++ S  +D    I+DLT+   E S
Sbjct: 297 QIYLYDMRDMSSPLH-VMSGHQDSVTTVEFSPHTDGIICSSGSDRRAIIWDLTQIGAEQS 355

>Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 87/181 (48%), Gaps = 18/181 (9%)

Query: 14  NNWCLKFKPLYNYGLLTSLSNGEISILDWK-----TNQIKDKIKIGETSINDFEIVNNNY 68
           N + L F PL    LL+   +  +++ D       T  I+    +    +ND +   +N+
Sbjct: 162 NGYALSFSPLIKGHLLSGSDDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKW--HNF 219

Query: 69  NGGSLMVTATNESVKIYDLKSNDCIKTITNEK-NSPFLSLDSLH---NMMACGTELSGVD 124
           N       + +  +KI D+++ +   TI   K   PF +L   H   N++A     +G+D
Sbjct: 220 NKDLFGTVSEDSLLKINDIRAENT--TIDTAKCPQPFNTLAFSHHSSNILAA----AGMD 273

Query: 125 AELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEED 184
           + +Y+YD+R+   P+   +  H D +T+++F P+   V++S  +D    ++DL +   E 
Sbjct: 274 SHVYLYDLRNMKEPLH-HMSGHEDAVTNLEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQ 332

Query: 185 S 185
           +
Sbjct: 333 T 333

>KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 408

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 81/170 (47%), Gaps = 15/170 (8%)

Query: 14  NNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNN----NYN 69
           N + L F P  +  LL++  +G +++ D  +   K   +  +      +IVN+     + 
Sbjct: 171 NGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKSPSQTFDVHT---DIVNDCKWHEFQ 227

Query: 70  GGSLMVTATNESVKIYDLKSNDCIK--TITNEKNSPFLSLDSLHNMMACGTELSGVDAEL 127
                  + + ++ I+D  S+  I+  ++++  N+   S  S  N++A     +G D+ +
Sbjct: 228 SSLFGTVSEDNTLIIHDTNSDRAIQKLSVSSAFNTLAFSKRS-ENLLAA----AGTDSNV 282

Query: 128 YIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDL 177
           Y+YD+R    P+ S    H D +T ++F P+   +L S  +D    ++DL
Sbjct: 283 YLYDLRRLQKPLHSMA-GHEDSVTSLEFSPHQDGLLTSSGSDRRIIMWDL 331

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 46/107 (42%), Gaps = 5/107 (4%)

Query: 127 LYIYD--IRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEED 184
           +YI+D  I+  D    +    H ++   + F+P  S  L+S S DG   ++D+T T  + 
Sbjct: 147 VYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLLSASDDGTVALWDVTSTANKS 206

Query: 185 SLHQV-INYSSIHSCGW--LSSRRIFTLSHMETFAIHQLNDKSEVLK 228
                 ++   ++ C W    S    T+S   T  IH  N    + K
Sbjct: 207 PSQTFDVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDTNSDRAIQK 253

>ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 393

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 82/177 (46%), Gaps = 16/177 (9%)

Query: 14  NNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNN----NYN 69
           N + L F P     LL+   +  I + D  T + ++ I       +D  IVN+    N++
Sbjct: 156 NGYGLSFNPNEKGKLLSGSDDSNIVLWD-VTGKSQEPILTFTDRHSD--IVNDCKWHNFD 212

Query: 70  GGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLD-SLH--NMMACGTELSGVDAE 126
                  + + +++++D +  D        K  P+ +L  S H  N+ A     +G D+ 
Sbjct: 213 QNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKK-PYNTLAFSAHSTNLFAA----AGTDSM 267

Query: 127 LYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEE 183
           +Y+YD R    P+   +  H D +T ++FHP +  VL+S  +D  T ++DL E   E
Sbjct: 268 VYLYDRRRASKPLH-MMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAE 323

>Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON}
           similar to Ashbya gossypii ACR017W
          Length = 397

 Score = 46.6 bits (109), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 43/185 (23%), Positives = 88/185 (47%), Gaps = 18/185 (9%)

Query: 8   LTSFGSNNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNNN 67
           L+    N + L F P     LL++  +  +++  W  N     + I    +N  +IVN++
Sbjct: 156 LSYHKDNGYGLAFNPQIEGELLSASDDTTVAL--WDINSTDRPVSI---VMNHTDIVNDS 210

Query: 68  ----YNGGSLMVTATNESVKIYDLKS-NDCIKTITNEKNSPFLSLDSLH--NMMACGTEL 120
               ++       + +++++++D +S ++  + +  EK    L+  S H  N++A     
Sbjct: 211 KWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEKPLNALAF-SKHSKNLIAA---- 265

Query: 121 SGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTET 180
           +G D  +Y+YD+R    P+ +    H D +T I+F  +   +L S  +D    I+DLT+ 
Sbjct: 266 AGTDTRVYLYDLRRLSEPLHTMA-GHQDAVTSIEFSSHKDGILCSSGSDRRLFIWDLTQI 324

Query: 181 EEEDS 185
             E +
Sbjct: 325 GAEQA 329

>Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON}
           (183046..184224) [1179 nt, 393 aa]
          Length = 392

 Score = 46.2 bits (108), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 1/63 (1%)

Query: 121 SGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTET 180
           +G+D  +Y+YD R    P+      H D IT ++FHP +  +L+SG  D    ++DL E 
Sbjct: 261 AGLDTNIYLYDRRQTTKPLHVMA-GHEDAITCLQFHPKEDGILVSGGADRRVILWDLAEI 319

Query: 181 EEE 183
             E
Sbjct: 320 GAE 322

>NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa]
           {ON} Anc_1.247
          Length = 589

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 69/125 (55%), Gaps = 18/125 (14%)

Query: 62  EIVNNNYNGGSLMVTATNESVKIYDLKSNDCIKTI---------TNEKNSPFLSLDSLHN 112
           EI + +Y+   L+  + ++S++ +DL + +C++T+         TN K+S   +L S+  
Sbjct: 393 EITSVSYDNEYLLSASRDKSIRQWDLTTGNCVQTLEATLSHNSGTNIKDSTVEALQSVGA 452

Query: 113 MMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYT 172
            +A G++    D  + ++D+RS    +R+ +  H   IT ++F   DS  +++GSTD   
Sbjct: 453 ALATGSK----DGIIRLWDLRSGKV-VRTLL-KHQGPITSLQF---DSTKIITGSTDANI 503

Query: 173 NIYDL 177
           ++ DL
Sbjct: 504 SVSDL 508

 Score = 31.2 bits (69), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 28/56 (50%), Gaps = 4/56 (7%)

Query: 125 AELYIYDIRSWDTPIRSFV---DSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDL 177
           A  Y   I+ WD      V   D H   +T ++ HP DSK L++GS D    ++DL
Sbjct: 312 AGKYNTSIKVWDLETNDQVMDLDDHIASVTCMQLHP-DSKTLITGSKDATLKLWDL 366

>CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} similar
           to uniprot|P47025 Saccharomyces cerevisiae YJL112w MDV1
          Length = 711

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 82/178 (46%), Gaps = 37/178 (20%)

Query: 69  NGGSLMVTATNESVKIYDLKSNDCIKTI----------------TNEK-------NSPFL 105
           +G +LM  + +++++ +DL S  CI+                  +NE        N+P +
Sbjct: 508 DGANLMTASQDKTIRRWDLYSGKCIQVFDVNFPSLSAYKSSFMKSNEDSMILKTVNTPII 567

Query: 106 -SLDSLHNMMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLM 164
            S+ S    +A GT+    D  + ++D+R+ +  +   ++ H D IT +KF   D+  ++
Sbjct: 568 GSIQSFDAALATGTK----DGLIRLWDMRTGE--VVRVLEGHMDAITSLKF---DATTII 618

Query: 165 SGSTDGYTNIYDLTETEEEDSLHQVINYSSIHSCGWLSSRRIFTLSHMETFAIHQLND 222
           SGS DG   ++DL      ++L  +I+Y    S     ++ I   S+     I+  ND
Sbjct: 619 SGSLDGTIRLWDL----RSNNLTDIISYEKPISSLDFDAKHIVVASNEHNTHIYDRND 672

 Score = 30.8 bits (68), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 19/93 (20%), Positives = 50/93 (53%), Gaps = 5/93 (5%)

Query: 24  YNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNNNYNGGSLMVTATNESVK 83
           ++  L T   +G I + D +T ++   +++ E  ++   I +  ++  +++  + + +++
Sbjct: 573 FDAALATGTKDGLIRLWDMRTGEV---VRVLEGHMD--AITSLKFDATTIISGSLDGTIR 627

Query: 84  IYDLKSNDCIKTITNEKNSPFLSLDSLHNMMAC 116
           ++DL+SN+    I+ EK    L  D+ H ++A 
Sbjct: 628 LWDLRSNNLTDIISYEKPISSLDFDAKHIVVAS 660

>KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa]
           {ON} Anc_4.122 YGL003C
          Length = 568

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 89/179 (49%), Gaps = 25/179 (13%)

Query: 28  LLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNNNYNGGSLMVTATNESVKIYDL 87
            LT+ SNGE+             I + +T  N++  +N   +G  L V  +N  V+I+D+
Sbjct: 287 FLTNNSNGEV-------------IHLCDTE-NEYTSLNWVGSGSHLAVGQSNGIVEIFDV 332

Query: 88  KSNDCIKTITNEKNS-PFLSLDSLHNMMACGTELSGVDAELYIYDIRSWDTPIRSFVDSH 146
               CI+T+    +    LS +S   ++  G+     D  +   D+RS D P    ++SH
Sbjct: 333 NKKKCIRTMLGHSDRVACLSWNSY--ILTSGSR----DHNILHRDVRSPD-PFFEKIESH 385

Query: 147 HDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSLHQVINYSSIHSCGWLSSRR 205
             ++  +K++ +++K L+SG  D   N+YD T T+   ++ +  + +++ +  W S +R
Sbjct: 386 SQEVCGLKWNVDENK-LVSGGNDNIVNVYDRTSTKPFMTMTE--HKAAVKALDWSSHKR 441

>YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit of
           the Hat1p-Hat2p histone acetyltransferase complex;
           required for high affinity binding of the complex to
           free histone H4, thereby enhancing Hat1p activity;
           similar to human RbAp46 and 48; has a role in telomeric
           silencing
          Length = 401

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 88/182 (48%), Gaps = 20/182 (10%)

Query: 14  NNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDF--EIVNNN---- 67
           N + L F  L    LL+   +  +++  W+     D  K   T  ND   +I+N+N    
Sbjct: 162 NGYALSFSTLVKGRLLSGSDDHTVAL--WEVGSGGDPTKPVRT-WNDLHSDIINDNKWHN 218

Query: 68  YNGGSLMVTATNESVKIYDLKSNDC-IKTITNEKNSPFLSLDSLH---NMMACGTELSGV 123
           +N       + +  +KI D+++N+  I T+   +  PF +L   H   N++A     +G+
Sbjct: 219 FNKDLFGTVSEDSLLKINDVRANNTTIDTVKCPQ--PFNTLAFSHHSSNLLAA----AGM 272

Query: 124 DAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEE 183
           D+ +Y+YD+R+   P+   +  H D + +++F  +   V++S  +D    ++DL +   E
Sbjct: 273 DSYVYLYDLRNMKEPLH-HMSGHEDAVNNLEFSTHVDGVVVSSGSDNRLMMWDLKQIGAE 331

Query: 184 DS 185
            +
Sbjct: 332 QT 333

>TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {ON}
           Anc_1.247 YKR036C
          Length = 709

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 65/137 (47%), Gaps = 30/137 (21%)

Query: 62  EIVNNNYNGGSLMVTATNESVKIYDLKSNDCIKTI--------------------TNEKN 101
           EI   +++ G L+  + + +V+ +DL S  C++TI                    T+   
Sbjct: 500 EITALSFDSGHLVSGSQDRTVRQWDLTSGKCLQTIDLSFAGRLSQTSSNSGSGLLTSTDT 559

Query: 102 SPFL-SLDSLHNMMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDS 160
           SP + +L      +A GT     D  + ++D+RS    IR+ ++ H   +T +KF   DS
Sbjct: 560 SPIIGALQCFDAALATGTR----DGAVRLWDLRSGKI-IRT-LEGHTGAVTSLKF---DS 610

Query: 161 KVLMSGSTDGYTNIYDL 177
           K L++GS D    I+DL
Sbjct: 611 KNLITGSLDRSVRIWDL 627

>Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)
          Length = 427

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 87/182 (47%), Gaps = 20/182 (10%)

Query: 14  NNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDF--EIVNN----N 67
           N + L F  L    LL+   +  +++  W+       I    T  ND   +IVN+    N
Sbjct: 188 NGYALSFNALVEGQLLSGSDDHTVAL--WEVGSNSTSISPVRT-WNDLHSDIVNDIKWHN 244

Query: 68  YNGGSLMVTATNESVKIYDLKSNDCIKTITNEK-NSPFLSLDSLH---NMMACGTELSGV 123
           +N       + +  +KI D+++++   TI   K   PF +L   H   N++A     +G+
Sbjct: 245 FNEKLFGTVSEDSLLKINDVRAHNI--TIDAVKCPQPFNTLAFSHHSSNLLAA----AGM 298

Query: 124 DAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEE 183
           D+ +Y+YD+R+   P+   +  H D +T+I+F  +   V++S  +D    ++DL +   E
Sbjct: 299 DSHVYLYDLRNMREPLH-HMSGHEDAVTNIEFSTHVDGVVVSSGSDNRLIMWDLKQIGAE 357

Query: 184 DS 185
            +
Sbjct: 358 QT 359

>CAGL0H03729g Chr8 (342948..343859) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006w LST8
          Length = 303

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 65/134 (48%), Gaps = 15/134 (11%)

Query: 51  IKIGETSINDFEIVNNNYNGGSLMVTATNESVKIYDLK---SNDCIKTITNEKNSPFLSL 107
           I+  ++ +N  EI N+      L+  A ++++++YD+K   SN       +  N   +S 
Sbjct: 28  IQHPDSQVNRLEITNDK----KLLAAAGHQNIRLYDIKTSNSNPVASFEGHRGNVTSVSF 83

Query: 108 DSLHNMMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGS 167
              +  M   +E    D  + ++DIRS   P R++   H+  + ++  HPN  + L+S  
Sbjct: 84  QQDNKWMVTSSE----DGTIKVWDIRSPSVP-RNY--KHNAPVNEVVIHPNQGE-LISCD 135

Query: 168 TDGYTNIYDLTETE 181
            DG   I+DL E +
Sbjct: 136 RDGNIRIWDLGENQ 149

 Score = 32.0 bits (71), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 40/83 (48%), Gaps = 4/83 (4%)

Query: 25  NYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNNNYNGGSLMVTATNESVKI 84
           N  ++TS  +G I + D ++  +    K     +N+  I   + N G L+    + +++I
Sbjct: 87  NKWMVTSSEDGTIKVWDIRSPSVPRNYK-HNAPVNEVVI---HPNQGELISCDRDGNIRI 142

Query: 85  YDLKSNDCIKTITNEKNSPFLSL 107
           +DL  N C   +T E + P  SL
Sbjct: 143 WDLGENQCTHQLTPEDDVPLQSL 165

>KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 418

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 46/74 (62%), Gaps = 6/74 (8%)

Query: 112 NMMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTD-G 170
           +M+ C  + +G    + ++DIR++  P+++ +  H+D I+ ++++P +  VL +G  D G
Sbjct: 303 DMLLCSADSAG---RINLWDIRNFTQPLKTLL--HNDSISVLQWNPREPTVLATGGQDGG 357

Query: 171 YTNIYDLTETEEED 184
              I+DL++ E ++
Sbjct: 358 LVKIWDLSQPEGQE 371

>TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.122
           YGL003C
          Length = 556

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/168 (22%), Positives = 78/168 (46%), Gaps = 18/168 (10%)

Query: 70  GGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYI 129
           G  L +   N  V+IYD+    CI+T++  K+     L   ++++  G+     D  +  
Sbjct: 304 GSHLAIGQANGLVEIYDVVKRKCIRTLSGHKDR-VACLSWNNHILTSGSR----DRRILH 358

Query: 130 YDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTET------EEE 183
            D+R  D+     +++H  ++  +K++P  +K L SG  D    +YD T        EE 
Sbjct: 359 RDVRVPDSFFER-IETHSQEVCGLKWNPESNK-LASGGNDNMVYVYDGTSRSPVLKFEEH 416

Query: 184 DSLHQVINYSS-----IHSCGWLSSRRIFTLSHMETFAIHQLNDKSEV 226
            +  + + +S      + S G  + R++ T +    F +++++  S+V
Sbjct: 417 TAAVKALAWSPHKRGILASGGGTADRKLKTWNVNTGFKVNEVDTGSQV 464

>TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9
           YEL056W
          Length = 392

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/187 (24%), Positives = 87/187 (46%), Gaps = 21/187 (11%)

Query: 8   LTSFG---SNNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGET----SIND 60
           L+S G    N + L F P+    LL+   + +I++ D  TN  K  +   E+     +ND
Sbjct: 146 LSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTK-PVSTWESCHQDGVND 204

Query: 61  FEIVNNNYNGGSLMVTATNESVKIYDLKSNDC----IKTITNEKNSPFLSLDSLHNMMAC 116
            +   +  NG +    + + +++++D +  D     IKT+T   N+   S  S +   A 
Sbjct: 205 CKW--HELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVT-AFNTIAFSKHSTNLFAAA 261

Query: 117 GTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYD 176
           GT     D+ +Y+YD R     + + +  H  ++T+++F+     ++MS   D    ++D
Sbjct: 262 GT-----DSLIYLYDSRRTGNVLHT-MSGHESNVTNLEFYAAKDGIVMSSGEDRRVIMWD 315

Query: 177 LTETEEE 183
           L E   E
Sbjct: 316 LMEIGAE 322

 Score = 30.4 bits (67), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 51/115 (44%), Gaps = 12/115 (10%)

Query: 127 LYIYDI-RSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEE-- 183
           +++YD  +  D  + S +  H D+   + F+P D   L+SGS D    ++D+T    +  
Sbjct: 132 VFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTNSTKPV 191

Query: 184 ---DSLHQVINYSSIHSCGW--LSSRRIFTLSHMETFAIHQLNDKSEVLKEPKPI 233
              +S HQ      ++ C W  L+     ++S   T  +H    K  V  + K +
Sbjct: 192 STWESCHQ----DGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTV 242

>KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} similar
           to uniprot|P53197 Saccharomyces cerevisiae YGL003C CDH1
           CDC20 homolog 1 protein required for Clb2 and Ase1
           degradation
          Length = 582

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 76/145 (52%), Gaps = 9/145 (6%)

Query: 56  TSINDFEIVNNNYNGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMA 115
           TS +DF  ++   +G  L V  ++  V+IYD+  N CI+T++   +     L   +++++
Sbjct: 316 TSESDFTSLSWVDSGSHLAVGLSSGIVEIYDVLKNKCIRTLSGHVDR-VACLSWNNHVLS 374

Query: 116 CGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIY 175
            G+     D ++   D+R+ + P    +D+H  ++  +K++ N++K L SG  D    +Y
Sbjct: 375 SGSR----DRKILHRDVRAPE-PFFEQIDTHSQEVCGLKWNVNENK-LASGGNDNMVYVY 428

Query: 176 DLTETEEEDSLHQVINYSSIHSCGW 200
           D T  +   S+ +  + +++ +  W
Sbjct: 429 DGTLRQPMLSMEE--HTAAVKAMAW 451

>Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {ON}
           similar to Ashbya gossypii AER255C
          Length = 471

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/164 (23%), Positives = 74/164 (45%), Gaps = 8/164 (4%)

Query: 17  CLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNNNYNGGSLMVT 76
           C+ F P+ NY L+  L N EI   D + N     I+  +   +    +    NG   + +
Sbjct: 268 CVTFHPINNYELVVGLLNSEIKHYDTRDNYKNGLIQTYDHHTSSIIALKFFPNGSKFISS 327

Query: 77  ATNESVKIYDLKSNDCIKTI--TNEKNSPFLSLDSLHNMMACGTELSGVDAELYIYDIRS 134
           + +++++I+D + N  IK I  T + + P++ +   HN  A  +    +D  + +Y ++ 
Sbjct: 328 SEDKTIRIWDNQINIPIKQISDTAQHSMPWIEIHPEHNYFATQS----MDNSIGVYSMKP 383

Query: 135 WDTPIRSFV-DSHHDDITDIKFHPN-DSKVLMSGSTDGYTNIYD 176
                   +   HH     I+F  + D + + SG + G   I+D
Sbjct: 384 KYKKHTKKIFKGHHSAGYGIRFDISPDGRYIASGDSMGRLFIWD 427

>KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} similar
           to uniprot|P40968 Saccharomyces cerevisiae YDR364C CDC40
           Pre-mRNA splicing factor important for catalytic step II
           of pre-mRNA splicing and plays a role in cell cycle
           progression required for DNA synthesis during mitosis
           and meiosis has WD repeats
          Length = 462

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 75/170 (44%), Gaps = 10/170 (5%)

Query: 17  CLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNNNYNGGSLMVT 76
           C +F P  +  L+  LSN E+   D +       +++ +  ++    +    +G   + +
Sbjct: 259 CAEFSPANSNELIVGLSNSEVRHYDLRVAHKDGLVQVYDHHLSSIIALKYFPDGSKFISS 318

Query: 77  ATNESVKIYDLKSNDCIKTI--TNEKNSPFLSLDSLHNMMACGTELSGVDAELYIYDIRS 134
           + ++S++I+D + N  IK I  T + + PF+ +   H+  A  +    +D  +Y + ++ 
Sbjct: 319 SEDKSMRIWDNQVNIPIKQISDTAQYSMPFIDIHPEHHYFATQS----MDNAIYAFSMKP 374

Query: 135 --WDTPIRSFVDSHHDDITDIKF-HPNDSKVLMSGSTDGYTNIYDLTETE 181
                P + F + H      I F    D + L SG T G   I+D   T 
Sbjct: 375 KYRRNPKKRF-EGHKCAGYGIGFGFSPDGQYLASGDTKGRVYIWDWKTTR 423

>KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}
           Anc_7.534 YPR178W
          Length = 461

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 61/116 (52%), Gaps = 7/116 (6%)

Query: 62  EIVNNNYNG-GSLMVTA-TNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTE 119
           E+ + ++ G GSL+ T   + +  ++D++    I T+ N  + P   +D   N     T 
Sbjct: 307 EVYSLSFQGDGSLVCTGGLDNTALLWDIRCGKSIMTL-NGHSKPVYCVDWSCNGYNVAT- 364

Query: 120 LSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIY 175
             G D  + I+DIR   T + + + +H++ I+D++F   DSK L+S S D   NIY
Sbjct: 365 -GGGDGLINIWDIRK--TNLVNTILAHNNIISDLRFAKQDSKCLVSCSYDKKINIY 417

>ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} similar
           to uniprot|P47025 Saccharomyces cerevisiae YJL112W MDV1
           WD repeat protein that regulates steps in the
           Dnm1p-dependent process of mitochondrial fission
          Length = 726

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 68/137 (49%), Gaps = 30/137 (21%)

Query: 62  EIVNNNYNGGSLMVTATNESVKIYDLKSNDCIKTI---------------TNEKNSPFL- 105
           EI   +++ G L+  + + +++ +DL +  C++TI               ++   SP + 
Sbjct: 517 EITALSFDSGHLVSGSQDRTLRQWDLSTGKCVQTIDISFASRGQSTSSLASSSLLSPVVE 576

Query: 106 -----SLDSLHNMMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDS 160
                +L      +A GT+    D  + ++D+RS  T IRS ++ H D IT +KF   DS
Sbjct: 577 APVVGALQCFDAALATGTK----DGIVRLWDMRSGKT-IRS-LEGHTDAITTLKF---DS 627

Query: 161 KVLMSGSTDGYTNIYDL 177
           + L++GS D    I+DL
Sbjct: 628 RNLVTGSLDRSIRIWDL 644

>Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON}
           complement(37021..37932) [912 nt, 304 aa]
          Length = 303

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 64/134 (47%), Gaps = 15/134 (11%)

Query: 51  IKIGETSINDFEIVNNNYNGGSLMVTATNESVKIYDLKS---NDCIKTITNEKNSPFLSL 107
           I+  ++ +N   I N+      L+  A +++VK+YD+ +   N       +  N   LS 
Sbjct: 28  IQHSDSQVNRLTITNDK----KLLAAAGHQNVKLYDINTTNPNPVASFEGHRGNVTSLSF 83

Query: 108 DSLHNMMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGS 167
            + +  M   +E    D  + ++D+RS   P R++   H+  + ++  HPN  + L+S  
Sbjct: 84  QNDNRWMVTSSE----DGTIKVWDVRSPSVP-RTY--KHNAPVNEVAIHPNQGE-LISCD 135

Query: 168 TDGYTNIYDLTETE 181
            DG   I+DL E +
Sbjct: 136 RDGNIRIWDLGENQ 149

 Score = 34.3 bits (77), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 71/162 (43%), Gaps = 21/162 (12%)

Query: 25  NYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNNNYNGGSLMVTATNESVKI 84
           N  ++TS  +G I + D ++  +    K     +N+  I   + N G L+    + +++I
Sbjct: 87  NRWMVTSSEDGTIKVWDVRSPSVPRTYK-HNAPVNEVAI---HPNQGELISCDRDGNIRI 142

Query: 85  YDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYIYDIRSWDTPIRSFVD 144
           +DL  N C   +T E ++P  SL    ++   G+ L   +++   Y    W+ P R+   
Sbjct: 143 WDLGENQCTHQLTPEDDTPVQSL----SLATDGSMLVAANSKGNCY---VWEMPNRTDA- 194

Query: 145 SHHDDITDIKFH---------PNDSKVLMSGSTDGYTNIYDL 177
           S+   +T  + H          +D K L + S D    I+ +
Sbjct: 195 SNLKPVTKFRAHDAYITRILLSSDVKFLATCSADHTARIWSI 236

>KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 417

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 83/168 (49%), Gaps = 14/168 (8%)

Query: 28  LLTSLSNGEISILDW-KTNQIKDKIKIGET-SINDFEIVNN---NYNGGSLMVTATNESV 82
           L T  SNG++ + D  K ++ K +++I E  S+ D   VN+     N  S++ +    +V
Sbjct: 201 LATCQSNGKVKVWDLTKFDKSKQRMEIPERESVMDANGVNDVSWMVNHTSILASCGESNV 260

Query: 83  -KIYDLKSN---DCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYIYDIRSWDTP 138
             + D++ +   D +   T+      +  +  ++M+ C  +  G   +L I+DIR +  P
Sbjct: 261 IGLIDIRQDTKMDTLHRTTHTDGINAIEFNYKNDMILCTGDSQG---QLKIWDIRDFKEP 317

Query: 139 IRSFVDSHHDDITDIKFHPNDSKVLMSG-STDGYTNIYDLTETEEEDS 185
           I+ +     D I+ I+++P   ++L +     G   I+D +  E+EDS
Sbjct: 318 IKEWEHGDQDPISAIQWNPQIPQILATADQQSGLVKIWDAS-GEQEDS 364

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 38/177 (21%), Positives = 77/177 (43%), Gaps = 11/177 (6%)

Query: 150 ITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSLHQVINYSSIHSC--GWLSSRRIF 207
           + D+ +  N + +L S        + D+ +  + D+LH+  +   I++    + +   + 
Sbjct: 239 VNDVSWMVNHTSILASCGESNVIGLIDIRQDTKMDTLHRTTHTDGINAIEFNYKNDMILC 298

Query: 208 TLSHMETFAIHQLNDKSEVLKEPKPIEFGDIRNDWGCNYVIDVYPGYIATGKTEESKGQL 267
           T        I  + D  E +KE    E GD        +   + P  +AT   ++  G +
Sbjct: 299 TGDSQGQLKIWDIRDFKEPIKE---WEHGDQDPISAIQWNPQI-PQILATA--DQQSGLV 352

Query: 268 KISPFNNEKIDLAEDNNIIIPQAHGDEV--IRDVFINPNDPSNMYSCGEDGNVKLWK 322
           KI   + E+ D   +NN+++   HG  +  + D+  + +DP  M S   D ++ +WK
Sbjct: 353 KIWDASGEQEDSNAENNMLLF-VHGGHMLGVNDISWSQHDPWTMCSVSNDNSIHIWK 408

>Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {ON}
           YKR036C (REAL)
          Length = 645

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 58/106 (54%), Gaps = 12/106 (11%)

Query: 73  LMVTATNESVKIYDLKSNDCIKTITNEKNSPFL-SLDSLHNMMACGTELSGVDAELYIYD 131
           L+VT T    K+    +N+    + +E  +P + +L   ++ +A GT+    D  + ++D
Sbjct: 464 LIVTPTYNDTKVSARSANNSTSVLGSE--APMIGALQCYNSALASGTK----DGVVRLWD 517

Query: 132 IRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDL 177
           +R    P+R+ ++ H D IT +KF   DS+ L++GS D    I+DL
Sbjct: 518 LR-IGKPVRA-LEGHTDGITSLKF---DSEKLVTGSMDNSVRIWDL 558

>Kwal_47.17567 s47 complement(459443..461215) [1773 bp, 590 aa] {ON}
           YGL003C (CDH1) - protein required for Clb2 and Ase1
           degradation [contig 206] FULL
          Length = 590

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 55/241 (22%), Positives = 104/241 (43%), Gaps = 27/241 (11%)

Query: 70  GGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYI 129
           G  L V  TN  V I+D++   CI+TI    +     L   ++++  G+     D  +  
Sbjct: 338 GSHLAVGQTNGLVNIFDVEKKKCIRTIPGHIDR-VACLSWNNHILTSGSR----DRRILH 392

Query: 130 YDIRSWDTPIRSF--VDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLT------ETE 181
            D+R   TP  SF  + +H+ ++  +K++  D+K L SG  D    +YD T      + E
Sbjct: 393 RDVR---TPQSSFEEIRTHNQEVCGLKWNVEDNK-LASGGNDNAVFVYDGTSRLPFLKLE 448

Query: 182 EEDSLHQVINYSS-----IHSCGWLSSRRIFTLSHMETFAIHQLNDKSEVLKEPKPIEFG 236
           E  +  + + +S      + + G  + +R+   +   +  +H ++  S+V      + + 
Sbjct: 449 EHTAAVKAMAWSPHRRGILATGGGTADKRLKIWNVKTSVKLHDVDTASQVCN----MIWS 504

Query: 237 DIRNDWGCNYVIDVYPGYIATGKTEESKGQLKISPFNNEKIDLAEDNNIIIPQAHGDEVI 296
              N+   ++    Y   +  G T E    LK   F    + L+ D   ++  A GDE +
Sbjct: 505 KNTNEIITSHGYSKYNLTLWDGNTLEPMAILKGHSFRVLHMTLSTDGTTVVSGA-GDETL 563

Query: 297 R 297
           R
Sbjct: 564 R 564

>TBLA0G01490 Chr7 (389958..392156) [2199 bp, 732 aa] {ON} Anc_4.122
           YGL003C
          Length = 732

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 57/108 (52%), Gaps = 9/108 (8%)

Query: 70  GGSLMVTATNESVKIYDLKSNDCIKTITNEKN-SPFLSLDSLHNMMACGTELSGVDAELY 128
           G  + +  +N  ++IYD+    CI+T++   + +  LS +S  +++  G+     D  + 
Sbjct: 480 GSHIAIGQSNGIIEIYDVTKRKCIRTLSGHTDRTACLSWNS--HILTSGSR----DRTIL 533

Query: 129 IYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYD 176
             D+R  D P    + SH  ++  +K++ +D+K L+SG  D   NIYD
Sbjct: 534 HRDVRMKD-PFFERIKSHTQEVCGLKWNESDNK-LVSGGNDNTVNIYD 579

>KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {ON}
           highly similar to uniprot|Q04305 Saccharomyces
           cerevisiae YMR093W UTP15 Nucleolar protein component of
           the small subunit (SSU) processome containing the U3
           snoRNA that is involved in processing of pre-18S rRNA
          Length = 507

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 56/133 (42%), Gaps = 19/133 (14%)

Query: 51  IKIGETSINDFEIVNNNYNGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPF-LSLDS 109
           I    T  NDF I ++               V+++  ++   IKT +  K+  +  S   
Sbjct: 45  ISFNPTHPNDFAITSST-------------RVQLFSSRTRQVIKTFSRFKDVVYSASFRQ 91

Query: 110 LHNMMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTD 169
              ++A G     V     IYD  +  T + S   S H      KFHP DS+ L++ S D
Sbjct: 92  DGKLLAMGDATGRVS----IYDSYNPRTQLVSIAASSHPTHV-AKFHPADSRTLVTASDD 146

Query: 170 GYTNIYDLTETEE 182
               ++D+T+ +E
Sbjct: 147 RVVRVWDITQAQE 159

>Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to
           Ashbya gossypii AEL246C
          Length = 800

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 39/190 (20%), Positives = 89/190 (46%), Gaps = 14/190 (7%)

Query: 8   LTSFGSNN---WCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIV 64
           L S+  +N   W +KF PL +Y    ++S+ + + L W  + I   ++I    +ND + V
Sbjct: 562 LVSYKGHNHPVWDVKFSPLGHY--FATVSHDQTARL-WSCDHIY-PLRIFAGHLNDVDCV 617

Query: 65  NNNYNGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPF-LSLDSLHNMMACGTELSGV 123
             + NG  ++  +++++ +++D+++ D ++       S   +++      +  G+E    
Sbjct: 618 AFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSE---- 673

Query: 124 DAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEE 183
           D  + ++DI +    I+         +  + F+  +  +L+SG  D    ++DL +   E
Sbjct: 674 DGVIIVWDIGTGKR-IKQMRGHGKSAVNSLSFN-KEGNILVSGGADQSVRVWDLKKFTNE 731

Query: 184 DSLHQVINYS 193
            +L     YS
Sbjct: 732 PALEPEQPYS 741

>TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.247
           YKR036C
          Length = 719

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 91/188 (48%), Gaps = 37/188 (19%)

Query: 17  CLKFKPLYNYGLLTSLSNGEISILDWKTNQ---IKDKIKIG---ETSINDF-----EIVN 65
           C++  P Y+  L+T   +  I + + K      +++   IG   ++ I+ F     E+  
Sbjct: 451 CMQSSPHYSM-LITGSKDATIKLWNLKLASQLYLEENADIGNSNQSCIHTFSSHLDELTA 509

Query: 66  NNYNGGSLMVTATNESVKIYDLKSNDCIKTI----TNEKNSPFLS------------LDS 109
            +Y+  +L+  + +++++ +DL S  C++TI       +N+ F S            +  
Sbjct: 510 ISYDTINLVSGSQDKTIRQWDLLSGKCVQTIDLSFIKSRNNDFYSNQLLGEKPLVGAIQC 569

Query: 110 LHNMMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTD 169
               +A GT+    D  + ++D+RS   P+R+ ++ H D +T +KF   DS  +++ S+D
Sbjct: 570 FDAALATGTK----DGIVRLWDLRSG-VPVRT-LEGHTDAVTALKF---DSSSIVTASSD 620

Query: 170 GYTNIYDL 177
               I+DL
Sbjct: 621 KQVRIWDL 628

>KNAG0C01410 Chr3 (277054..279015) [1962 bp, 653 aa] {ON} Anc_1.247
           YKR036C
          Length = 653

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 68/132 (51%), Gaps = 25/132 (18%)

Query: 62  EIVNNNYNGGSLMVTATNESVKIYDLKSNDCIKTIT---------------NEKNSPFL- 105
           EIV  + +G SL+  + +++++ +DLKS  C++++                +  N P + 
Sbjct: 451 EIVALSLSGESLVSASRDKTIRQWDLKSGKCVQSLDVAFPSRDLAGLDASYSMLNPPVVG 510

Query: 106 SLDSLHNMMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMS 165
           +L S  N +A G+     D  + ++D+R     +R+ + +H+  +T +KF   D+  L++
Sbjct: 511 TLQSYENALATGSR----DGLIRLWDLRIGKV-VRT-IPAHNSAVTALKF---DTTHLIT 561

Query: 166 GSTDGYTNIYDL 177
           GS D    I+DL
Sbjct: 562 GSFDRTAFIWDL 573

>AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR198C
           (TAF5)
          Length = 815

 Score = 39.3 bits (90), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 40/190 (21%), Positives = 88/190 (46%), Gaps = 14/190 (7%)

Query: 8   LTSFGSNN---WCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIV 64
           L S+  +N   W +KF PL +Y    + S+ + + L W  + I   ++I    +ND + V
Sbjct: 577 LVSYKGHNHPVWDVKFSPLGHY--FATGSHDQTARL-WSCDHIY-PLRIFAGHLNDVDCV 632

Query: 65  NNNYNGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPF-LSLDSLHNMMACGTELSGV 123
             + NG  ++  +++++ +++D+++ D ++       S   +++      +  G+E    
Sbjct: 633 TFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSE---- 688

Query: 124 DAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEE 183
           D  + ++DI +    I+         +  + F+  +  +L+SG  D    ++DL +   E
Sbjct: 689 DGVIIVWDIGTGKR-IKQMRGHGKSAVYSLSFN-KEGNILVSGGADQSVRVWDLKKFTNE 746

Query: 184 DSLHQVINYS 193
            SL     YS
Sbjct: 747 PSLEPEQPYS 756

>TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON}
           Anc_6.9 YEL056W
          Length = 391

 Score = 38.9 bits (89), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 46/191 (24%), Positives = 89/191 (46%), Gaps = 22/191 (11%)

Query: 14  NNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNNN----YN 69
           N + L F P     L++   +  I++ D   +++K  I+   TS +D  IVN+     +N
Sbjct: 153 NAYGLAFNPNAEGELISGSDDSTIALWDATNDKLKQPIQEWTTSHSD--IVNDCQWHCFN 210

Query: 70  GGSLMVTATNESVKIYDLKS---NDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAE 126
                  + + +++++D ++   +D   +   + NS   S  S +   A GT        
Sbjct: 211 TNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQYNSIAFSGFSENLFAAAGTT-----NN 265

Query: 127 LYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTET------ 180
           +Y+YDIR+    + S    H + +T ++F  +   +L+SGS+D    ++DL E       
Sbjct: 266 IYLYDIRNTGKILHSMT-GHEEPVTSLEFSNDKDGILISGSSDRRVIMWDLFEIGAEQQP 324

Query: 181 -EEEDSLHQVI 190
            E +D L +V+
Sbjct: 325 DEADDGLPEVM 335

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 40/84 (47%), Gaps = 11/84 (13%)

Query: 124 DAELYIYDI-RSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEE 182
           +  ++IYD  R   + + S +  H D+   + F+PN    L+SGS D    ++D T    
Sbjct: 127 EGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDAT---- 182

Query: 183 EDSLHQVIN-YSSIHS-----CGW 200
            D L Q I  +++ HS     C W
Sbjct: 183 NDKLKQPIQEWTTSHSDIVNDCQW 206

>YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}
           MDV1Peripheral protein of the cytosolic face of the
           mitochondrial outer membrane, required for mitochondrial
           fission; interacts with Fis1p and with the
           dynamin-related GTPase Dnm1p; contains WD repeats
          Length = 714

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 59/128 (46%), Gaps = 32/128 (25%)

Query: 73  LMVTATNESVKIYDLKSNDCIKTI----------------------TNEKNSPFL-SLDS 109
           L+  + + +++ +DL+S  C++TI                      T     P + +L S
Sbjct: 515 LVSGSQDRTIRQWDLRSGKCLQTIDLSFANVLTTSTNVDLSKSTLLTQRNERPSIGALQS 574

Query: 110 LHNMMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTD 169
               +A GT+    D  + ++D+RS    IR+ +  H D IT +KF   DS  L++GS D
Sbjct: 575 FDAALATGTK----DGVVRLWDLRSGKV-IRT-LKGHTDAITSLKF---DSACLVTGSYD 625

Query: 170 GYTNIYDL 177
               I+DL
Sbjct: 626 RTVRIWDL 633

>Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]
           {ON} YJL112W (MDV1) - Involved in mitochondrial division
           [contig 260] FULL
          Length = 721

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 66/143 (46%), Gaps = 36/143 (25%)

Query: 62  EIVNNNYNGGSLMVTATNESVKIYDLKSNDCIKTI--------------TNEKNSPFLSL 107
           EI   ++ G SL+  + + +++ +DL +  C++TI                  N+P  S+
Sbjct: 504 EITALHFEGNSLVSGSQDRTIRQWDLTTGKCLQTIDINFANRGTSGGFSKISSNNPRSSI 563

Query: 108 DSLHN-------------MMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIK 154
              HN              MA GT+    D  + ++D+RS    IR+ ++ H D +T ++
Sbjct: 564 LLTHNDPPVIGALQCYDAAMATGTK----DGLVRLWDLRSGQV-IRT-LEGHTDAVTGLQ 617

Query: 155 FHPNDSKVLMSGSTDGYTNIYDL 177
           F   DS  L++GS D    I+DL
Sbjct: 618 F---DSVNLVTGSLDRSIRIWDL 637

>TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8.544
           YBR198C
          Length = 832

 Score = 38.9 bits (89), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 36/167 (21%), Positives = 85/167 (50%), Gaps = 17/167 (10%)

Query: 16  WCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNNNYNGGSLMV 75
           W ++F P+ +Y    + S+ + + L W  + I   ++I    I+D + V  + NG  +  
Sbjct: 599 WDVQFSPVGHY--FATASHDQTARL-WSCDHIF-PLRIFSGHISDVDCVTFHPNGCYIFT 654

Query: 76  TATNESVKIYDLKSNDCIKTITNEKNSPFLSL----DSLHNMMACGTELSGVDAELYIYD 131
            +++++ +++D+ + + ++       +P LS+    D L   +A G+E    D  ++I+D
Sbjct: 655 GSSDKTCRMWDITTGESVRLFIGH-TAPILSVAVAPDGLR--LATGSE----DGVIHIWD 707

Query: 132 IRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLT 178
           I +  + ++  +      +  + ++  +S +L+SG +D    I+DLT
Sbjct: 708 IGTGKS-LKKLIGHGKSAVNSLSYN-KESNILVSGGSDNSVRIWDLT 752

>ZYRO0F06776g Chr6 (555965..557263) [1299 bp, 432 aa] {ON} similar
           to uniprot|Q12206 Saccharomyces cerevisiae YOR229W WTM2
           WD repeat containing transcriptional modulator 2
           Transcriptional modulator
          Length = 432

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 76/166 (45%), Gaps = 21/166 (12%)

Query: 50  KIKIGETSINDFEIVNNNYNGGSLMVTATNESV-KIYDLKSNDCIKTITNEKNSPFLSLD 108
           +  +  + I+    ++NN     L VT ++E+V   +D +S+  + + T+ ++    SL 
Sbjct: 227 RFNVEASVIHSVSFLDNN-----LYVTCSDENVVSFWDKRSDSQLWSFTDSQDGNITSLS 281

Query: 109 S---LHNMMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMS 165
           S   L    A GT+ +GV     +  I S    + SF  S+ D + D++F P +S   +S
Sbjct: 282 SSSQLDGFFATGTD-AGVIKLWDLRAIMSQQQEMVSFYHSNEDPVVDLQFSPTNSTEFLS 340

Query: 166 GSTDGYTNIYDL------TETEEEDSLHQVINYSSIHSCGWLSSRR 205
               G    +D        E +EED   Q + +  +H+ G   SRR
Sbjct: 341 VGKSGNVYQWDTDFFFTNEEVDEEDLHLQCLKF--LHTGG---SRR 381

>Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {ON}
           YLR222C (REAL)
          Length = 817

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 35/147 (23%), Positives = 65/147 (44%), Gaps = 9/147 (6%)

Query: 36  EISILDWKTNQIKDKIKIGETSINDFEIVNNNYNGGSLMVTATNESVKIYDLKSNDCIKT 95
           EI+I+D      K   KI      +   +    +G  L   +  + +KI+ LK+   +++
Sbjct: 39  EINIIDLTLGCRKILHKISNEDEQEITALRLTPDGQYLAYVSQAQLLKIFQLKTGRIVRS 98

Query: 96  ITNEKNSPFLSLDSLHNMMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKF 155
           +     S  L  D    ++A G    G D  + I DI   +  I   +  H   I+ +KF
Sbjct: 99  LKISSPSYILDTDPTSTLLAVG----GTDGSIVIVDIE--NGYITHSLKGHGGTISSLKF 152

Query: 156 HP---NDSKVLMSGSTDGYTNIYDLTE 179
           +    +++ +L SG T+G   ++DL +
Sbjct: 153 YGQLDSETWLLASGDTNGMVKVWDLVK 179

>KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]
           {ON} similar to uniprot|P47025 Saccharomyces cerevisiae
           YJL112W MDV1 WD repeat protein that regulates steps in
           the Dnm1p-dependent process of mitochondrial fission
          Length = 723

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 35/137 (25%), Positives = 61/137 (44%), Gaps = 24/137 (17%)

Query: 62  EIVNNNYNGGSLMVTATNESVKIYDLKSNDCIKTI--------------TNEKNSPFLSL 107
           EI   ++ G SL+  + + +++ +DL++  C++TI              T   N+P  S+
Sbjct: 506 EITALHFEGNSLVSGSQDRTIRQWDLRTGKCLQTIDINFTNRGTSDGFSTISSNNPRSSV 565

Query: 108 DSLHNMMACGTELSGVDAELYIYD----IRSWDTPIRSFV---DSHHDDITDIKFHPNDS 160
              HN       L   DA +        +R WD  +   V   + H D +T ++F   D+
Sbjct: 566 LLTHNDPPVIGALQCYDAAMATGTKDGIVRLWDLRMGQVVRTLEGHTDAVTGLQF---DA 622

Query: 161 KVLMSGSTDGYTNIYDL 177
             L++GS D    I+DL
Sbjct: 623 VNLVTGSLDRSIRIWDL 639

>Kpol_1061.36 s1061 (100800..102569) [1770 bp, 589 aa] {ON}
           (100800..102569) [1770 nt, 590 aa]
          Length = 589

 Score = 38.5 bits (88), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 31/136 (22%), Positives = 65/136 (47%), Gaps = 9/136 (6%)

Query: 70  GGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYI 129
           G  L V   N  ++IYD+    CI+T++   +     L   +N+++ G+     D  +  
Sbjct: 337 GSHLAVGQGNGLMEIYDVVKKKCIRTLSGHTDR-VSCLSWNNNILSSGSR----DRRILH 391

Query: 130 YDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSLHQV 189
            D+R  D P  + +++H  ++  +K++  ++K L SG  D    +YD T      +  + 
Sbjct: 392 RDVRIAD-PFFAQIETHTQEVCGLKWNVEENK-LASGGNDNIVCVYDGTSVTPTLTFRE- 448

Query: 190 INYSSIHSCGWLSSRR 205
            + +++ + GW   +R
Sbjct: 449 -HTAAVKAIGWSPHKR 463

>Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {ON}
           complement(56019..57566) [1548 nt, 516 aa]
          Length = 515

 Score = 38.5 bits (88), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 36/182 (19%), Positives = 80/182 (43%), Gaps = 10/182 (5%)

Query: 16  WCLKFKPLYNYG-LLTSLSNGEISILDWKTNQ-IKDKIKIGETSINDFEIVNNNYNGGSL 73
           + L + PL   G LLT   +G++      T++ + DK     ++    E +  +    ++
Sbjct: 282 YALDWSPLIRSGALLTGDCSGQVYFTQRHTSKWVTDKQPFTVSNNKSIEDIQWSRTEATV 341

Query: 74  MVTATNES-VKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYIYDI 132
             TA  +  ++++D +S      I+ + ++  +++ S +  M         +    ++D+
Sbjct: 342 FATAGCDGYIRVWDTRSKKHKPAISTKASNTDVNVISWNEKMGYLLASGDDNGTWGVWDL 401

Query: 133 RSWD------TPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSL 186
           R +        P+  + D H   IT I FHP D  ++   S D    ++DL+   +++ +
Sbjct: 402 RQFSPSNENAQPVAQY-DFHKGAITSISFHPTDESIVAVASEDNTVTLWDLSVEADDEEI 460

Query: 187 HQ 188
            Q
Sbjct: 461 KQ 462

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 24/111 (21%), Positives = 49/111 (44%), Gaps = 4/111 (3%)

Query: 93  IKTITNEKNSPFLSLDSLHNMMACGTELSG-VDAELYIYDIRS--WDTPIRSFVDSHHDD 149
           I TI N  N    +LD    ++  G  L+G    ++Y     +  W T  + F  S++  
Sbjct: 270 IHTIRNHGNVEGYALD-WSPLIRSGALLTGDCSGQVYFTQRHTSKWVTDKQPFTVSNNKS 328

Query: 150 ITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSLHQVINYSSIHSCGW 200
           I DI++   ++ V  +   DGY  ++D    + + ++    + + ++   W
Sbjct: 329 IEDIQWSRTEATVFATAGCDGYIRVWDTRSKKHKPAISTKASNTDVNVISW 379

>KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 38.5 bits (88), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 50/106 (47%), Gaps = 5/106 (4%)

Query: 71  GSLMVTATNESVK-IYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYI 129
           G+L+ +   +S+  ++DL+S   I T+      P   +D   N     T   G D  + +
Sbjct: 320 GALICSGGLDSLAMVWDLRSGKNIVTLQGHAK-PVYCVDWSSNSHQLAT--GGGDGVVNV 376

Query: 130 YDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIY 175
           +D+R  + P    + +H   ++ ++F  N   VL+SG  D   N+Y
Sbjct: 377 WDLRKLEQPATKLL-AHKSIVSSLRFERNRGDVLVSGGYDRALNVY 421

>Ecym_4343 Chr4 (733111..734862) [1752 bp, 583 aa] {ON} similar to
           Ashbya gossypii ADL082C
          Length = 583

 Score = 38.5 bits (88), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 59/255 (23%), Positives = 106/255 (41%), Gaps = 59/255 (23%)

Query: 105 LSLDSLHNMMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLM 164
           LSL   H+++  G+     D+ + I+D+ S     R  +  H D +  ++F   D + L+
Sbjct: 274 LSLQFTHSLLFTGS----YDSTVAIWDLCSGKLLRR--LTGHTDGVKCVRF---DDQKLI 324

Query: 165 SGSTDGYTNIYDL-------TETEEEDSLHQVINYSSIHSCGWLSSRRIFTLSHMETFAI 217
           +GS D    +++        T    +DS+  V ++  I   G  S+ +   + H+E+   
Sbjct: 325 TGSLDKTIRVWNYVTGKCVSTYRGHQDSVLSVDSFRKIIVSG--SADKTVKVWHVESRTC 382

Query: 218 HQLNDKSE----VLKEPKP-----------IEFGDIRNDWGCNYVIDVYPGYIATGKTEE 262
           + L   ++    V   PK            I   DIR     N  I ++ G++       
Sbjct: 383 YTLRGHTKWINCVKLHPKSFTCFSGSDDTTIRMWDIRT----NTCIKIFRGHV------- 431

Query: 263 SKGQL-KISPFN---NEKIDLAEDNNIIIPQAHGDEVIRDVFINPND-------PSNMYS 311
             GQ+ K+ P N      +  AED  +I    + D  + D  +NP +       P+ + S
Sbjct: 432 --GQVQKVIPLNLVDENLVQDAEDATVISDVENTD--VEDPTVNPENWDDSLPYPNYLLS 487

Query: 312 CGEDGNVKLWKIDTT 326
           C  D  +KLW + T+
Sbjct: 488 CSLDNTIKLWDVKTS 502

>TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {ON}
           Anc_1.247 YKR036C
          Length = 730

 Score = 38.5 bits (88), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 46/83 (55%), Gaps = 10/83 (12%)

Query: 100 KNSPFL-SLDSLHNMMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPN 158
           +N P + +L    + +A GT+    D  + ++D+RS +   R  +  H D IT +KF  N
Sbjct: 579 ENKPIIGALQCFDSALATGTK----DGIIRLWDLRSGEIA-RKLI-GHQDAITSLKFDTN 632

Query: 159 DSKVLMSGSTDGYTNIYDLTETE 181
           +   ++SGS DG T I+DL + +
Sbjct: 633 N---IISGSLDGSTRIWDLRQDQ 652

>CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON}
           similar to uniprot|P53197 Saccharomyces cerevisiae
           YGL003c CDH1 substrate-specific activator of
           APC-dependent proteolysis
          Length = 640

 Score = 38.5 bits (88), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 54/109 (49%), Gaps = 7/109 (6%)

Query: 70  GGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYI 129
           G  L +   N  V+IYD+    CI+T++   +     L   +++++ G+     D  +  
Sbjct: 388 GSHLAIGQGNGIVEIYDVTKEKCIRTLSGHLDR-VACLSWNNHILSSGSR----DRTILH 442

Query: 130 YDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLT 178
            D+R  D P    +++H  +I  +K++ ND+K L SG  D    +YD T
Sbjct: 443 RDVRMAD-PFFEKIETHEQEICGLKWNTNDNK-LASGGNDNMVFVYDGT 489

>Kpol_1064.35 s1064 (64223..65584) [1362 bp, 453 aa] {ON}
           (64223..65584) [1362 nt, 454 aa]
          Length = 453

 Score = 38.1 bits (87), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 59/124 (47%), Gaps = 13/124 (10%)

Query: 77  ATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLH--NMMACGTELSGVDAELYIYDIRS 134
           + + ++K +DL ++ CI T T   +   LSL  L   N++ACG+  S     L+   I S
Sbjct: 300 SQDHTIKTWDLVTSRCIDTKTTSYS--LLSLAQLPTLNLLACGS--SARHITLHDPRIGS 355

Query: 135 WDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDL-------TETEEEDSLH 187
                +  +  H + +  +   P +  +L SGS DG   ++D+       T T EE S+ 
Sbjct: 356 TSKITQQQLVGHKNFVVSLDTCPENEYMLCSGSHDGTVKVWDVRANSPMYTITREEQSVE 415

Query: 188 QVIN 191
           + +N
Sbjct: 416 KGVN 419

>ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 RiboSome Assembly 2
          Length = 516

 Score = 38.1 bits (87), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 26/115 (22%), Positives = 52/115 (45%), Gaps = 4/115 (3%)

Query: 89  SNDCIKTITNEKNSPFLSLDSLHNMMACGTELSG-VDAELYIYDIRS--WDTPIRSFVDS 145
           S   I TI N  N     LD    ++  G  L+G    ++++    +  W T  + F  +
Sbjct: 266 SRKAIHTIRNHGNVEGYGLD-WSPLIKTGALLTGDCSGQIFLTQRHTSKWITDKQPFTAA 324

Query: 146 HHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSLHQVINYSSIHSCGW 200
           ++  + DI++ P +S V  +  TDGY  I+D    + + ++    + + ++   W
Sbjct: 325 NNQSVEDIQWSPTESTVFATSGTDGYVRIWDTRSKKHKPAISTRASNTDVNVISW 379

 Score = 37.4 bits (85), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 42/185 (22%), Positives = 83/185 (44%), Gaps = 19/185 (10%)

Query: 18  LKFKPLYNYG-LLTSLSNGEISILDWKTNQ-IKDKIKIGETSINDFEIVNNNYNGGSLMV 75
           L + PL   G LLT   +G+I +    T++ I DK      +    E +  +    ++  
Sbjct: 284 LDWSPLIKTGALLTGDCSGQIFLTQRHTSKWITDKQPFTAANNQSVEDIQWSPTESTVFA 343

Query: 76  TA-TNESVKIYDLKSNDCIKTITNEKNSPFLSL----DSLHNMMACGTELSGVDAELYIY 130
           T+ T+  V+I+D +S      I+   ++  +++    + L  ++A G +    +    ++
Sbjct: 344 TSGTDGYVRIWDTRSKKHKPAISTRASNTDVNVISWNEKLGYLLASGDD----NGSWGVW 399

Query: 131 DIRSWD-------TPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEE 183
           D+R +         P+  + D H   IT I F+P D  V+   S D    ++DL+   ++
Sbjct: 400 DLRQFSPANSEGVQPVAQY-DFHRGPITSISFNPLDDSVVAVASEDNTVTLWDLSVEADD 458

Query: 184 DSLHQ 188
           D + Q
Sbjct: 459 DEIQQ 463

>TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.717
           YOR269W
          Length = 848

 Score = 38.5 bits (88), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 54/117 (46%), Gaps = 12/117 (10%)

Query: 69  NGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELY 128
           +G  L   +TN+ +KIY++     +K++     S  +S+D    ++A G    G D  + 
Sbjct: 72  DGKYLCYASTNQLLKIYNIVEKKFVKSLKISSPSYVMSIDQTSTLLAVG----GTDGSVT 127

Query: 129 IYDIRSWDTPIRSFVDSHHDDITDIKFHP------NDSKVLMSGSTDGYTNIYDLTE 179
           + DI   ++ I      H   I+ +KF+       N+  +L SG T G   + D+ +
Sbjct: 128 VIDIE--NSYITHSFKGHGATISAVKFYSDASTQNNEGWLLFSGDTAGMIKVCDMVK 182

>KNAG0B05550 Chr2 (1080707..1082560) [1854 bp, 617 aa] {ON}
           Anc_4.122 YGL003C
          Length = 617

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 37/163 (22%), Positives = 77/163 (47%), Gaps = 11/163 (6%)

Query: 45  NQIKDKIKIGETSINDFEIVNNNYNGGS--LMVTATNESVKIYDLKSNDCIKTITNEKNS 102
           N   D + + +T   D E  + ++ G    L V   N  V+IYD     CI+T++   + 
Sbjct: 338 NATGDVVHLCDTDTVDNEFTSLSWVGAGSHLAVGQRNGLVEIYDAVKGKCIRTLSGHVDR 397

Query: 103 PFLSLDSLHNMMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKV 162
               L   +++++ G+     D  +   D+R  D P    ++SH  ++  +K++ +++K 
Sbjct: 398 -VACLSWNNHILSSGSR----DHRILHRDVRMPD-PFFERIESHTQEVCGLKWNVDENK- 450

Query: 163 LMSGSTDGYTNIYDLTETEEEDSLHQVINYSSIHSCGWLSSRR 205
           L SG  D   ++YD T      +L++  + +++ +  W   +R
Sbjct: 451 LASGGNDNIVHVYDGTSRTPMLTLNE--HKAAVKAIAWSPHKR 491

>ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR212W (STE4)
          Length = 467

 Score = 37.7 bits (86), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 56/108 (51%), Gaps = 17/108 (15%)

Query: 112 NMMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGY 171
           N+ A G    G D  LYI+D R   T ++SF  S   D++ +KF  N    + +GS DG 
Sbjct: 275 NVFASG----GSDGYLYIWDKRV-PTSVQSFFVSD-SDVSKVKFFRN-GNTIATGSDDGC 327

Query: 172 TNIYDLTETEEEDSLHQVINYS---SIHSCGWLSSRRIFTLSHMETFA 216
           TN+YDL       S  ++ NYS   SIH    +  ++ + +S+M+  A
Sbjct: 328 TNLYDLR------SDCRIANYSLSRSIHGATPV-QQQTYIMSNMDYTA 368

>Suva_7.279 Chr7 complement(484066..485766) [1701 bp, 566 aa] {ON}
           YGL003C (REAL)
          Length = 566

 Score = 37.7 bits (86), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 53/109 (48%), Gaps = 7/109 (6%)

Query: 70  GGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYI 129
           G  L V   N  V+IYD+    CI+T++   +     L   ++++  G+     D  +  
Sbjct: 314 GSHLAVGQGNGLVEIYDVIKRKCIRTLSGHVDR-VACLSWNNHVLTSGSR----DHRILH 368

Query: 130 YDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLT 178
            D+R  D P    ++SH  ++  +K++  D+K L SG  D   N+Y+ T
Sbjct: 369 RDVRMPD-PFFETIESHTQEVCGLKWNVADNK-LASGGNDNMVNVYEGT 415

>SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]
           {ON} highly similar to uniprot|Q75AV4 Ashbya gossypii
           ADL184W PSF2 Polyadenylation factor subunit 2 and
           similar to YNL317W uniprot|P42841 Saccharomyces
           cerevisiae YNL317W PFS2 Integral subunit of the pre-mRNA
           cleavage and polyadenylation factor (CPF) complex plays
           an essential role in mRNA 3'-end formation by bridging
           different processing factors and thereby promoting the
           assembly of the processing complex
          Length = 459

 Score = 37.7 bits (86), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 58/121 (47%), Gaps = 10/121 (8%)

Query: 73  LMVTATNES-VKIYDLKSNDCIKTITNEKNSPFLS--LDSLHNMMACGTELSGVDAELYI 129
           L+V+ + ++ +K++D +S  CI TI   K++   +    +  N++A    +   D    I
Sbjct: 221 LIVSGSKDNLIKLWDPRSGQCISTILGFKHTIIKTKFQPTKGNLLA----VVAKDKSCKI 276

Query: 130 YDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTE-TEEEDSLHQ 188
           +DIR     ++SF D    D   + +HP +  +   G  DG    +DL + T   +S H 
Sbjct: 277 FDIRQNMKELKSFRDE--SDYMSLTWHPINESIFTVGCYDGSLKHFDLLQDTGSSNSFHD 334

Query: 189 V 189
           +
Sbjct: 335 I 335

>Kwal_47.17310 s47 (345235..346896) [1662 bp, 553 aa] {ON} YER124C
           (DSE1) - Daughter Specific Expression 1 [contig 210]
           FULL
          Length = 553

 Score = 37.7 bits (86), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 38/73 (52%), Gaps = 3/73 (4%)

Query: 123 VDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEE 182
           +D ++ ++DIRS  T  +  V+ H   I  +K+H ND++ L S   +GYT  +DL   + 
Sbjct: 316 IDNQVKVWDIRS--TGAKCTVNGHKGSIKGLKYH-NDTRRLYSSDDEGYTIAWDLQGIDN 372

Query: 183 EDSLHQVINYSSI 195
               H    + SI
Sbjct: 373 VSECHLATGFLSI 385

>Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar to
           Ashbya gossypii AGL196C
          Length = 937

 Score = 37.7 bits (86), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 62/118 (52%), Gaps = 20/118 (16%)

Query: 74  MVTATNESVKIYDLKSNDCIKTITN-----------EKNSPFLSLDSLH--NMMACGTEL 120
           ++T++ E++  +D+K+ + +KT+++           EK +    L+  H  N++A G   
Sbjct: 38  IITSSLENINCWDIKTGNLLKTLSDSIPPGSIDAKYEKPAEVAYLEYHHETNLLAAGY-- 95

Query: 121 SGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLT 178
              D  + I+D+++    I    +SH   IT +KF P+ ++ L+SGS D    I+DL 
Sbjct: 96  --ADGVIKIWDMQTQTVLI--IFNSHTAAITFLKFDPSGTR-LISGSRDSNIIIWDLV 148

>NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}
           Anc_6.9 YEL056W
          Length = 411

 Score = 37.7 bits (86), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 61/123 (49%), Gaps = 9/123 (7%)

Query: 62  EIVNN----NYNGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLD-SLHNMMAC 116
           +IVN+    N++       + + +++++D +  D   T   + ++PF +L  S H+    
Sbjct: 219 DIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTF-TSQFKVDAPFNTLAFSKHSQYLF 277

Query: 117 GTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYD 176
               +G D+ +Y++D R    P+ S    H   +T+++F P+   +LM+   D    I+D
Sbjct: 278 AA--AGTDSHVYLFDRRDISRPLHSMA-GHDGAVTNMEFSPDQDGILMTSGEDRRAIIWD 334

Query: 177 LTE 179
           + +
Sbjct: 335 ICD 337

>Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {ON}
           YMR093W (UTP15) - Protein required for cell viability
           [contig 55] FULL
          Length = 507

 Score = 37.7 bits (86), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 47/102 (46%), Gaps = 6/102 (5%)

Query: 82  VKIYDLKSNDCIKTITNEKNSPF-LSLDSLHNMMACGTELSGVDAELYIYDIRSWDTPIR 140
           V+++  ++   IKT +  K+  +  S      ++A G     V     +YD  +    + 
Sbjct: 63  VQLFSSRTRQVIKTFSRFKDVVYSASFRQDGKLLAMGDATGRVS----VYDSYNPRAQLV 118

Query: 141 SFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEE 182
           S   S H      KFHP DS+ L++ S D    ++D+T+ +E
Sbjct: 119 SIAASSHPTHV-AKFHPADSRTLVTASDDRVVRVWDITQAQE 159

>Ecym_2808 Chr2 (1568103..1569500) [1398 bp, 465 aa] {ON} similar to
           Ashbya gossypii AEL269C
          Length = 465

 Score = 37.7 bits (86), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 69/151 (45%), Gaps = 16/151 (10%)

Query: 71  GSLMVTATNESVK-IYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYI 129
           GSL+ +   +S+  I+DL+S + I  +   +  P   LD   N     T  SG D  + I
Sbjct: 319 GSLLASGGLDSIGLIWDLRSGEPIMNLVGHQK-PIYGLDWSPNGYQVATA-SG-DGSIKI 375

Query: 130 YDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIY-----DLTETEEED 184
           +D+R     I S + +H +   DIKF   +   L+SG  D    I+     +L +T E  
Sbjct: 376 WDLRK--QSIVSTLLAHRNVAFDIKFDKANGHFLVSGGYDRELKIFNADNWELIKTLEGH 433

Query: 185 -----SLHQVINYSSIHSCGWLSSRRIFTLS 210
                S+  V + S   S GW  + + +TLS
Sbjct: 434 TDKILSVDLVSDGSKFFSTGWDRTVKQWTLS 464

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 44/99 (44%), Gaps = 6/99 (6%)

Query: 69  NGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPF-LSLDSLHNMMACGTELSGVDAEL 127
           NG  +   + + S+KI+DL+    + T+   +N  F +  D  +          G D EL
Sbjct: 360 NGYQVATASGDGSIKIWDLRKQSIVSTLLAHRNVAFDIKFDKANGHFLVS---GGYDREL 416

Query: 128 YIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSG 166
            I++  +W+  +   ++ H D I  +    + SK   +G
Sbjct: 417 KIFNADNWE--LIKTLEGHTDKILSVDLVSDGSKFFSTG 453

>Kwal_55.21450 s55 (842483..843994) [1512 bp, 503 aa] {ON} YDR364C
           (CDC40) - Member of the beta transducin family [contig
           130] FULL
          Length = 503

 Score = 37.7 bits (86), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 34/168 (20%), Positives = 75/168 (44%), Gaps = 8/168 (4%)

Query: 17  CLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNNNYNGGSLMVT 76
           C +F+P  +   +  LSN EI   D +T+     +++ +  ++    +    +G   + +
Sbjct: 300 CAEFRPSNSNEFIVGLSNSEIRHYDLRTSHKNGLVQVYDHHLSSIIALKYFPDGSKFVSS 359

Query: 77  ATNESVKIYDLKSNDCIKTI--TNEKNSPFLSLDSLHNMMACGTELSGVDAELYIYDIR- 133
           + ++S++I++ + N  IK I  T++ + P++ +    N  A  +    +D  +Y + ++ 
Sbjct: 360 SEDKSMRIWENQINIPIKQISDTSQYSMPYIGIHPEQNYFAAQS----MDNAIYAFSMKP 415

Query: 134 SWDTPIRSFVDSHHDDITDIKF-HPNDSKVLMSGSTDGYTNIYDLTET 180
            +    +     H      I F    D + + SG T G   I+D   T
Sbjct: 416 KYKRHPKKHFSGHKCAGFGIGFGFSPDGQYIASGDTRGRVYIWDWKTT 463

>SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]
           {ON} similar to uniprot|P53197 Saccharomyces cerevisiae
           YGL003C CDH1 CDC20 homolog 1 protein required for Clb2
           and Ase1 degradation
          Length = 555

 Score = 37.7 bits (86), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 32/147 (21%), Positives = 70/147 (47%), Gaps = 9/147 (6%)

Query: 59  NDFEIVNNNYNGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGT 118
           N++  +N    G  L V   N  V+IYD+    CI+T++   +     L   ++++  G+
Sbjct: 292 NEYTSINWVGAGSHLAVGQGNGLVEIYDIVKRKCIRTLSGHMDR-VACLSWNNHILTSGS 350

Query: 119 ELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLT 178
                D ++   D+R  + P    V++H  ++  +K++ ++++ L SG  D    +YD  
Sbjct: 351 R----DRKILHRDVRMPE-PYFEQVETHTQEVCGLKWNTDENR-LASGGNDNVVYVYD-- 402

Query: 179 ETEEEDSLHQVINYSSIHSCGWLSSRR 205
            T  + +L    + +++ +  W   +R
Sbjct: 403 GTSRKPTLKLAEHTAAVKAIAWSPHKR 429

>TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}
           Anc_7.534 YPR178W
          Length = 465

 Score = 37.4 bits (85), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 52/106 (49%), Gaps = 6/106 (5%)

Query: 71  GSLMVTATNESVK-IYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYI 129
           GSL+ +A  +    I+D++S +C   ++     P  S+D         T  SG D  + I
Sbjct: 319 GSLLCSAGLDCTGMIWDIRSGNCAMVLSGH-TKPIYSVDWSPRGFEVATA-SG-DGTVNI 375

Query: 130 YDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIY 175
           +DIR  + P    + +H+  ++ I+F  ++ K LMS   D   N+Y
Sbjct: 376 WDIRKTNQP--QVLLAHNSIVSGIRFEKHNGKFLMSCGYDKNINVY 419

>TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.122
           YGL003C
          Length = 631

 Score = 37.7 bits (86), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 75/148 (50%), Gaps = 11/148 (7%)

Query: 59  NDFEIVNNNYNGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHN-MMACG 117
           N+F  +N    G  L V  +N  V+IYD+    CI+T++    S  +S  S +N +++ G
Sbjct: 368 NEFTSLNWVGTGSHLAVGQSNGLVEIYDIIKRKCIRTLSGH--SDRVSCLSWNNHILSSG 425

Query: 118 TELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDL 177
           +     D ++   D+RS D+   + +++H  ++  +K++  D++ L SG  D    +YD 
Sbjct: 426 SR----DRKILHRDVRSPDSYF-TQIETHTQEVCGLKWNIEDNR-LASGGNDNIVYVYDG 479

Query: 178 TETEEEDSLHQVINYSSIHSCGWLSSRR 205
             ++   +L    + +++ +  W   RR
Sbjct: 480 VNSKP--TLMFTEHTAAVKAMTWSPHRR 505

>TPHA0D02860 Chr4 (596215..597192) [978 bp, 325 aa] {ON} Anc_5.615
           YOR026W
          Length = 325

 Score = 37.4 bits (85), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 46/179 (25%), Positives = 78/179 (43%), Gaps = 14/179 (7%)

Query: 24  YNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNNNYNGGSLMVTATNESVK 83
           Y   L+    NG + I+D  TN +  KI++    I  F++ +N+     L++ ATN +  
Sbjct: 113 YRDKLICGSWNGSLHIIDCHTNSVDFKIQLDGRKI--FKMSSND---EKLILYATNNTTL 167

Query: 84  IYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYI--YDIRSWDTPIRS 141
            +DL      + I  E    F + D       CG   S VD  + +  +D  S     R 
Sbjct: 168 YFDLPLQKNSEGIKVESGLKFQTRDIALTPGGCGYVSSSVDGRVAVEYFDDESKKFAFRC 227

Query: 142 FVDSHHDD-----ITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSLHQVINYSSI 195
              +  D      +  I F PN S +L +G +DG  + ++++   +   L + IN +SI
Sbjct: 228 HRMTLSDSQFVFPVNTICFIPN-SNILYTGGSDGCVSCWNISSKRKVGQLPK-INETSI 284

>ZYRO0A09636g Chr1 (779501..781927) [2427 bp, 808 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 808

 Score = 37.4 bits (85), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 27/124 (21%), Positives = 55/124 (44%), Gaps = 9/124 (7%)

Query: 59  NDFEIVNNNYNGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGT 118
            D   +    +G  L   +  + +KI+DL+    ++++     S  +  DS   ++A G 
Sbjct: 61  QDITALKLTADGRYLCFASQAQLLKIFDLREGKIVRSMKISSPSYVVDSDSTSTLLAIG- 119

Query: 119 ELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSK---VLMSGSTDGYTNIY 175
              G D  + + D+   +  +   +  H   I+ +KF+   +    +L SG T+G   I+
Sbjct: 120 ---GTDGSITVVDVE--NGYVTHSLKGHGGTISSVKFYGEQNGEVWLLASGDTNGMVKIW 174

Query: 176 DLTE 179
           DL +
Sbjct: 175 DLVK 178

>Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON}
           YOL138C - Hypothetical ORF [contig 124] FULL
          Length = 1286

 Score = 37.4 bits (85), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 8/69 (11%)

Query: 116 CGTELSGVDAELYIYDIRSWDT---PIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYT 172
           CGT  S     + IYDI   +T   P+ + +  H   I  + F+   S +L+SGS DG  
Sbjct: 184 CGTSTS-----VSIYDINKANTLEGPLTTILSKHTRSINSVDFNMAQSSLLISGSQDGCI 238

Query: 173 NIYDLTETE 181
            ++DL  ++
Sbjct: 239 KVWDLRSSQ 247

>YGL003C Chr7 complement(492474..494174) [1701 bp, 566 aa] {ON}
           CDH1Cell-cycle regulated activator of the
           anaphase-promoting complex/cyclosome (APC/C), which
           directs ubiquitination of cyclins resulting in mitotic
           exit; targets the APC/C to specific substrates including
           Cdc20p, Ase1p, Cin8p and Fin1p
          Length = 566

 Score = 37.0 bits (84), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 53/109 (48%), Gaps = 7/109 (6%)

Query: 70  GGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYI 129
           G  L V   N  V+IYD+    CI+T++   +     L   ++++  G+     D  +  
Sbjct: 314 GSHLAVGQANGLVEIYDVMKRKCIRTLSGHIDR-VACLSWNNHVLTSGSR----DHRILH 368

Query: 130 YDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLT 178
            D+R  D P    ++SH  ++  +K++  D+K L SG  D   ++Y+ T
Sbjct: 369 RDVRMPD-PFFETIESHTQEVCGLKWNVADNK-LASGGNDNVVHVYEGT 415

>KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {ON}
           Anc_2.469 YMR093W
          Length = 508

 Score = 36.6 bits (83), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 52/111 (46%), Gaps = 4/111 (3%)

Query: 82  VKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYIYDIRSWDTPIRS 141
           V+I+  K+   +KT +  K+  + +       +    + +G+ +    Y+ RS    I +
Sbjct: 63  VQIFSSKTRQVVKTFSRFKDVVYSASFRNDGKLLVAGDATGLVSVYDAYNPRSILLSINA 122

Query: 142 FVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSLHQVINY 192
              +H   +T  KFHP D+K L++ S D  T I+D++   E   L    +Y
Sbjct: 123 --STHPTHVT--KFHPQDNKTLVTTSDDRVTRIWDISHAYEAQELTGASDY 169

>Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {ON}
           YKR036C (REAL)
          Length = 646

 Score = 37.0 bits (84), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 36/149 (24%), Positives = 73/149 (48%), Gaps = 38/149 (25%)

Query: 58  INDFEIVNN-----NYNGGSLMVTATNESVKIYDLKSNDCIKTI---------------T 97
           I++FE+ N+     +++  +L+  + ++ +  +DL +  C++ +                
Sbjct: 420 IHNFELHNDEITALSFDSEALISGSKDKKIFHWDLATGKCVQELNLIFTPTHNDTKTSTR 479

Query: 98  NEKNSPFL---------SLDSLHNMMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHD 148
           + KN  +L         +L   ++ +A GT+    D  + ++D+R    P+RS ++ H D
Sbjct: 480 SGKNGTYLLGTEAPMIGALQCYNSALATGTK----DGVVRLWDLR-IGKPVRS-LEGHTD 533

Query: 149 DITDIKFHPNDSKVLMSGSTDGYTNIYDL 177
            IT +KF   DS+ L++GS D    I+DL
Sbjct: 534 GITSLKF---DSEKLVTGSMDNSVRIWDL 559

>TBLA0B04680 Chr2 complement(1095348..1099997) [4650 bp, 1549 aa] {ON}
            Anc_5.49 YHR186C
          Length = 1549

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 75/173 (43%), Gaps = 20/173 (11%)

Query: 18   LKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGE---TSINDFEIVNNNYNGGSLM 74
            +KF    NY L+T+     I++ DW+++QI  K   G    T I   +++N + N   L+
Sbjct: 1190 IKFSQFENY-LITADERDNITVFDWESSQICSKFSNGNPYGTKITSLQLINEDDN-ALLL 1247

Query: 75   VTATNESVKIY-------DLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAEL 127
              ++N  VK++       D++  +  + +T+   +P  S   L      G  L+  D ++
Sbjct: 1248 TGSSNGIVKVFKNMHDSEDVEVINSWRALTDMLLTPRSSGLLLEWQQMKGYLLATGDVKV 1307

Query: 128  YIYDIRSWDTPIRSF-VD---SHHDDITDIKFHPNDSKVLMSGSTDGYTNIYD 176
                IR WD    S  VD        IT I        + + G TDG   +YD
Sbjct: 1308 ----IRIWDAHTESMEVDIPAKTSSLITSITSDQLSGNIFVCGFTDGSLRVYD 1356

>Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W
           (REAL)
          Length = 303

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 38/162 (23%), Positives = 72/162 (44%), Gaps = 21/162 (12%)

Query: 25  NYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNNNYNGGSLMVTATNESVKI 84
           N  ++TS  +G I + D ++  I    K     +N+  I   + N G L+    + +++I
Sbjct: 87  NRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVI---HPNQGELISCDRDGNIRI 142

Query: 85  YDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYIYDIRSWDTPIRSFVD 144
           +DL  N C   +T E ++   SL    +M + G+ L+  +++   Y    W+ P R+   
Sbjct: 143 WDLGENQCTHQLTPEDDTSLQSL----SMASDGSMLAAANSKGNCY---VWEMPNRTDA- 194

Query: 145 SHHDDITDIKFH---------PNDSKVLMSGSTDGYTNIYDL 177
           SH   +T  + H          +D K L + S D    ++ +
Sbjct: 195 SHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSI 236

>Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129W
           (DIP2) - interacts with Dom3p [contig 171] FULL
          Length = 937

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 55/112 (49%), Gaps = 11/112 (9%)

Query: 73  LMVTATNESVKIYDLKSNDCIKTITN--EKNSPFLSLDSLHNMMACGTELSGVDAELYIY 130
           L+ TA+N ++KI+++K+N CI+T          FL   +L   +  GT+      +L++Y
Sbjct: 399 LLATASNGTLKIWNIKTNSCIRTFECGYALACKFLPGGAL---VVLGTK----TGDLHLY 451

Query: 131 DIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEE 182
           D+ S  T + +   +H   I  +     D K L++GS D     +D    +E
Sbjct: 452 DLAS-STLLNTIEGAHSGAIWSLDM-TTDGKRLVTGSADKTVCFWDFQVEQE 501

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 63/165 (38%), Gaps = 28/165 (16%)

Query: 28  LLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNNNYNGGSLMVTATNES-VKIYD 86
           LL + SNG + I + KTN      + G      + +      GG+L+V  T    + +YD
Sbjct: 399 LLATASNGTLKIWNIKTNSCIRTFECG------YALACKFLPGGALVVLGTKTGDLHLYD 452

Query: 87  LKSNDCIKTITNEKNSPFLSLDSLHNMMACGTEL--SGVDAELYIYDIRSWDTPIRSFVD 144
           L S+  + TI    +    SLD    M   G  L     D  +  +D +    P+    D
Sbjct: 453 LASSTLLNTIEGAHSGAIWSLD----MTTDGKRLVTGSADKTVCFWDFQVEQEPVPGTTD 508

Query: 145 SH--------------HDDITDIKFHPNDSKVLMSGSTDGYTNIY 175
                           +DD+  +K  P D+++L     D    ++
Sbjct: 509 KFNPKLKMFHDTTLELNDDVLAVKISP-DNRLLAVSLLDNTVKVF 552

>TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {ON}
           Anc_8.631 YOR212W
          Length = 431

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 24/66 (36%), Positives = 39/66 (59%), Gaps = 7/66 (10%)

Query: 112 NMMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGY 171
           NM A G    G D+ ++I+D R+  + ++ F  S+ D +  +KF+ ND   ++SGS DG 
Sbjct: 248 NMFATG----GSDSYVHIWDTRA-PSSVQKFYISNSD-VNTVKFY-NDGNAIVSGSDDGI 300

Query: 172 TNIYDL 177
             +YDL
Sbjct: 301 IRLYDL 306

>CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa]
           {ON} highly similar to uniprot|Q04305 Saccharomyces
           cerevisiae YMR093w
          Length = 517

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 48/101 (47%), Gaps = 4/101 (3%)

Query: 82  VKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYIYDIRSWDTPIRS 141
           V+++  ++   IKT +  K+  + +       + C  + +G+   + +YD  +  T + S
Sbjct: 63  VQVFSSRTRQAIKTFSRFKDVVYSASYRKDGKLLCAGDATGL---VSVYDSYNPRTLLVS 119

Query: 142 FVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEE 182
              S H      KFH +D K L+S S D  T ++D++   E
Sbjct: 120 VAASQHPTHV-TKFHDHDLKTLVSASDDRVTRVWDISHAYE 159

>KLTH0H05038g Chr8 complement(449230..452217) [2988 bp, 995 aa] {ON}
           similar to uniprot|Q08924 Saccharomyces cerevisiae
           YPL183C Hypothetical ORF
          Length = 995

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 87/199 (43%), Gaps = 48/199 (24%)

Query: 8   LTSFGSNNWC-LKFKPLYN---YGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEI 63
           LTS+     C L F+ L     YG  + L +G I++L+      +DK+ +          
Sbjct: 111 LTSYNKVLCCDLSFRVLQTKAVYGERSILYSGTITVLN------QDKVLV---------- 154

Query: 64  VNNNYNGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMA--CGTELS 121
                N G++M     + V ++DLK+   I   T+ + S F    S+    A  C  + S
Sbjct: 155 -----NAGTVM-----DGVLVWDLKTEKTIHHFTDHEGSIFYVAASIKGRYAASCSDDRS 204

Query: 122 GVDAELYIYDIRSWDTPIRSFVDS---HHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLT 178
                     I+ WD      V +   H   I ++KF+ NDSK L+S S D    +++++
Sbjct: 205 ----------IKLWDLHSGHLVSTGWGHTARIWNLKFYDNDSK-LISVSEDCTCRVWEIS 253

Query: 179 E--TEEEDSLHQVINYSSI 195
           E  T  + S+H++    SI
Sbjct: 254 ERGTLIQKSIHELHQTKSI 272

>Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093W
           (REAL)
          Length = 513

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 50/102 (49%), Gaps = 6/102 (5%)

Query: 82  VKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYIYDIRSWDTPIRS 141
           V+I+  ++   IKT +  K+  + +       + C  + +G+   + +YD  +  T + S
Sbjct: 63  VQIFSSRTRQVIKTFSRFKDVVYSASFRSDGKLLCAGDATGL---VSVYDSYNPRTILLS 119

Query: 142 F-VDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEE 182
               +H   +T  KFH  DSK+L + S D  T ++D++   E
Sbjct: 120 MNASTHPTHVT--KFHTQDSKILATASDDRVTRLWDISNAYE 159

>CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011w SOF1
          Length = 477

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 45/192 (23%), Positives = 80/192 (41%), Gaps = 38/192 (19%)

Query: 148 DDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSLHQVINYSSIHSCGWLSSRRIF 207
           D+I  +KF+ ND+ VL S  +D    +YDL       +  +++    ++S  W       
Sbjct: 217 DNINTVKFNQNDANVLGSAGSDNSIVLYDL---RTNSATQKIVQTMRVNSMCW------- 266

Query: 208 TLSHMETFAIHQLNDKSEVLKEPKPIEFGDIRNDWGCNYVIDVYPGYIATGKTEESKGQL 267
             + ME F          V  E     + D+RN    +  ++V+  +++      +   +
Sbjct: 267 --NPMEAFNF-------VVASEDHNAYYYDMRN---MSRALNVFKDHVS------AVMDV 308

Query: 268 KISPFNNEKIDLAEDNNI-IIP--QAHGDEV-----IRDVFINP--NDPSNMYSCGEDGN 317
            ISP   E +  + D  I I P  + H  E+     ++ VF      D   + S  +DGN
Sbjct: 309 DISPTGEEVVTASYDKTIRIFPINKGHSREIYHTKRMQHVFQAKFSMDSKYVMSGSDDGN 368

Query: 318 VKLWKIDTTTKS 329
           V+LW+     +S
Sbjct: 369 VRLWRAKAWERS 380

>ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} similar
           to uniprot|P38129 Saccharomyces cerevisiae YBR198C TAF5
           Subunit (90 kDa) of TFIID and SAGA complexes involved in
           RNA polymerase II transcription initiation and in
           chromatin modification
          Length = 824

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 49/90 (54%), Gaps = 7/90 (7%)

Query: 8   LTSFGSNN---WCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIV 64
           L S+  +N   W +KF PL +Y    + S+   + L W  + I   ++I    +ND + V
Sbjct: 586 LVSYKGHNHPVWDVKFSPLGHY--FATASHDHTARL-WSCDHIY-PLRIFAGHLNDVDCV 641

Query: 65  NNNYNGGSLMVTATNESVKIYDLKSNDCIK 94
           + + NG  L   +++++ +++D+ + DC++
Sbjct: 642 SFHPNGCYLFTGSSDKTCRMWDIATGDCVR 671

>KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.469
           YMR093W
          Length = 509

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 56/123 (45%), Gaps = 9/123 (7%)

Query: 62  EIVNNNYNGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELS 121
           EI  N  +     VT++   V+I+  ++   +KT +  K+  + +     N  A G  L 
Sbjct: 44  EIAFNPKSPFDFAVTSSTR-VQIFSSRTRQVVKTFSRFKDVVYCA-----NFRADGKLLV 97

Query: 122 GVDAE--LYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTE 179
             DA   + +YD  +    + S   S H      KFHP DSK L++ S D  T ++D++ 
Sbjct: 98  AGDATGLVSVYDSYNPRNVLVSIQASTHPTHV-TKFHPMDSKTLITSSDDRVTRLWDISH 156

Query: 180 TEE 182
             E
Sbjct: 157 AYE 159

>SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} similar
           to uniprot|P47025 Saccharomyces cerevisiae YJL112W MDV1
           WD repeat protein that regulates steps in the
           Dnm1p-dependent process of mitochondrial fission
          Length = 769

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 37/140 (26%), Positives = 64/140 (45%), Gaps = 33/140 (23%)

Query: 62  EIVNNNYNGGSLMVTATNESVKIYDLKSNDCIKTI-------TNEKNSPFLS-------- 106
           EI   +++G +L+  + + +++ +DL S  C++TI        N   S  LS        
Sbjct: 554 EITALSFSGDNLISGSQDRTIRQWDLNSGKCVQTIDINFASRVNSSTSGTLSSRSSTLLV 613

Query: 107 ---------LDSLHNMMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHP 157
                    L      +A GT+    D  + ++D+RS    +R+ +  H D IT ++F  
Sbjct: 614 PNEQPVIGALQCYDAALATGTK----DGLVRLWDLRSGQV-VRT-LQGHTDAITSLQF-- 665

Query: 158 NDSKVLMSGSTDGYTNIYDL 177
            DS  L++GS D    I+DL
Sbjct: 666 -DSINLITGSIDRSIRIWDL 684

>Suva_7.519 Chr7 (900889..901503) [615 bp, 205 aa] {ON} YGR225W
           (REAL)
          Length = 205

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 4/62 (6%)

Query: 105 LSLDSLHNMMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLM 164
           +SL+   N++A G    G D    ++DI + D P++ FV  H   +  I F P    +L 
Sbjct: 8   ISLNEHSNLLAVG----GNDNSCSLWDISNLDKPVKKFVLPHKAAVKAIAFCPWSKSLLA 63

Query: 165 SG 166
           +G
Sbjct: 64  TG 65

>ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly
           similar to uniprot|Q12024 Saccharomyces cerevisiae
           YOR272W YTM1 microtubule-associated protein
          Length = 448

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 61/123 (49%), Gaps = 11/123 (8%)

Query: 77  ATNESVKIYDLKSNDCIKTITNEKNSPFLS-LDSLHNMMACGTELSGVDAELYIYDIRSW 135
           + + +VK +DL ++ C+ T T   +   L+ L SLH ++ACG+  S     L+ +   S 
Sbjct: 295 SQDHTVKTWDLVTSRCVDTKTTSYSLLSLAQLPSLH-LLACGS--SARHITLHDFRANSS 351

Query: 136 DTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDL-------TETEEEDSLHQ 188
               +  +  H + +  +   P +  +L+SGS DG   ++D+       T T ++ S+ +
Sbjct: 352 SKITQQQLLGHKNFVVSLDTCPENEYMLVSGSHDGTAKVWDIRANSPMYTITRQDPSVQK 411

Query: 189 VIN 191
            +N
Sbjct: 412 GVN 414

>YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON}
           CAF4WD40 repeat-containing protein associated with the
           CCR4-NOT complex, interacts in a Ccr4p-dependent manner
           with Ssn2p; also interacts with Fis1p, Mdv1p and Dnm1p
           and plays a role in mitochondrial fission
          Length = 643

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 72/152 (47%), Gaps = 31/152 (20%)

Query: 62  EIVNNNYNGGSLMVTATNESVKIYDLKSNDCIKTI----TNEKNSPFLSLDSLHNMMAC- 116
           EI   +++  +L+  + ++ +  +DL +  CI+ +    T   +   +   SL+N  AC 
Sbjct: 426 EITALSFDSEALVSGSRDKKIFHWDLTTGKCIQQLDLIFTPTHSDIKMPARSLNNG-ACL 484

Query: 117 -GTELSGVDAELYIYD-----------IRSWD----TPIRSFVDSHHDDITDIKFHPNDS 160
            GTE   + A L  Y+           +R WD     P+R  ++ H D IT +KF   DS
Sbjct: 485 LGTEAPMIGA-LQCYNSALATGTKDGIVRLWDLRVGKPVR-LLEGHTDGITSLKF---DS 539

Query: 161 KVLMSGSTDGYTNIYDLTETEEEDSLHQVINY 192
           + L++GS D    I+DL  +    S+  VI Y
Sbjct: 540 EKLVTGSMDNSVRIWDLRTS----SILDVIAY 567

>KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {ON}
           similar to uniprot|P53197 Saccharomyces cerevisiae
           YGL003C CDH1 CDC20 homolog 1 protein required for Clb2
           and Ase1 degradation
          Length = 556

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 31/136 (22%), Positives = 65/136 (47%), Gaps = 9/136 (6%)

Query: 70  GGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYI 129
           G  L V   N  VKI+D++   CI+TI    +     L   ++++  G+     D  +  
Sbjct: 304 GSHLAVGQANGLVKIFDVEKKRCIRTIPGHIDR-VACLSWNNHILTSGSR----DRRILH 358

Query: 130 YDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSLHQV 189
            D+R+ + P    + +H  ++  +K++ ++++ L SG  D    +YD T  +   +L + 
Sbjct: 359 RDVRTPE-PCFEEIRTHKQEVCGLKWNVDENQ-LASGGNDNVVFVYDGTSRKPILTLAE- 415

Query: 190 INYSSIHSCGWLSSRR 205
            + +++ +  W   RR
Sbjct: 416 -HTAAVKAMAWSPHRR 430

>NCAS0H02420 Chr8 (477754..482316) [4563 bp, 1520 aa] {ON} Anc_5.500
          Length = 1520

 Score = 36.2 bits (82), Expect = 0.16,   Method: Composition-based stats.
 Identities = 31/100 (31%), Positives = 43/100 (43%), Gaps = 12/100 (12%)

Query: 251 YPGYIATGKTE--ESKGQLKISPFNN----EKIDLAEDNNIIIPQAHGDEVIRDVFINPN 304
           Y G+  T + E  E    L I   NN    E I+  E+ +I  P+  G   I  VF NP 
Sbjct: 34  YHGFDQTAEEEIRELARTLTIQSVNNASVHESINELENQSIFTPEMEG---INPVFTNPA 90

Query: 305 DPS---NMYSCGEDGNVKLWKIDTTTKSLKIPEHFFDYSL 341
           +P     +    ED + K W  +    SL  P+ +  YSL
Sbjct: 91  NPGYNPKLDPVSEDFSSKAWVQNMANISLADPDFYKPYSL 130

>ACR085C Chr3 complement(508364..511228) [2865 bp, 954 aa] {ON}
           NOHBY322; No homolog in Saccharomyces cerevisiae
          Length = 954

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 42/78 (53%), Gaps = 4/78 (5%)

Query: 143 VDSHHDDITDIKFHPNDSKVLMSGST--DGYTNIYDLTETEEEDSLHQVINYSSIHSCGW 200
           +  H   + ++KFHP+DS+V MS     DG+ +++ LT T     L    N SS+    W
Sbjct: 203 IQQHSFGVANLKFHPSDSRVFMSLGQINDGFLHVWRLTSTNVV-LLGTNKNISSVTDVLW 261

Query: 201 LSSRRI-FTLSHMETFAI 217
            +S+ I + + H++ + I
Sbjct: 262 CNSKFITYGVRHLKEWRI 279

>YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}
           YTM1Constituent of 66S pre-ribosomal particles, forms a
           complex with Nop7p and Erb1p that is required for
           maturation of the large ribosomal subunit; has seven
           C-terminal WD repeats
          Length = 460

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 58/122 (47%), Gaps = 9/122 (7%)

Query: 77  ATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYIYDIRSWD 136
           + + ++K +DL +  CI T T   +   ++  S  N++ACG+  S     L+   + +  
Sbjct: 307 SQDHTIKTWDLVTARCIDTRTTSYSLLSIAQLSTLNLLACGS--SARHITLHDPRVGASS 364

Query: 137 TPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDL-------TETEEEDSLHQV 189
              +  +  H + ++ +   P +  +L SGS DG   ++D+       T T E+ S+ + 
Sbjct: 365 KVTQQQLIGHKNFVSSLDTCPENEYILCSGSHDGTVKVWDVRSTSPMYTITREDKSVQKG 424

Query: 190 IN 191
           +N
Sbjct: 425 VN 426

>KLTH0H12122g Chr8 (1034092..1035003) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006W LST8 Protein required for the transport of amino
           acid permease Gap1p from the Golgi to the cell surface
           component of the TOR signaling pathway associates with
           both Tor1p and Tor2p contains a WD-repeat
          Length = 303

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 31/142 (21%), Positives = 64/142 (45%), Gaps = 18/142 (12%)

Query: 51  IKIGETSINDFEIVNNNYNGGSLMVTATNESVKIYDLKS---NDCIKTITNEKNSPFLSL 107
           I+  ++ +N  EI ++       +  A + +V++YD+++   N       +  N   ++ 
Sbjct: 28  IQHSDSQVNRLEITSDK----RFLAAAGHLNVRLYDIRTTNPNPVTSFEGHRGNVTSIAF 83

Query: 108 DSLHNMMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGS 167
              +  M   +E    D  + ++D+R+   P       HH  + ++  HPN  + L+S  
Sbjct: 84  QQENKWMVSSSE----DGTIKVWDVRA---PSVQRNYKHHAAVNEVVIHPNQGE-LISCD 135

Query: 168 TDGYTNIYDLTETEEEDSLHQV 189
            DG   I+DL E +    +HQ+
Sbjct: 136 QDGNIKIWDLGENQ---CVHQL 154

 Score = 35.0 bits (79), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 48/95 (50%), Gaps = 6/95 (6%)

Query: 25  NYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNNNYNGGSLMVTATNESVKI 84
           N  +++S  +G I + D +   ++   K    ++N+  I   + N G L+    + ++KI
Sbjct: 87  NKWMVSSSEDGTIKVWDVRAPSVQRNYK-HHAAVNEVVI---HPNQGELISCDQDGNIKI 142

Query: 85  YDLKSNDCIKTITNEKNSPF--LSLDSLHNMMACG 117
           +DL  N C+  +  E ++P   LS+ S  +M+  G
Sbjct: 143 WDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAG 177

>SAKL0D08756g Chr4 complement(728765..729676) [912 bp, 303 aa] {ON}
           highly similar to uniprot|P41318 Saccharomyces
           cerevisiae YNL006W LST8 Protein required for the
           transport of amino acid permease Gap1p from the Golgi to
           the cell surface component of the TOR signaling pathway
           associates with both Tor1p and Tor2p contains a
           WD-repeat
          Length = 303

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 30/134 (22%), Positives = 59/134 (44%), Gaps = 15/134 (11%)

Query: 51  IKIGETSINDFEIVNNNYNGGSLMVTATNESVKIYDLKS---NDCIKTITNEKNSPFLSL 107
           I+  ++ +N  EI ++       +  A +  V++YD+++   N       +  N   +S 
Sbjct: 28  IQHADSQVNRLEITSDK----RFLAAAGHLHVRLYDIRTTNPNPVTSFEGHRGNVTSISF 83

Query: 108 DSLHNMMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGS 167
              +  M   +E    D  + ++D+R+   P       HH  + ++  HPN  + L+S  
Sbjct: 84  QQDNKWMVSSSE----DGTIKVWDVRA---PSVQRNYKHHAPVNEVVIHPNQGE-LISCD 135

Query: 168 TDGYTNIYDLTETE 181
            DG   I+DL E +
Sbjct: 136 QDGNIRIWDLGENQ 149

 Score = 33.1 bits (74), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 47/95 (49%), Gaps = 6/95 (6%)

Query: 25  NYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNNNYNGGSLMVTATNESVKI 84
           N  +++S  +G I + D +   ++   K     +N+  I   + N G L+    + +++I
Sbjct: 87  NKWMVSSSEDGTIKVWDVRAPSVQRNYK-HHAPVNEVVI---HPNQGELISCDQDGNIRI 142

Query: 85  YDLKSNDCIKTITNEKNSPF--LSLDSLHNMMACG 117
           +DL  N C   +T E ++P   LS+ S  +M+  G
Sbjct: 143 WDLGENQCTHQLTPEDDTPLQSLSIASDGSMLVAG 177

>Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {ON}
           YMR131C (REAL)
          Length = 510

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 52/111 (46%), Gaps = 4/111 (3%)

Query: 93  IKTITNEKNSPFLSLDSLHNMMACGTELSG-VDAELYIYDIRS--WDTPIRSFVDSHHDD 149
           I T+ N  N     LD    ++  G  LSG    ++Y+    +  W T  +SF  S+++ 
Sbjct: 264 IHTVKNHGNVEGYGLD-WSPLIKTGALLSGDCSGQIYLTQRHTSRWVTDKQSFTVSNNES 322

Query: 150 ITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSLHQVINYSSIHSCGW 200
           I DI++   +S V  + + DGY  I+D    + + ++    + + ++   W
Sbjct: 323 IEDIQWSRTESTVFATAACDGYIRIWDTRSKKHKPAISVKASNTDVNVISW 373

 Score = 34.3 bits (77), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 40/185 (21%), Positives = 87/185 (47%), Gaps = 19/185 (10%)

Query: 18  LKFKPLYNYG-LLTSLSNGEISILDWKTNQ-IKDKIKIGETSINDFEIVNNNYNGGSLMV 75
           L + PL   G LL+   +G+I +    T++ + DK     ++    E +  +    ++  
Sbjct: 278 LDWSPLIKTGALLSGDCSGQIYLTQRHTSRWVTDKQSFTVSNNESIEDIQWSRTESTVFA 337

Query: 76  TATNES-VKIYDLKSNDCIKTITNEKNSPFLSL----DSLHNMMACGTELSGVDAELYIY 130
           TA  +  ++I+D +S      I+ + ++  +++    D +  ++A G +    +    ++
Sbjct: 338 TAACDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDD----NGTWGVW 393

Query: 131 DIRSW-----DT--PIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEE 183
           D+R +     DT  P+  + D H   IT I F+P D  ++  GS D    ++DL+   ++
Sbjct: 394 DLRQFTPSNADTVQPVAQY-DFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADD 452

Query: 184 DSLHQ 188
           + + Q
Sbjct: 453 EEIKQ 457

>Skud_7.284 Chr7 complement(495549..497249) [1701 bp, 566 aa] {ON}
           YGL003C (REAL)
          Length = 566

 Score = 35.8 bits (81), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 53/109 (48%), Gaps = 7/109 (6%)

Query: 70  GGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYI 129
           G  L V   N  V+IYD+    CI+T++   +     L   ++++  G+     D  +  
Sbjct: 314 GSHLAVGQENGLVEIYDVIKRKCIRTLSGHVDR-VACLSWNNHVLTSGSR----DHRILH 368

Query: 130 YDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLT 178
            D+R  D P    ++SH  ++  +K++  D+K L SG  D   ++Y+ T
Sbjct: 369 RDVRMPD-PFFETIESHTQEVCGLKWNVADNK-LASGGNDNMVHVYEGT 415

>Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON}
           similar to Ashbya gossypii ADL186C
          Length = 1317

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 8/68 (11%)

Query: 116 CGTELSGVDAELYIYDI-RSWD--TPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYT 172
           CGT  S     L IYDI R+ D  +P+ +    H   I  + F+   + +++SG  DGY 
Sbjct: 212 CGTSTS-----LSIYDINRTSDIGSPLVATYSEHSRSINSVDFNMGQTNLIISGGQDGYI 266

Query: 173 NIYDLTET 180
            ++DL  T
Sbjct: 267 KVWDLRST 274

>Kwal_0.212 s0 (105364..106275) [912 bp, 303 aa] {ON} YNL006W (LST8)
           - Protein required for transport of permeases from the
           Golgi to the plasma membrane [contig 82] FULL
          Length = 303

 Score = 35.4 bits (80), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 49/95 (51%), Gaps = 6/95 (6%)

Query: 25  NYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNNNYNGGSLMVTATNESVKI 84
           N  +++S  +G I + D +   ++   K  + ++N+  I   + N G L+    + +V+I
Sbjct: 87  NKWMVSSSEDGTIKVWDVRAPSVQRNYK-HQAAVNEVVI---HPNQGELISCDQDGNVRI 142

Query: 85  YDLKSNDCIKTITNEKNSPF--LSLDSLHNMMACG 117
           +DL  N C+  +  E ++P   LS+ S  +M+  G
Sbjct: 143 WDLGENQCVHQLAPEDDTPLQSLSVASDGSMLVAG 177

>KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178W PRP4
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 459

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 71/144 (49%), Gaps = 18/144 (12%)

Query: 68  YNGGSLMVTATNESVK-IYDLKSNDCIKTITNEKNSPFLSLDSLHN--MMACGTELSGVD 124
           +N GSL+ TA  +++  I+D++S   I ++    + P  S+D   N   +A G+     D
Sbjct: 314 HNDGSLVSTAGLDAIALIWDIRSGKNIMSLQGH-SKPIYSVDWSQNGYQLASGSG----D 368

Query: 125 AELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYD----LTET 180
             + ++DIR     + + + +H+  ++ +KF+  +   L+S   D   NI++    + E 
Sbjct: 369 GTIKVWDIRK-KGNVETIL-AHNSIVSQVKFNKQNGGYLVSSGYDKKVNIFNDGNWIKER 426

Query: 181 EEEDSLHQVINYS----SIHSCGW 200
             E  L +V++       I+S GW
Sbjct: 427 SLEGHLDKVMSIDIVGPDIYSAGW 450

>TBLA0D04870 Chr4 complement(1194448..1195431) [984 bp, 327 aa] {ON}
           Anc_1.399 YNL006W
          Length = 327

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 36/165 (21%), Positives = 70/165 (42%), Gaps = 39/165 (23%)

Query: 51  IKIGETSINDFEIVNNNYNGGSLMVTATNESVKIYDLKSND-----CIKTITNEKNSPFL 105
           I+  E+ +N  EI ++     +L+  A N+SV++YDL+S +     C+    +  N   +
Sbjct: 28  IQHPESQVNRLEISSDK----TLLAAAANQSVRLYDLQSANPTPLACLD--GHGGNVTAV 81

Query: 106 SLDSLHNMMACGTELSGVDAELYIYDIRSWDTPIRSFV--------------------DS 145
           +       +A  +E    D  + ++D+RS  T  R ++                     +
Sbjct: 82  AFQRERQWIATASE----DGAVRVWDVRSPPTQPRIYLHGSSGSSSSTSGNSSSASSVGT 137

Query: 146 HHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSLHQVI 190
               + D+  HPN ++ L+S    G   ++DL       S HQ++
Sbjct: 138 GAAPVNDVAIHPNQAE-LVSCDRSGTLRVWDLAGGR---STHQLV 178

>AGR180W Chr7 (1090641..1093061) [2421 bp, 806 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR222C (UTP13)
          Length = 806

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 54/114 (47%), Gaps = 9/114 (7%)

Query: 69  NGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELY 128
           +G  L   + N+ ++ YDL++    +++     +  L  D    ++A G    G D  + 
Sbjct: 71  DGRYLCYASQNQLLRFYDLETKRTTRSMKISSPAYVLDCDESSTLLAVG----GTDGSVN 126

Query: 129 IYDIRSWDTPIRSFVDSHHDDITDIKFHPN-DSK--VLMSGSTDGYTNIYDLTE 179
           ++DI   +  +   +  H   I+ +KF+   DS   +L SG T+G   I+DL +
Sbjct: 127 VFDIA--NGYVTHSLKGHGATISSVKFYGEVDSGMWLLASGDTNGMVKIWDLVK 178

>KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON}
           similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1133

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 31/57 (54%), Gaps = 1/57 (1%)

Query: 127 LYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEE 183
           +Y++D+R   +P+ S ++ H   +  I F+P +   +MS   DG    +D  + E+E
Sbjct: 182 VYVWDVRKGTSPL-SVLEGHSGSVNSIDFNPFNETEIMSSGNDGTVKFWDYNKVEDE 237

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 22/45 (48%)

Query: 133 RSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDL 177
           RS    +   +  H   ITDI FHP   ++L + S D Y   +D+
Sbjct: 100 RSSSKAVEHVLHGHFRAITDINFHPLQPEILATSSIDTYALAWDM 144

>KAFR0H03140 Chr8 complement(600224..601135) [912 bp, 303 aa] {ON}
           Anc_1.399 YNL006W
          Length = 303

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 42/206 (20%), Positives = 82/206 (39%), Gaps = 58/206 (28%)

Query: 25  NYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNNNYNGGSLMVTATNESVKI 84
           N  ++TS  +G I + D ++  +    K     +N+  I   + N G L+    + +++I
Sbjct: 87  NRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVI---HPNQGELISCDRDGNIRI 142

Query: 85  YDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAE--LYIYDI---------- 132
           +DL  N C   +T E N+P  SL    ++ + G+ L   +++   Y++++          
Sbjct: 143 WDLGENQCTHQLTPEDNTPLQSL----SVASDGSMLVAANSKGNCYVWEMPNHTDASNLK 198

Query: 133 ---------------------------------RSW----DTPIRSFVDSHHDDITDIKF 155
                                            R+W    +  + S +D H   + D  F
Sbjct: 199 PVTKFKAHSNYITRILLSSDVKHLATCSADKTARTWSLDDNFKLESTLDGHQRWVWDCAF 258

Query: 156 HPNDSKVLMSGSTDGYTNIYDLTETE 181
              DS  L++ S+D Y  ++DL+  E
Sbjct: 259 SA-DSAYLVTASSDHYVRLWDLSTRE 283

>ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|Q04305 Saccharomyces
           cerevisiae YMR093W UTP15 Nucleolar protein component of
           the small subunit (SSU) processome containing the U3
           snoRNA that is involved in processing of pre-18S rRNA
          Length = 510

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 24/101 (23%), Positives = 52/101 (51%), Gaps = 4/101 (3%)

Query: 82  VKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYIYDIRSWDTPIRS 141
           V+++  ++   IKT +  K+  + +       + C  + +G+ +    Y+ R+    I +
Sbjct: 63  VQLFSSRTRQVIKTFSRFKDVVYSASFRNDGKLLCAGDATGLVSVYDSYNPRALLVSINA 122

Query: 142 FVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEE 182
              +H   +T  KFH +DSK L++ S D  T ++D++++ E
Sbjct: 123 --STHPTHVT--KFHSHDSKSLVTASDDRITRVWDISQSYE 159

>Kpol_1013.37 s1013
           complement(88637..88936,88986..88994,89037..90134) [1407
           bp, 468 aa] {ON}
           complement(88637..88936,88986..88994,89037..90134) [1407
           nt, 469 aa]
          Length = 468

 Score = 35.8 bits (81), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 51/106 (48%), Gaps = 7/106 (6%)

Query: 71  GSLMVTATNESVKI-YDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYI 129
           GSL+ TA  + V I +DL+S   I ++      P    D   N        SG D  + I
Sbjct: 322 GSLIATAGADKVGIIWDLRSGKNILSLVGHAK-PIYCSDWSQN--GYQXXXSG-DGTIKI 377

Query: 130 YDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIY 175
           +D+R  D      + +H + +TD+KF   +SK L+S S D   N++
Sbjct: 378 WDLRKVDDV--ETILAHKNVVTDLKFEKENSKFLISSSYDKDINVF 421

>KLLA0D04840g Chr4 (413362..414273) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006W LST8 Protein required for the transport of amino
           acid permease Gap1p from the Golgi to the cell surface
           component of the TOR signaling pathway associates with
           both Tor1p and Tor2p contains a WD-repeat
          Length = 303

 Score = 35.4 bits (80), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 42/83 (50%), Gaps = 4/83 (4%)

Query: 25  NYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNNNYNGGSLMVTATNESVKI 84
           N  +++S  +G I + D ++  ++   K     +N+  I   + N G L+    + +++I
Sbjct: 87  NRWMVSSSEDGTIKVWDVRSPSVQRNYK-HNAPVNEVAI---HPNQGELISCDQDGNIRI 142

Query: 85  YDLKSNDCIKTITNEKNSPFLSL 107
           +DL  N C   +T E N+P  SL
Sbjct: 143 WDLGENQCTNQLTPEDNTPLQSL 165

 Score = 30.4 bits (67), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 25/107 (23%), Positives = 52/107 (48%), Gaps = 9/107 (8%)

Query: 73  LMVTATNESVKIYDLKSNDCIKTITN-EKNSPFLSLDSLHNMMACGTELSGVDAELYIYD 131
           L     + +++ ++  +  C +TI + +     L + S    +A    L      + +YD
Sbjct: 5   LASAGYDHTIRFWEALTGVCSRTIQHADSQVNRLEITSDKKYLAAAGHL-----HVRLYD 59

Query: 132 IRSWD-TPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDL 177
           IRS +  P+ SF + H  ++T I F   +++ ++S S DG   ++D+
Sbjct: 60  IRSNNPNPVSSF-EGHKGNVTSIAFQ-QENRWMVSSSEDGTIKVWDV 104

>TPHA0B04250 Chr2 complement(995664..997187) [1524 bp, 507 aa] {ON}
           Anc_1.107 YNL253W
          Length = 507

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 71/157 (45%), Gaps = 14/157 (8%)

Query: 25  NYG--LLTSLSNGEISILDWKTN-QIKDKIKI--GETSINDFEIVNNNYNGGSLMVTATN 79
           N+G  ++   S GEIS+L    N ++K+ IK+      I   ++      G  L+    +
Sbjct: 242 NHGNYIIVGTSIGEISLLRVNNNKELKNIIKVPAHRGKITGLKVTPL---GDKLVSVGED 298

Query: 80  ESVKIYDLKSNDCIKTITN-EKNSPFLSLDSLHNMMACGTELSGVDAELYIYDIRSWDTP 138
            +  I+DL+S  CI TI   E N     L     ++   +E    + +   YD+ + +  
Sbjct: 299 GACLIWDLESLTCISTIVECESNIRTFDLSPSGKLLVVVSE----EGKFRFYDMITTEK- 353

Query: 139 IRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIY 175
           I  +   H D    +KF+PN S +++SG  D    +Y
Sbjct: 354 INDYDQKHLDSDFIVKFYPNKSWLMISGENDTLCRLY 390

>KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]
           {ON} highly similar to uniprot|Q12220 Saccharomyces
           cerevisiae YLR129W DIP2 Nucleolar protein specifically
           associated with the U3 snoRNA part of the large
           ribonucleoprotein complex known as the small subunit
           (SSU) processome required for 18S rRNA biogenesis part
           of the active pre-rRNA processing complex
          Length = 937

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 62/134 (46%), Gaps = 15/134 (11%)

Query: 51  IKIGETSINDFEIVNNNYNGGSLMVTATNESVKIYDLKSNDCIKTITN--EKNSPFLSLD 108
           IK   T +   +I ++N     L+ TA+N S+KI+++K+  CI+T          FL   
Sbjct: 381 IKGHRTDVRAIDISDDN----KLLATASNGSLKIWNIKTKSCIRTFECGYALACKFLPGG 436

Query: 109 SLHNMMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGST 168
           +L   +  GT+      +L ++D+ S  T + S   +H   I  +     D K L++GS 
Sbjct: 437 AL---VVIGTK----TGDLNLFDLAS-STLLSSIEAAHSGAIWSLDL-TADGKRLVTGSA 487

Query: 169 DGYTNIYDLTETEE 182
           D     +D    +E
Sbjct: 488 DKSVRFWDFQVEQE 501

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 2/46 (4%)

Query: 290 AHGDEVIRDVFINPNDPSNMYSCGEDGNVKLWKIDTTTKSLKIPEH 335
           AH D +++  F+   +  N +SCG+DG VK W  D      K+  H
Sbjct: 607 AHSDSIMKVAFLP--ESHNFFSCGKDGLVKYWDGDKFECIQKLAAH 650

>Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON}
           YEL056W (HAT2) - subunit of a cytoplasmic histone
           acetyltransferase [contig 186] FULL
          Length = 396

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 45/211 (21%), Positives = 84/211 (39%), Gaps = 27/211 (12%)

Query: 124 DAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEE 183
           D  + I+DI+S  T   S    H D + + K+H +D  +  S S D +  I+D    +  
Sbjct: 181 DGSIAIWDIKSGKTVPTSVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKRSEKPL 240

Query: 184 DSLHQVINYSSI----HSCGWLSSRRIFTL-----SHMETFAIHQLNDKSEVLKEPKPIE 234
             L Q   +++I    HS    ++     +     S   T A+H ++   E +     +E
Sbjct: 241 QKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTS---LE 297

Query: 235 FGDIRNDWGCNYVIDVYPGYIATGKTEESKGQLKISPFNNEKIDLAEDNN---IIIPQAH 291
           F   ++            G + +G ++       +     E+ +   D+    +++  A 
Sbjct: 298 FAHHKD------------GILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAG 345

Query: 292 GDEVIRDVFINPNDPSNMYSCGEDGNVKLWK 322
               I D   +PN P  M S  E+  V++WK
Sbjct: 346 HKSAINDFSFSPNVPWLMASVEEENIVQIWK 376

>NDAI0G02580 Chr7 complement(590030..592906) [2877 bp, 958 aa] {ON}
           Anc_8.324 YLR129W
          Length = 958

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 60/130 (46%), Gaps = 15/130 (11%)

Query: 55  ETSINDFEIVNNNYNGGSLMVTATNESVKIYDLKSNDCIKTITN--EKNSPFLSLDSLHN 112
            T I   +I ++N     L+ TA+N  +KI+++K+  CI+T          FL   +L  
Sbjct: 403 RTDIRSIDISDDN----KLLATASNGLLKIWNIKTKSCIRTFECGYSLTCKFLPGGTL-- 456

Query: 113 MMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYT 172
            +  GT       EL ++D+ S  T + +  D+H   I  +    +D K L++GS D   
Sbjct: 457 -VIVGTR----GGELQLFDLAS-STLLETIEDAHDAAIWSLDL-TSDGKRLVTGSADKSV 509

Query: 173 NIYDLTETEE 182
             +D    +E
Sbjct: 510 KFWDFQLEQE 519

>Smik_16.79 Chr16 complement(149712..150310,150409..151591) [1782
           bp, 593 aa] {ON} YGR225W (REAL)
          Length = 593

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 4/62 (6%)

Query: 105 LSLDSLHNMMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLM 164
           +SL+   N++A G    G D    ++DI   D PI+ FV  H   +  I F P    +L 
Sbjct: 396 ISLNEHSNLLAVG----GNDNSCSLWDISDLDKPIKKFVLPHKAAVKAIAFCPWSKSLLA 451

Query: 165 SG 166
           +G
Sbjct: 452 TG 453

>KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1101

 Score = 35.8 bits (81), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 25/50 (50%)

Query: 133 RSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEE 182
           RS    +   +  H   ITDI FHP + ++L + S D Y + +D+  +  
Sbjct: 100 RSSSNAVEHVLHGHSRAITDINFHPTNPEILATCSIDAYVHAWDMRSSRR 149

>YGR225W Chr7 (945145..946327,946421..947019) [1782 bp, 593 aa] {ON}
            AMA1Activator of meiotic anaphase promoting complex
           (APC/C); Cdc20p family member; required for initiation
           of spore wall assembly; required for Clb1p degradation
           during meiosis
          Length = 593

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 4/62 (6%)

Query: 105 LSLDSLHNMMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLM 164
           +SL+   N++A G    G D    ++DI   D PI+ FV  H   +  I F P    +L 
Sbjct: 396 ISLNEHANLLAVG----GNDNSCSLWDISDLDKPIKKFVLPHKAAVKAIAFCPWSKSLLA 451

Query: 165 SG 166
           +G
Sbjct: 452 TG 453

>Smik_7.287 Chr7 complement(484376..486076) [1701 bp, 566 aa] {ON}
           YGL003C (REAL)
          Length = 566

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 53/109 (48%), Gaps = 7/109 (6%)

Query: 70  GGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYI 129
           G  L V   N  V+IYD+    CI+T++   +     L   ++++  G+     D  +  
Sbjct: 314 GSHLAVGQGNGLVEIYDVMKRKCIRTLSGHVDR-VACLSWNNHVLTSGSR----DHRILH 368

Query: 130 YDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLT 178
            D+R  D P    ++SH  ++  +K++  D+K L SG  D   ++Y+ T
Sbjct: 369 RDVRMPD-PFFETIESHTQEVCGLKWNVIDNK-LASGGNDNMVHVYEGT 415

>Skud_13.249 Chr13 (427918..429459) [1542 bp, 513 aa] {ON} YMR093W
           (REAL)
          Length = 513

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 50/102 (49%), Gaps = 6/102 (5%)

Query: 82  VKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYIYDIRSWDTPIRS 141
           V+I+  ++   IKT +  K+  + +       + C  + +G+   + +YD  +  T + S
Sbjct: 63  VQIFSSRTRQVIKTFSRFKDVVYSASFRSDGKLLCAGDATGL---VSVYDSYNPRTILLS 119

Query: 142 F-VDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEE 182
               +H   +T  KFH  D+KVL + S D  T ++D++   E
Sbjct: 120 INASTHPAHVT--KFHTQDNKVLATASDDRVTRLWDISHAYE 159

>Suva_7.518 Chr7 (899625..900807,900908..901506) [1782 bp, 593 aa]
           {ON} YGR225W (REAL)
          Length = 593

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 4/62 (6%)

Query: 105 LSLDSLHNMMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLM 164
           +SL+   N++A G    G D    ++DI + D P++ FV  H   +  I F P    +L 
Sbjct: 396 ISLNEHSNLLAVG----GNDNSCSLWDISNLDKPVKKFVLPHKAAVKAIAFCPWSKSLLA 451

Query: 165 SG 166
           +G
Sbjct: 452 TG 453

>AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR178W
           (PRP4)
          Length = 455

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 52/107 (48%), Gaps = 6/107 (5%)

Query: 71  GSLMVTATNESV-KIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYI 129
           G+L+ +A  ++V  I+DL+S + I  +     +    +D   N     T  +G D  + +
Sbjct: 310 GALLASAGLDAVCAIWDLRSGEPIMKLEGHAGA-ISGVDWSPNGYQLAT--AGADGTVRV 366

Query: 130 YDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYD 176
           +DIR+  T   S + +H     D+KF  N+   L+S   D   NI++
Sbjct: 367 WDIRNVGTE--SALLAHQVAALDVKFKKNNGTFLVSCGHDRLVNIFN 411

>TDEL0A07400 Chr1 complement(1292494..1295199) [2706 bp, 901 aa]
           {ON} Anc_6.325 YCR057C
          Length = 901

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 48/100 (48%), Gaps = 9/100 (9%)

Query: 134 SWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIY---DLTETEEEDSLHQVI 190
           SW    + F  +  + +  + FHPN S++L+ G  +G   +Y   D T  ++       +
Sbjct: 235 SWRITQKHFFHNEQNKVKCVTFHPN-SRILVVGFNNGEFRLYELPDFTLIQQLSMGQNPV 293

Query: 191 NYSSIHSCG-WLSSRRIFTLSHMETFAIHQLNDKSEVLKE 229
           N  SI+S G WL+    F  S +    +++   +S +LK+
Sbjct: 294 NTVSINSSGEWLA----FGSSKLGQLLVYEWQSESYILKQ 329

>KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.544
           YBR198C
          Length = 814

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 36/181 (19%), Positives = 79/181 (43%), Gaps = 12/181 (6%)

Query: 8   LTSFGSNN---WCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIV 64
           L S+  +N   W +KF P+ +Y    + S+ + + L W  + I   ++I    +ND E V
Sbjct: 576 LVSYKGHNHPVWDVKFSPMGHY--FATASHDQTARL-WSCDHIY-PLRIFAGHLNDVETV 631

Query: 65  NNNYNGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVD 124
           + + NG  +   + +++ +++D+ + D ++           +  +      C     G D
Sbjct: 632 SFHPNGCYVFTGSADKTCRMWDISTGDSVRLFLGHTAPVLTTAVTPDGRWLC---TGGED 688

Query: 125 AELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEED 184
             + ++DI +    ++       + I    F+  +  +L+SG  D    ++DL +   E 
Sbjct: 689 GVINVWDIGTGKR-LKQMRGHGKNAIHSFSFN-KEGNILISGGADHSVRVWDLKKATPEP 746

Query: 185 S 185
           S
Sbjct: 747 S 747

>TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {ON}
           Anc_8.435 YLR222C
          Length = 805

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 56/129 (43%), Gaps = 12/129 (9%)

Query: 69  NGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELY 128
           +G  L   +  + +KI+ L S    +++     S  +  DS   ++A G    G D  + 
Sbjct: 71  DGRYLCYVSQAQQLKIFSLDSMKITRSMKISSPSYVMDSDSTSTLIAIG----GTDGSIS 126

Query: 129 IYDIRSWDTPIRSFVDSHHDDITDIKFHP---NDSKVLMSGSTDGYTNIYDLTETEEEDS 185
           + D+   +  I      H   I+ +KFH     D  +L SG T+G   ++DL +      
Sbjct: 127 VVDVE--NGYITHSFKGHGGTISSLKFHGELNGDKWLLASGDTNGVAKVWDLVKRR---C 181

Query: 186 LHQVINYSS 194
           LH +  ++S
Sbjct: 182 LHTMQEHTS 190

 Score = 31.2 bits (69), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 23/109 (21%), Positives = 43/109 (39%), Gaps = 7/109 (6%)

Query: 133 RSWDTPIRSFVDSHHDDITDIK------FHPNDSKVLMSGSTDGYTNIYDLTETEEEDSL 186
           + WD   R  + +  +  + I+          D   L+SG  D   N+++    +    L
Sbjct: 172 KVWDLVKRRCLHTMQEHTSAIRGLDFKEVEGEDCVKLLSGGRDDIVNLWEFNMKKHSKLL 231

Query: 187 HQVINYSSIHSCGWLS-SRRIFTLSHMETFAIHQLNDKSEVLKEPKPIE 234
             V  +  + SCG++  S  ++T        +  L  +  + K  KPIE
Sbjct: 232 KTVPVHQQVESCGFVRESDLVYTAGGEAVLQLISLESQKVIKKTQKPIE 280

>KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} similar
           to uniprot|P38968 Saccharomyces cerevisiae YDL195W SEC31
           involved in protein transport from endoplasmic reticulum
           to Golgi Component (p150) of COPII coat of secretory
           pathway vesicles
          Length = 1299

 Score = 35.4 bits (80), Expect = 0.28,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 37/77 (48%), Gaps = 9/77 (11%)

Query: 111 HNMMACGTELSGVDAELYIYDIRSWDTP-----IRSFVDSHHDDITDIKFHPNDSKVLMS 165
           HN++  G    G   E+YI+D    +TP     +     +  D+I  + ++ N + V  S
Sbjct: 117 HNVLCSG----GSKGEIYIWDANKIETPGYAPFVPGTAMTPMDEIYSLAWNQNQAHVFAS 172

Query: 166 GSTDGYTNIYDLTETEE 182
             + GY +I+DL   +E
Sbjct: 173 AGSSGYASIWDLKAKKE 189

>CAGL0L03201g Chr12 complement(368792..370531) [1740 bp, 579 aa]
           {ON} some similarities with uniprot|P47025 Saccharomyces
           cerevisiae YJL112w MDV1 or uniprot|P36130 Saccharomyces
           cerevisiae YKR036c CAF4 CCR4
          Length = 579

 Score = 35.4 bits (80), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 62/127 (48%), Gaps = 29/127 (22%)

Query: 71  GSLMVTATNE-SVKIYDLKSNDCIKT------------------ITNEKNSPFL-SLDSL 110
           G+ +V+ +N+ +++ +DL S  CI++                  IT   N+P +   D +
Sbjct: 385 GNAIVSGSNDKTLRHWDLGSGKCIQSIDLTIALKMVPQSVSKLDITPSFNTPLIGGADCI 444

Query: 111 HNMMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDG 170
            N +  GT+    D  +Y++D+R     +   ++ H   IT +K+  ++   L++GS D 
Sbjct: 445 DNALVTGTK----DGIVYLWDLRI--GRVVGSLEGHRGPITSLKYMGSE---LITGSMDK 495

Query: 171 YTNIYDL 177
            T I+DL
Sbjct: 496 STRIWDL 502

>KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} similar
           to uniprot|Q12220 Saccharomyces cerevisiae YLR129W DIP2
           Nucleolar protein specifically associated with the U3
           snoRNA part of the large ribonucleoprotein complex known
           as the small subunit (SSU) processome required for 18S
           rRNA biogenesis part of the active pre- rRNA processing
           complex
          Length = 936

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 53/115 (46%), Gaps = 14/115 (12%)

Query: 71  GSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGV---DAEL 127
           G L+ TA+N  +K+++L +  CI+T        F    +L + M  G  L  V     EL
Sbjct: 395 GKLLSTASNGELKVWNLTTKKCIRT--------FSCGYALCSQMLPGGLLVVVGTRQGEL 446

Query: 128 YIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEE 182
            ++D+ S  + + S  ++H   I  +    N  K L++GS D     +D    E+
Sbjct: 447 QLFDLAS--STLLSTTEAHTAAIWSLDLTSN-GKRLVTGSADKSCKFWDFEVVEQ 498

>YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}
           DIP2Nucleolar protein, specifically associated with the
           U3 snoRNA, part of the large ribonucleoprotein complex
           known as the small subunit (SSU) processome, required
           for 18S rRNA biogenesis, part of the active pre-rRNA
           processing complex
          Length = 943

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 60/125 (48%), Gaps = 15/125 (12%)

Query: 55  ETSINDFEIVNNNYNGGSLMVTATNESVKIYDLKSNDCIKTIT--NEKNSPFLSLDSLHN 112
            T +   +I ++N     L+ TA+N S+KI+++K++ CI+T          FL    L  
Sbjct: 391 RTDVRSIDISDDN----KLLATASNGSLKIWNIKTHKCIRTFECGYALTCKFLPGGLL-- 444

Query: 113 MMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYT 172
            +  GT     + EL ++D+ S  + + +  D+H   I  +    +D K L++GS D   
Sbjct: 445 -VILGTR----NGELQLFDLAS-SSLLDTIEDAHDAAIWSLDL-TSDGKRLVTGSADKTV 497

Query: 173 NIYDL 177
             +D 
Sbjct: 498 KFWDF 502

 Score = 30.8 bits (68), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 59/127 (46%), Gaps = 20/127 (15%)

Query: 65  NNNYNGGSLMVTATNESVKIYDLKSNDCIKTITN-------------EKNSPFLSLDSLH 111
           N+N +G   ++T+  E V I+D+K+ D +  +++                  +L      
Sbjct: 32  NSNGSGPGQLITSALEDVNIWDIKTGDLVSKLSDGLPPGASDARGAKPAECTYLEAHKDT 91

Query: 112 NMMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGY 171
           +++A G      D  + ++D+ S  T + +F + H   IT ++F    ++ L+SGS D  
Sbjct: 92  DLLAVGY----ADGVIKVWDLMS-KTVLLNF-NGHKAAITLLQFDGTGTR-LISGSKDSN 144

Query: 172 TNIYDLT 178
             ++DL 
Sbjct: 145 IIVWDLV 151

>NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {ON}
           Anc_8.631
          Length = 428

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 122 GVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDL 177
           G D   YI+D RS     + FV     D+T IKF   D   +++GS DG  N++DL
Sbjct: 251 GSDGYTYIWDTRSPSAVQKFFVSD--SDVTSIKFF-KDGNSIITGSDDGIINMFDL 303

>TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {ON}
           Anc_2.469 YMR093W
          Length = 510

 Score = 35.0 bits (79), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 26/110 (23%), Positives = 51/110 (46%), Gaps = 6/110 (5%)

Query: 74  MVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYIYDIR 133
               ++  V+++   +   IKT +  K+  + +       + C  + +G+   + +YD  
Sbjct: 55  FAVTSSTRVQLFSSSTRQVIKTFSRFKDVVYSASFRSDGKLLCAGDATGL---VSVYDSY 111

Query: 134 SWDTPIRSF-VDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEE 182
           +  T + S    SH   +T  KFH  DSK L++ S D  T ++D++   E
Sbjct: 112 NPRTLLLSINASSHPTHVT--KFHTQDSKTLVTASDDRITRVWDISHAYE 159

>Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}
           similar to Ashbya gossypii AGR180W
          Length = 810

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 50/114 (43%), Gaps = 9/114 (7%)

Query: 69  NGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELY 128
           +G  L   A N+ ++IY L S   ++++        +  D    ++  G    G D  + 
Sbjct: 71  DGSYLCFVAQNQLLRIYSLASKKIVRSMKVSSPVYVMDCDETSTLLVIG----GTDGSVS 126

Query: 129 IYDIRSWDTPIRSFVDSHHDDITDIKFH---PNDSKVLMSGSTDGYTNIYDLTE 179
           I+DI   +  +      H   I+ +KF+      + +L SG T+G   I+DL +
Sbjct: 127 IFDIE--NGYVTHSFKGHGGIISSVKFYGELDGANWLLASGDTNGVVKIWDLVK 178

 Score = 33.9 bits (76), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 80/169 (47%), Gaps = 34/169 (20%)

Query: 33  SNGEISILDWKT-----NQIKDKIKIGETS----------INDFEIVNNNYNGGSLMVTA 77
           S+ ++++  WK      N  +D+I + +TS          IN   I  N+    S+  TA
Sbjct: 450 SSTDMTVKKWKVPKPTQNPTEDEIPVVKTSEYTRRAHEKDINALSISPND----SIFATA 505

Query: 78  T-NESVKIYDLKSNDCIKTITNEKNS----PFLSLDSLHNMMACGTELSGVDAELYIYDI 132
           + +++ KI+DL + + + T+ N K       F   D L  +  C    SG D  + I+ +
Sbjct: 506 SYDKTCKIWDLVTGELVATLANHKRGLWDVSFCQHDKL--IATC----SG-DKTIKIWSL 558

Query: 133 RSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETE 181
            +++  I++ ++ H + +  I F  N +K L+S   DG   I+D +  E
Sbjct: 559 ENYN--IKATLEGHTNAVQRISF-INKNKQLVSCGADGLVKIWDCSTGE 604

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 2/37 (5%)

Query: 289 QAHGDEVIRDVFINPNDPSNMYSCGEDGNVKLWKIDT 325
           + H + V R  FIN N    + SCG DG VK+W   T
Sbjct: 568 EGHTNAVQRISFINKN--KQLVSCGADGLVKIWDCST 602

>ZYRO0E04620g Chr5 (348647..349558) [912 bp, 303 aa] {ON} highly
           similar to uniprot|P41318 Saccharomyces cerevisiae
           YNL006W LST8 Protein required for the transport of amino
           acid permease Gap1p from the Golgi to the cell surface
           component of the TOR signaling pathway associates with
           both Tor1p and Tor2p contains a WD-repeat
          Length = 303

 Score = 34.7 bits (78), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 47/202 (23%), Positives = 76/202 (37%), Gaps = 50/202 (24%)

Query: 25  NYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNNNYNGGSLMVTATNESVKI 84
           N  + TS  +G I + D +   I    K+    +N+  I   + N G L+    +  ++I
Sbjct: 87  NKWMATSSEDGTIKVWDVRAPSIPRNYKLN-APVNEVVI---HPNQGELISCDRDGHIRI 142

Query: 85  YDLKSNDCIKTITNEKNSPF--LSLDSLHNMMACG--------------TELSGVDA--- 125
           +DL  N C   +T E ++P   LSL S  +M+                 T+ S +     
Sbjct: 143 WDLGENQCTHQLTPEDDTPLQSLSLASDGSMLVAANNKGNCYVWEMPNRTDASNLKPVTK 202

Query: 126 ----ELYIYDI------------------RSWDT----PIRSFVDSHHDDITDIKFHPND 159
                 YI  I                  R W       + + +D H   + D  F   D
Sbjct: 203 FRSHNTYITRILLSSDVKHLATCSADHTARVWSVDDNFKLETTLDGHQRWVWDCAFSA-D 261

Query: 160 SKVLMSGSTDGYTNIYDLTETE 181
           S  LM+ S+D Y  ++DL+  E
Sbjct: 262 SAYLMTASSDHYVRLWDLSTRE 283

>Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar to
           Ashbya gossypii AEL314W
          Length = 716

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 63/136 (46%), Gaps = 29/136 (21%)

Query: 62  EIVNNNYNGGSLMVTATNESVKIYDLKSNDCIK-------------------TITNEKNS 102
           EI   +++   L+  + + +++ +DL +  C++                   TI N    
Sbjct: 509 EITALSFDDDHLVSGSQDRTIRQWDLNNGKCVQTLDISFASGGNLSRSIYSSTILNPDEP 568

Query: 103 PFL-SLDSLHNMMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSK 161
           P + +L      +A GT+    D  + ++D+RS    +R+ +D H D IT ++F   DS 
Sbjct: 569 PIIGALQCYDAALATGTK----DGVVRLWDLRSGRV-VRT-LDGHSDAITSLEF---DSL 619

Query: 162 VLMSGSTDGYTNIYDL 177
            L++GS D    I+DL
Sbjct: 620 HLVTGSLDKSIRIWDL 635

>Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 64/126 (50%), Gaps = 20/126 (15%)

Query: 66  NNYNGGSLMVTATNESVKIYDLKSNDCIKTITN---------EKNSP----FLSLDSLHN 112
           NN +G   ++T+  E+V I+D+K+ D + T+++         + + P    +L +    N
Sbjct: 33  NNGSGPGQLITSALENVNIWDIKTGDLVTTLSDGLPPGASDAKGSKPAECTYLEVHQDTN 92

Query: 113 MMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYT 172
           ++A G      D  + ++D+ S  T + +F + H   IT ++F    ++ L+SGS D   
Sbjct: 93  LLAVGY----ADGVIKVWDLVS-KTVLLNF-NGHKAAITLMQFDSTGTR-LISGSKDSNI 145

Query: 173 NIYDLT 178
            ++DL 
Sbjct: 146 IVWDLV 151

 Score = 33.9 bits (76), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 59/125 (47%), Gaps = 15/125 (12%)

Query: 55  ETSINDFEIVNNNYNGGSLMVTATNESVKIYDLKSNDCIKTIT--NEKNSPFLSLDSLHN 112
            T +   ++ ++N     L+ TA+N S+KI+++K++ CI+T          FL    L  
Sbjct: 391 RTDVRSIDVSDDN----KLLATASNGSLKIWNVKTHKCIRTFECGYALTCKFLPGGLL-- 444

Query: 113 MMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYT 172
            +  GT       EL ++D+ S  + + +  D+H   I  +    +D K L++GS D   
Sbjct: 445 -VILGTR----SGELQLFDLAS-SSLLDTIEDAHDAAIWSLDL-TSDGKRLVTGSADKTV 497

Query: 173 NIYDL 177
             +D 
Sbjct: 498 KFWDF 502

>Ecym_3168 Chr3 complement(318158..322045) [3888 bp, 1295 aa] {ON}
           similar to Ashbya gossypii AFR382W
          Length = 1295

 Score = 35.0 bits (79), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 63/136 (46%), Gaps = 17/136 (12%)

Query: 25  NYGLLTSLSNGEISILDWKTN----QIKDKIKIGETSINDFEIVNNNYNGGSLMVTATNE 80
           N  L+ +LSN EI   +  TN    +++D+I++ E +IN    V N      L+V   + 
Sbjct: 577 NTQLVLALSNNEIVYFEIGTNDSLNELQDRIEL-EDTINGLS-VANGMRSNYLVVVCGDT 634

Query: 81  SVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDA--ELYIYDIRSWDTP 138
           SVK+Y LK +D          + F  + S+  + +    +  V +   L ++   +    
Sbjct: 635 SVKVYSLKMDD---------QNNFFEVVSMQALTSSANSIKLVSSNDSLCLHIGLASGVY 685

Query: 139 IRSFVDSHHDDITDIK 154
           +RS +D H   + D++
Sbjct: 686 VRSRLDKHDGQLFDVR 701

>Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W
           (REAL)
          Length = 1273

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 39/161 (24%), Positives = 68/161 (42%), Gaps = 10/161 (6%)

Query: 77  ATNESVKIYDLKSNDCIKTITN-EKNSPFLSLDSLHNMMACGTELSGVDAELYIYDIRSW 135
           +T+ S++++ L + D  K + + + +S F  LD  HN       L     ELY  +  + 
Sbjct: 37  STDSSLELWSLLATDSEKPLASLQVDSKFNDLDWSHNNEIIAGALDNGTLELYSTNEAND 96

Query: 136 DTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSLHQVI----- 190
                +   SH   +  +KF+     VL SG  +G   I+D+ +  E  S +  +     
Sbjct: 97  TISSTAKFGSHSSSVKTVKFNARQDNVLASGGNNGEIFIWDMNKCTESPSTYTPLTPGQS 156

Query: 191 --NYSSIHSCGWLSS-RRIFTLSHMETFA-IHQLNDKSEVL 227
             +   ++S  W  S   +F  +    FA I  L  K EV+
Sbjct: 157 MSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLKAKKEVI 197

>Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 35.0 bits (79), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 61/125 (48%), Gaps = 15/125 (12%)

Query: 55  ETSINDFEIVNNNYNGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHN-- 112
            T +   +I ++N     L+ TA+N S+KI+++K++ CI+T    +    LS   L    
Sbjct: 391 RTDVRSIDISDDN----KLLATASNGSLKIWNVKTHKCIRTF---ECGYALSCKFLPGGL 443

Query: 113 MMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYT 172
           ++  GT       EL ++D+ S  + + +  D+H   I  +    +D K L++GS D   
Sbjct: 444 LVILGTR----TGELQLFDLAS-SSLLDTVEDAHDAAIWSLDL-TSDGKRLVTGSADKTV 497

Query: 173 NIYDL 177
             +D 
Sbjct: 498 KFWDF 502

>NCAS0C03260 Chr3 complement(640108..643059) [2952 bp, 983 aa] {ON}
           Anc_8.324
          Length = 983

 Score = 35.0 bits (79), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 60/130 (46%), Gaps = 15/130 (11%)

Query: 55  ETSINDFEIVNNNYNGGSLMVTATNESVKIYDLKSNDCIKTIT--NEKNSPFLSLDSLHN 112
            T I   +I ++N     L+ TA+N S+KI++LK+  CI+T          FL    L  
Sbjct: 429 RTDIRSIDISDDN----KLLATASNGSLKIWNLKTKLCIRTFECGYALTCKFLPGGML-- 482

Query: 113 MMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYT 172
            +  GT       EL ++D+ S  T I +  ++H   I  +    +D K L++GS D   
Sbjct: 483 -VIIGTRA----GELQLFDLAS-STQIANIEEAHDAAIWSLDL-TSDGKRLITGSADKSV 535

Query: 173 NIYDLTETEE 182
             ++    +E
Sbjct: 536 KFWNFQLEQE 545

>Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}
           similar to Ashbya gossypii ACR137W
          Length = 426

 Score = 34.7 bits (78), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 51/92 (55%), Gaps = 14/92 (15%)

Query: 73  LMVTATNESV-KIYDLKSNDCIKTITNEK----NSPFLSLDSLHNMMACGTELSGVDAEL 127
           L+V+A  +SV +I+D++S  C+ T+   K     +  L++D    +++C T     DA +
Sbjct: 213 LIVSAGRDSVVRIWDIRSRTCVMTLAGHKGPINKARCLAVDP--QVVSCST-----DATV 265

Query: 128 YIYDIRSWDTPIRSFVDSHHDDITDIKFHPND 159
            ++DI +  T I++    H  ++ DI F+P +
Sbjct: 266 RLWDITAGKT-IKTLT-HHKRNVRDITFNPAE 295

 Score = 33.9 bits (76), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 47/102 (46%), Gaps = 11/102 (10%)

Query: 77  ATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYIYDIRSWD 136
           +T+ +V+++D+ +   IKT+T+ K +       + ++     E S   A     DIRSW 
Sbjct: 260 STDATVRLWDITAGKTIKTLTHHKRN-------VRDITFNPAEFSFTTA--CTDDIRSWM 310

Query: 137 TPIRSFVDSHHDDITDI--KFHPNDSKVLMSGSTDGYTNIYD 176
            P    + +   D   I      N   VL +GS DG+ + +D
Sbjct: 311 LPKGQLLTNFQSDSLGIINSLSCNQDGVLFAGSDDGHLSFFD 352

>Smik_14.82 Chr14 (149174..150442) [1269 bp, 422 aa] {ON} YNL253W
           (REAL)
          Length = 422

 Score = 34.7 bits (78), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 50/92 (54%), Gaps = 8/92 (8%)

Query: 84  IYDLKSNDCIKTITNEKNSPFLSLDSLH--NMMACGTELSGVDAELYIYDIRSWDTPIRS 141
           I+ LKS  C + + ++ +S  ++LD  H   ++   TE    D  +Y YD+ S  + ++S
Sbjct: 279 IWGLKS-LCCELVIHDLDSAVITLDVCHLGKILGICTE----DEMVYFYDLNS-GSLLQS 332

Query: 142 FVDSHHDDITDIKFHPNDSKVLMSGSTDGYTN 173
              +++D    +KF+PN S  +MSG  D  +N
Sbjct: 333 KSLANYDTDPVLKFYPNKSWYIMSGKNDTLSN 364

>Suva_14.89 Chr14 (164766..166034) [1269 bp, 422 aa] {ON} YNL253W
           (REAL)
          Length = 422

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 69/150 (46%), Gaps = 13/150 (8%)

Query: 28  LLTSLSNGEISILDWKTN--QIKDKIKIGETSINDFEIVNNNYNGGSLMVTATNESVKIY 85
           +     +G + IL  +    ++  KIK   +SI   +I   +  G   +  +++ +  I+
Sbjct: 224 IFVGFKSGHLVILKLRDEMLEVSTKIKAHTSSITGIKI---DPWGRYFVTGSSDGNCYIW 280

Query: 86  DLKSNDCIKTITNEKNSPFLSLDSLH--NMMACGTELSGVDAELYIYDIRSWDTPIRSFV 143
            LKS  C + I  + +S  ++LD  H   ++   TE    D  +Y YD+          +
Sbjct: 281 SLKSL-CCEKIIQDLDSAVVALDVCHLGKILGVCTE----DEMVYFYDLNEAKLLESKSL 335

Query: 144 DSHHDDITDIKFHPNDSKVLMSGSTDGYTN 173
            +H  D+  +KF+P+ S  ++SG  D  +N
Sbjct: 336 ANHKSDLV-LKFYPDKSWYILSGKNDTLSN 364

>SAKL0D03740g Chr4 (303240..304676) [1437 bp, 478 aa] {ON} similar
           to uniprot|Q12021 Saccharomyces cerevisiae YDR030C RAD28
           Protein involved in transcription-coupled repair
           nucleotide excision repair of UV-induced DNA lesions
           homolog of human CSA protein
          Length = 478

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 44/188 (23%), Positives = 77/188 (40%), Gaps = 15/188 (7%)

Query: 144 DSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSLHQVINYSSIHSCGWLSS 203
           DSH   IT IK++ +D+ +  +GS+D    I+D  E E   +       + + + G L  
Sbjct: 199 DSHSFAITSIKWYSHDNGMFFTGSSDREVKIWDTNEFEVVQNFQLGYRVNQLDTKGDL-- 256

Query: 204 RRIFTLSHMETFAIHQLNDKSEVLK---EPKPIEFGDIRNDWGCNYVIDVYPGYIATGKT 260
             +   S      +  L   S V+    + K ++FG I          D+    +A+G  
Sbjct: 257 --VIVASEDTYPRVIDLKSMSSVISLGVKNKKMKFG-INTAKFAPMGTDL----VASGDD 309

Query: 261 EESKGQLKISPFNNEKIDLAEDNNIIIPQAHGDEVIRDVFINPNDPSNMYSCGEDGNVKL 320
           + +     +   N+   DL E + +  P A   +   D+  NP     + + G DG  KL
Sbjct: 310 DGNVRIWDLRKSNSMLYDLTEQDTLSKPHA---KCCNDLCWNPRLEDELVTTGNDGKCKL 366

Query: 321 WKIDTTTK 328
           W    T++
Sbjct: 367 WSWRNTSE 374

>Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {ON}
           YKR036C (REAL)
          Length = 662

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 34/144 (23%), Positives = 67/144 (46%), Gaps = 33/144 (22%)

Query: 58  INDFEIVNNNYNGGSLMVTATNESVKIYDLKSNDCIK----------------------- 94
           I+D EI   +++  +L+  + ++ +  +D+ +  CI+                       
Sbjct: 441 IHDDEITALSFDSEALISGSKDKKILHWDMATGKCIQQLDLIFAPTHNDSRISAPSSNYS 500

Query: 95  TITNEKNSPFL-SLDSLHNMMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDI 153
           T   + ++P + +L    + +A GT+    D  + ++D+R    P+R  +  H D IT +
Sbjct: 501 TRLLDTDAPMIGALQCYKSALATGTK----DGIVRLWDLRV-GKPVR-LLRGHTDGITSL 554

Query: 154 KFHPNDSKVLMSGSTDGYTNIYDL 177
           KF   DS+ L++GS D    I+DL
Sbjct: 555 KF---DSEKLVTGSMDNSVRIWDL 575

>YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}
           UTP15Nucleolar protein, component of the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 513

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 50/102 (49%), Gaps = 6/102 (5%)

Query: 82  VKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYIYDIRSWDTPIRS 141
           V+I+  ++   IKT +  K+  + +       + C  + +G+   + +YD  +  T + S
Sbjct: 63  VQIFSSRTRQVIKTFSRFKDVVYSASFRSDGKLLCAGDATGL---VSVYDSYNPRTILLS 119

Query: 142 F-VDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEE 182
               +H   +T  KFH  D+K+L + S D  T ++D++   E
Sbjct: 120 INASTHPTHVT--KFHTQDNKILATASDDRVTRLWDISNAYE 159

>NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa]
           {ON} Anc_6.363
          Length = 671

 Score = 34.7 bits (78), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 53/124 (42%), Gaps = 18/124 (14%)

Query: 69  NGGSLMVTATNESVKIYDLKSNDCIKTITNEK-NSPFLSLDS--------LHNMMACGT- 118
           N G  + T  N++ +IY +   + I  ++++   SP  S  +        L+    C + 
Sbjct: 338 NDGQFLATGCNKTTQIYRVSDGELIAKLSDDSVTSPDTSSATSGSTPSTDLYIRSVCFSP 397

Query: 119 --ELSGVDAELYIYDIRSWDTPIRSFV---DSHHDDITDIKFHPNDSKVLMSGSTDGYTN 173
             E     AE  +  IR WD   R  V     H  D+  + + PN  K L+SGS D    
Sbjct: 398 DGEFLATGAEDKL--IRIWDIQERKIVMVLKGHEQDVYSLDYFPNGEK-LVSGSGDRTVR 454

Query: 174 IYDL 177
           I+DL
Sbjct: 455 IWDL 458

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 52/112 (46%), Gaps = 10/112 (8%)

Query: 69  NGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTEL-SGV-DAE 126
           +G  L   A ++ ++I+D++    +  +   +   + SLD   N    G +L SG  D  
Sbjct: 398 DGEFLATGAEDKLIRIWDIQERKIVMVLKGHEQDVY-SLDYFPN----GEKLVSGSGDRT 452

Query: 127 LYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLT 178
           + I+D+R+      S   S    +T +   PND K + +GS D    ++D T
Sbjct: 453 VRIWDLRTGQC---SLTLSIEYGVTTVAVSPNDGKFIAAGSLDRAVRVWDST 501

>KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {ON}
           Anc_8.324 YLR129W
          Length = 938

 Score = 34.7 bits (78), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 59/125 (47%), Gaps = 15/125 (12%)

Query: 55  ETSINDFEIVNNNYNGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHN-- 112
            T I    I ++N     L+ TA+N  +KI++LK++ CI+T    +    L    L    
Sbjct: 385 RTDIRSIAISDDN----KLLATASNGLLKIWNLKTHKCIRTF---ECGYALCCKFLPGGL 437

Query: 113 MMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYT 172
           ++  GT     + EL ++D+ S  T + +  D+H   I  +    +D K L++GS D   
Sbjct: 438 LVIVGTR----NGELQLFDLAS-STQLENIEDAHDAAIWSLDI-TSDGKRLITGSADKTV 491

Query: 173 NIYDL 177
             +D 
Sbjct: 492 KFWDF 496

 Score = 30.8 bits (68), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 2/46 (4%)

Query: 290 AHGDEVIRDVFINPNDPSNMYSCGEDGNVKLWKIDTTTKSLKIPEH 335
           AH D ++   F+N  +  N +SC +DG +K W  D      K+  H
Sbjct: 607 AHADSIMNVKFLN--NSHNFFSCSKDGTIKYWDGDKFECIQKLVAH 650

>Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129W
           (REAL)
          Length = 943

 Score = 34.7 bits (78), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 53/107 (49%), Gaps = 11/107 (10%)

Query: 73  LMVTATNESVKIYDLKSNDCIKTIT--NEKNSPFLSLDSLHNMMACGTELSGVDAELYIY 130
           L+ TA+N S+KI+++K++ CI+T          FL    L   +  GT     + EL ++
Sbjct: 405 LLATASNGSLKIWNVKTHKCIRTFECGYALTCKFLPGGLL---VILGTR----NGELQLF 457

Query: 131 DIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDL 177
           D+ S  + + +  D+H   I  +    +D K L++GS D     +D 
Sbjct: 458 DLAS-SSLLDTIEDAHDAAIWSLDL-TSDGKRLVTGSADKTVKFWDF 502

>SAKL0H07656g Chr8 complement(659189..660469) [1281 bp, 426 aa] {ON}
           similar to uniprot|P18851 YOR212W Saccharomyces
           cerevisiae STE4 G protein beta subunit
          Length = 426

 Score = 34.3 bits (77), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 29/126 (23%), Positives = 59/126 (46%), Gaps = 17/126 (13%)

Query: 58  INDFEIVNNNYNGGSLMVTATNESVKIYDLKSNDCIKTITNEK------NSPFLSLDSLH 111
           ++D E +NN     S++  + + +  ++D+  +  +   ++        + P     S  
Sbjct: 180 VSDLEFINNE----SILTASGDMTCALWDIPKSKRVSEYSDHLGDVLTLSVPPAGTTSYD 235

Query: 112 NMMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGY 171
           +M A G    G D  +Y++D RS  +    FV     DI+ ++F  +D   +++GS DG 
Sbjct: 236 SMFASG----GSDGYVYLWDTRSPSSVQNFFVS--DSDISTVRFF-SDGNSIITGSDDGI 288

Query: 172 TNIYDL 177
             ++DL
Sbjct: 289 ARLFDL 294

>KAFR0A00600 Chr1 (108157..110841) [2685 bp, 894 aa] {ON} Anc_2.450
           YMR102C
          Length = 894

 Score = 34.7 bits (78), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 22/36 (61%)

Query: 146 HHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETE 181
           H D +T +KFHPND +  ++GS D    ++ + + E
Sbjct: 323 HTDFVTSVKFHPNDDRFFVTGSLDHKCRLWSILDNE 358

>KAFR0A04110 Chr1 (826618..828000) [1383 bp, 460 aa] {ON} Anc_8.721
           YOR272W
          Length = 460

 Score = 34.3 bits (77), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 57/122 (46%), Gaps = 9/122 (7%)

Query: 77  ATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYIYDIRSWD 136
           + + ++K +DL ++ C+ T T   +   ++     N++ACG+  S     L+   + S  
Sbjct: 307 SQDHTIKTWDLVTSRCVDTKTTSYSLLSIAQIPTLNLLACGS--SARHITLHDPRVDSSS 364

Query: 137 TPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDL-------TETEEEDSLHQV 189
              +  +  H + +  +   P +  +L SGS DG   ++D+       T T E+ S+ + 
Sbjct: 365 KITQQQLIGHKNFVVSLDTCPENDYILASGSHDGTVKVWDIRSNSPVYTITREDSSVQKG 424

Query: 190 IN 191
           +N
Sbjct: 425 VN 426

>KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} similar
           to uniprot|P42841 Saccharomyces cerevisiae YNL317W PFS2
           Integral subunit of the pre-mRNA cleavage and
           polyadenylation factor (CPF) complex plays an essential
           role in mRNA 3'-end formation by bridging different
           processing factors and thereby promoting the assembly of
           the processing complex
          Length = 452

 Score = 34.3 bits (77), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 56/124 (45%), Gaps = 9/124 (7%)

Query: 73  LMVTATNES-VKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGV--DAELYI 129
           L+V+ + ++ +K +D +S  C+ T+   K++    + S       G  LS +  D    +
Sbjct: 221 LIVSGSKDNLIKFWDPRSGSCVSTMLGFKHT----IISTKFQPKQGNLLSVISKDKTCKV 276

Query: 130 YDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSLHQV 189
           YDIR     + S  D    D   +++HP D  V   G  DG    +DL++  + +     
Sbjct: 277 YDIRQQAKELFSVRDD--VDYMTLQWHPIDETVFTVGCYDGSIKHFDLSQENQPNKPTHN 334

Query: 190 INYS 193
           I Y+
Sbjct: 335 IPYA 338

>Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON}
           (27192..29201) [2010 nt, 670 aa]
          Length = 669

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 63/140 (45%), Gaps = 33/140 (23%)

Query: 62  EIVNNNYNGGSLMVTATNESVKIYDLKSNDCIKTITNE---KNSPFL------------- 105
           EI + +Y+  +L+  + ++++K +DL +  C++T        NSP               
Sbjct: 457 EISSISYDNFNLLTGSQDKTIKHWDLITGKCVQTFDVSFYLNNSPPFENKFSPTKKNYFA 516

Query: 106 --------SLDSLHNMMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHP 157
                   SL    + +A GT+    D  + ++D+RS    +   ++ H D IT +KF  
Sbjct: 517 HSEAPTIGSLQCFESALASGTK----DGLIRLWDLRS--GKVIRILEGHTDAITSLKF-- 568

Query: 158 NDSKVLMSGSTDGYTNIYDL 177
            D   L++GS D    I+D+
Sbjct: 569 -DMTNLITGSLDKNIRIWDM 587

>NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {ON}
           Anc_8.288
          Length = 1145

 Score = 34.3 bits (77), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 126 ELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTE 179
           ++YI+D+R   TP+   V  H   +  I F+   S  +MS S DG    +D+++
Sbjct: 184 DIYIWDLRMGSTPLHKLV-GHDSSVNSIDFNRFKSSEIMSSSNDGTVKFWDISK 236

>KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.324
           YLR129W
          Length = 942

 Score = 34.3 bits (77), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 68/279 (24%), Positives = 111/279 (39%), Gaps = 43/279 (15%)

Query: 73  LMVTATNESVKIYDLKSNDCIKTI--TNEKNSPFLSLDSLHNMMACGTELSGVDAELYIY 130
           L+ TA+N  +KI++L++  CI+T          FL    L   +  GT     + EL ++
Sbjct: 404 LLATASNGLLKIWNLRTKQCIRTFDCGYALTCKFLPGGLL---VILGTR----NGELQLF 456

Query: 131 DIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSLHQVI 190
           D+ S  T I +   +H   I  +    N  K L++GS D     +D         L Q+ 
Sbjct: 457 DLAS-STQIENIEGAHDAAIWSLDLTSN-GKRLVTGSADKTVKFWDF-------QLEQL- 506

Query: 191 NYSSIHSCGWLSSRRIFTLSHMETFAIHQLNDKSEVLK---EPKPIEFGDIRNDWGCNYV 247
               I      S  ++ TL+H  T    +LND    +K   E K +    + N     + 
Sbjct: 507 ---PIEGTSGKSESKL-TLNHDTTL---ELNDDVLCVKISPEDKHLAVSLLDNTVKI-FF 558

Query: 248 IDVYPGYIATGKTEESKGQLKISPFNNEKIDLAEDNNIIIPQ-----------AHGDEVI 296
           +D    +++    +     + IS  +   I  + D NI I             AH D ++
Sbjct: 559 LDTMKFFLSLYGHKLPVLSIDISFDSKMVITSSADKNIKIWGLDFGDCHKSLFAHQDSIM 618

Query: 297 RDVFINPNDPSNMYSCGEDGNVKLWKIDTTTKSLKIPEH 335
              F+   +  N +SC +DG VK W  D      K+  H
Sbjct: 619 NVKFL--PESHNFFSCSKDGQVKYWDGDKFECVQKLVSH 655

>Suva_13.270 Chr13 (435573..437114) [1542 bp, 513 aa] {ON} YMR093W
           (REAL)
          Length = 513

 Score = 34.3 bits (77), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 50/102 (49%), Gaps = 6/102 (5%)

Query: 82  VKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYIYDIRSWDTPIRS 141
           V+I+  ++   IKT +  K+  + +       + C  + +G+   + +YD  +  T + S
Sbjct: 63  VQIFSSRTRQVIKTFSRFKDVVYSASFRNDGKLLCAGDATGL---VSVYDSYNPRTILLS 119

Query: 142 F-VDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEE 182
               +H   +T  KFH  D+K+L + S D  T ++D++   E
Sbjct: 120 INASTHPTHVT--KFHTQDNKILATASDDRVTRLWDISHAYE 159

>KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {ON}
           some similarities with uniprot|P18323 Saccharomyces
           cerevisiae YCR084C
          Length = 725

 Score = 34.3 bits (77), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 52/110 (47%), Gaps = 10/110 (9%)

Query: 69  NGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTEL-SGV-DAE 126
           +G  L   A ++ ++I+DL +   + T+   +   + SLD        G +L SG  D  
Sbjct: 459 DGKFLATGAEDKLIRIWDLTTRRIVMTLQGHEQDIY-SLD----YFPSGDKLVSGSGDRT 513

Query: 127 LYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYD 176
           + I+D+R+      S   S  D +T +   P D K++ +GS D    I+D
Sbjct: 514 VRIWDLRAGQC---SLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWD 560

>Skud_14.85 Chr14 (158809..160077) [1269 bp, 422 aa] {ON} YNL253W
           (REAL)
          Length = 422

 Score = 33.9 bits (76), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 41/84 (48%), Gaps = 7/84 (8%)

Query: 92  CIKTITNEKNSPFLSLDSLH--NMMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDD 149
           C + I N+ +S  ++LD  H   ++A  TE   V    Y YDI          + ++  D
Sbjct: 286 CCELIINDLDSAVITLDICHLGKILAICTEGEMV----YFYDINDGKLLQSKSLANYKSD 341

Query: 150 ITDIKFHPNDSKVLMSGSTDGYTN 173
           +  +KF+PN S  +MSG  D  +N
Sbjct: 342 LV-LKFYPNKSWYIMSGKNDTLSN 364

>Suva_14.342 Chr14 (600032..600943) [912 bp, 303 aa] {ON} YNL006W
           (REAL)
          Length = 303

 Score = 33.9 bits (76), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 71/162 (43%), Gaps = 21/162 (12%)

Query: 25  NYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNNNYNGGSLMVTATNESVKI 84
           N  ++TS  +G I + D ++  I    K     +N+  I   + N G L+    + +++I
Sbjct: 87  NRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVI---HPNQGELISCDRDGNIRI 142

Query: 85  YDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYIYDIRSWDTPIRSFVD 144
           +DL  N C   +T E ++   SL    +M + G+ L+  +++   Y    W+ P  +   
Sbjct: 143 WDLGENQCTHQLTPEDDTSLQSL----SMASDGSMLAAANSKGNCY---VWEMPNHTDA- 194

Query: 145 SHHDDITDIKFH---------PNDSKVLMSGSTDGYTNIYDL 177
           SH   +T  + H          +D K L + S D    ++ +
Sbjct: 195 SHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSI 236

>NDAI0G02450 Chr7 complement(557055..559937) [2883 bp, 960 aa] {ON} 
          Length = 960

 Score = 34.3 bits (77), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 37/82 (45%), Gaps = 13/82 (15%)

Query: 158 NDSKVLMSGSTDGYTNIYDLTETEEEDSLHQVINYSSIHSCGWLSSRRIFTLSHMETFAI 217
           N S  L S +   +     LT T+E D+  QV+  SS+      SS    +L H  T  I
Sbjct: 93  NLSNTLASSNIPSFRTDMGLTNTQELDANSQVV--SSVTQAALASS----SLRHRPTLVI 146

Query: 218 HQLNDKSEVLKEPKPIEFGDIR 239
           +       V KEP+P+   DIR
Sbjct: 147 N-------VKKEPEPVHLTDIR 161

>NCAS0G03600 Chr7 complement(672904..673887) [984 bp, 327 aa] {ON}
           Anc_1.399
          Length = 327

 Score = 33.9 bits (76), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 83/175 (47%), Gaps = 18/175 (10%)

Query: 25  NYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNNNYNGGSLMVTATNESVKI 84
           N  ++TS  +G I + D ++  +    K     +N+  I   + N G L+    + ++KI
Sbjct: 107 NKWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVI---HPNQGELISCDRDGTIKI 162

Query: 85  YDLKSNDCI-KTITNEKNSPFLSLDSLHNMMACGTELSGVD--AELYIYDI-----RSWD 136
           +DL  N C  + I ++ N+   SL    ++ + G+ L   +   + Y++++      S  
Sbjct: 163 WDLGENQCTHQLIPDDDNTSLQSL----SVASDGSMLVAANNKGDCYVWEMPNHTDASNL 218

Query: 137 TPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSLHQVIN 191
            PI  F  +H D IT +    +D K + + S D    I+ + ETE++ +L   ++
Sbjct: 219 KPINKF-SAHKDYITRVVL-SSDVKHMATCSADRTAKIWSVGETEDDFNLETTLD 271

>Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {ON}
           similar to Ashbya gossypii AGL234W
          Length = 646

 Score = 34.3 bits (77), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 49/109 (44%), Gaps = 8/109 (7%)

Query: 69  NGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGV-DAEL 127
           +G  L   A ++ ++I+DL S   + T+   +   +    SL    A    +SG  D  +
Sbjct: 380 DGKYLATGAEDKLIRIWDLSSKKILMTLQGHEQDIY----SLDYFPAGDKLVSGSGDRTV 435

Query: 128 YIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYD 176
            I+D+R+      S   S  D +T +   P D K + +GS D    ++D
Sbjct: 436 RIWDLRTGQC---SLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWD 481

>Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa]
           {ON} YCR084C (TUP1) - glucose repression regulatory
           protein, exhibits similarity to beta subunits of G
           proteins [contig 17] FULL
          Length = 750

 Score = 34.3 bits (77), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 52/110 (47%), Gaps = 10/110 (9%)

Query: 69  NGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTEL-SGV-DAE 126
           +G  L   A ++ ++I+DL +   + T+   +   + SLD        G +L SG  D  
Sbjct: 481 DGKFLATGAEDKLIRIWDLATRRIVMTLQGHEQDIY-SLD----YFPSGDKLVSGSGDRT 535

Query: 127 LYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYD 176
           + I+D+R+      S   S  D +T +   P D K++ +GS D    I+D
Sbjct: 536 VRIWDLRTGQC---SLTLSIEDGVTTVAVSPGDGKLIAAGSLDRTVRIWD 582

>TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {ON}
           Anc_3.25 YNL317W
          Length = 459

 Score = 33.9 bits (76), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 60/124 (48%), Gaps = 11/124 (8%)

Query: 73  LMVTATNES-VKIYDLKSNDCIKTITNEKNSPFLS--LDSLHNMMACGTELSGVDAELYI 129
           L+V+A+ ++ +K++D +S  C+ T+ N K++   +    +  N++A  ++    D    +
Sbjct: 226 LIVSASKDNLIKLWDPRSGQCVSTLLNFKHTVLKTKFQPTKGNLLAAISK----DKSCRV 281

Query: 130 YDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSLHQV 189
           +DIR     +    D    D   + +HP +  +    S DG    +D+ +  EE    QV
Sbjct: 282 FDIRYHMKELTVIRD--EVDYMTLLWHPTNESMFTIASYDGAIKHFDILQNLEEP--QQV 337

Query: 190 INYS 193
           I Y+
Sbjct: 338 IPYA 341

>Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa]
           {ON} YDR128W - Hypothetical ORF [contig 174] FULL
          Length = 1102

 Score = 34.3 bits (77), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 21/39 (53%)

Query: 139 IRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDL 177
           I   +  H   ITDI FHP   ++L + S D Y + +D+
Sbjct: 106 IEHVLHGHSRAITDINFHPTHPEILATCSIDAYVHAWDM 144

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 126 ELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEE 183
           ++YI+D+R   TP+   +  H + +  I F   D   +MS S DG    +D + +++E
Sbjct: 181 DVYIWDLRKGCTPLH-VLQGHVNSVNSIDFSKFDETEIMSSSNDGTVKFWDYSLSDKE 237

>NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {ON}
           Anc_2.401 YMR131C
          Length = 511

 Score = 33.9 bits (76), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 43/192 (22%), Positives = 87/192 (45%), Gaps = 29/192 (15%)

Query: 16  WCLKFKPLYNYG-LLTSLSNGEISILDWKTNQ-IKDKIKIGETSINDFEIVNNNYNGGSL 73
           + L + PL   G LLT   +G+I      T++ I DK      +    E +  +    ++
Sbjct: 277 YALDWSPLTKTGALLTGDCSGQIYFTQRHTSKWITDKQPFTVANNQSIEDIQWSRTESTV 336

Query: 74  MVTATNES-VKIYDLKSNDCIKTITNEKNSPFLSLDSLH---NMMACGTEL-----SGVD 124
             +A  +  ++I+D +S         +K+ P +S+ + +   N+++   +L     SG D
Sbjct: 337 FASAGCDGYIRIWDTRS---------KKHKPAISVKASNTDVNVISWSEKLGYLLASGDD 387

Query: 125 AELY-IYDIRSWD-------TPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYD 176
              + ++D+R +         P+  + D H   IT I F+P D  ++  GS D    ++D
Sbjct: 388 NGTWGVWDLRQFSPENAGSVQPVAQY-DFHKGAITSISFNPLDESIIAVGSEDNTVTLWD 446

Query: 177 LTETEEEDSLHQ 188
           L+   +++ + Q
Sbjct: 447 LSVEADDEEIKQ 458

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 48/111 (43%), Gaps = 4/111 (3%)

Query: 93  IKTITNEKNSPFLSLDSLHNMMACGTELSG-VDAELYIYDIRS--WDTPIRSFVDSHHDD 149
           I T+ N  N    +LD    +   G  L+G    ++Y     +  W T  + F  +++  
Sbjct: 265 IHTVKNHGNVEGYALD-WSPLTKTGALLTGDCSGQIYFTQRHTSKWITDKQPFTVANNQS 323

Query: 150 ITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSLHQVINYSSIHSCGW 200
           I DI++   +S V  S   DGY  I+D    + + ++    + + ++   W
Sbjct: 324 IEDIQWSRTESTVFASAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISW 374

>KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1290

 Score = 34.3 bits (77), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 8/69 (11%)

Query: 116 CGTELSGVDAELYIYDIRSW---DTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYT 172
           CGT  S     + IYDI      D P    +  H   I  + F+   + +L+SGS DG  
Sbjct: 184 CGTSTS-----VSIYDINRANLVDGPASMVLSKHTRSINSVDFNMAQTSLLISGSQDGCI 238

Query: 173 NIYDLTETE 181
            ++DL  ++
Sbjct: 239 KVWDLRSSQ 247

>TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON}
           Anc_6.276 YPL247C Two N bases added to fix a frameshift
           that can't be corrected using the reads.
          Length = 447

 Score = 33.9 bits (76), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 125 AELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDL 177
           +++ I D+RS  +P+ + +++H   I  IK+HP    VL+S S D     +DL
Sbjct: 335 SKVLILDMRSPGSPLLT-LEAHTAPINQIKWHPTRRNVLLSASDDCQVLYWDL 386

>KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {ON}
           Anc_5.429 YDR364C
          Length = 439

 Score = 33.9 bits (76), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 24/125 (19%), Positives = 59/125 (47%), Gaps = 6/125 (4%)

Query: 11  FGSNNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNNNYNG 70
           F S   C++F+P  N+  +  L++ +I+  D + +     ++  +  +     +    +G
Sbjct: 230 FKSTPNCVEFRPANNHEFIVGLADSKIAHYDTRESSKHGLVQTYDHHLGSILSLRFFPDG 289

Query: 71  GSLMVTATNESVKIYDLKSNDCIKTI--TNEKNSPFLSLDSLHNMMACGTELSGVDAELY 128
              + ++ +++V+I++ + N  IK I  T + + PF+ +   H      +    +D  +Y
Sbjct: 290 SKFISSSEDKTVRIWENQINIPIKQISDTTQYSMPFIGIHPEHKYFCTQS----LDNTIY 345

Query: 129 IYDIR 133
            Y +R
Sbjct: 346 SYSLR 350

>Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}
           YPL247C (REAL)
          Length = 526

 Score = 33.9 bits (76), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 39/74 (52%), Gaps = 7/74 (9%)

Query: 126 ELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDS 185
           ++ I D+R+ ++PI + ++ H   + +IK+HP    VL+S S D     +DL  +  E  
Sbjct: 376 KIIILDMRNPESPILT-LEGHSSSVNEIKWHPTKRNVLLSCSDDCQVLYWDLNNSFME-- 432

Query: 186 LHQVINYSSIHSCG 199
               IN  S+ S G
Sbjct: 433 ----INGGSVKSPG 442

>NDAI0E00910 Chr5 complement(182574..183968) [1395 bp, 464 aa] {ON}
           Anc_8.721
          Length = 464

 Score = 33.9 bits (76), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 64/136 (47%), Gaps = 13/136 (9%)

Query: 64  VNNNYNGGSLMVTATNESVKIYDLKSNDCIKT-ITNEKNSPFLSLDSLHNMMACGTELSG 122
           +N+N  G S+   + + ++K +DL +  C+ T IT+      + + +L N++ACG+    
Sbjct: 300 INDNTVGYSV---SQDHTIKTWDLVTARCVDTKITSYSLLSLVQMPTL-NLLACGSSARH 355

Query: 123 VDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDL----- 177
           +       D  S     +  +  H + +  +   P +  +L SGS DG   ++D+     
Sbjct: 356 ITLHDPRMDSSSSKITQQQLI-GHKNFVVSLDTCPENEYMLCSGSHDGTVKVWDVRSSSP 414

Query: 178 --TETEEEDSLHQVIN 191
             T T E+ S+ + IN
Sbjct: 415 MYTITREDKSVKKGIN 430

>ZYRO0D16742g Chr4 complement(1385330..1387156) [1827 bp, 608 aa]
           {ON} similar to uniprot|P39014 Saccharomyces cerevisiae
           YIL046W MET30 F-box protein containing five copies of
           the WD40 motif controls cell cycle function sulfur
           metabolism and methionine biosynthesis as part of the
           ubiquitin ligase complex interacts with and regulates
           Met4p localizes within the nucleus
          Length = 608

 Score = 33.9 bits (76), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 55/223 (24%), Positives = 92/223 (41%), Gaps = 39/223 (17%)

Query: 124 DAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETE-- 181
           D+ + I+D+ +     R  + SH D +  + F   D + L++GS D    +++    E  
Sbjct: 304 DSTIAIWDLCTGRLVRR--LSSHTDGVKALYF---DDQKLITGSLDKTIRVWNYLTGECI 358

Query: 182 -----EEDSLHQVINYSSIHSCGWLSSRRIFTLSHMETFAIHQLNDKSE----VLKEPKP 232
                  DS+  V +Y  I   G  S+ +   + H+E+   + L   +E    V   PK 
Sbjct: 359 STYRGHTDSVLSVDSYKKIIVSG--SADKTVKVWHVESRTCYSLRGHTEWVNCVKLHPKS 416

Query: 233 -----------IEFGDIRNDWGCNYVIDVYPGYIATGKTEESKGQLKISPFNNEKIDLAE 281
                      I   DIR     N  + V+ G++  G+ ++      I   N    D AE
Sbjct: 417 FLCFSCSDDTTIRMWDIRT----NVCLKVFRGHL--GQVQKVVPLTIIDSENLVVDDKAE 470

Query: 282 DNNIIIPQAHGDEVIRDVFI-NPNDPSNMYSCGEDGNVKLWKI 323
           D+     +   DE  +DV   N   P+++ SC  D  +KLW I
Sbjct: 471 DDG---EEQGDDENAQDVLTENLPYPTHLLSCSLDNTIKLWDI 510

>TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {ON}
           Anc_6.239 YGL137W
          Length = 866

 Score = 33.9 bits (76), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 38/174 (21%), Positives = 72/174 (41%), Gaps = 47/174 (27%)

Query: 28  LLTSLSNGEISILDWKTNQIKDKIKIGETSI----------------NDFEIVNNNYNGG 71
           +LT+L +G + I +++T Q    I++ ET +                +DF+I   NYN G
Sbjct: 28  VLTTLYSGRVEIWNYETKQEVRSIQVTETPVRTGRFIARKNWIIVGSDDFKIRVFNYNTG 87

Query: 72  SLMVTATNESVKIYDLKSN-DCIKTITNEKNSPFLSLDSLHNMMACGTELSGVD---AEL 127
                      K+ D +++ D I++I      P++              LSG D    +L
Sbjct: 88  E----------KVVDFEAHPDYIRSIAVHPTKPYV--------------LSGSDDLTVKL 123

Query: 128 YIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETE 181
           + ++ +SW+  +    D H   +  + F+P D     S   D    ++ L + +
Sbjct: 124 WNWE-KSWE--LEQQFDGHTHFVMCVTFNPKDPSTFASACLDRTVKVWSLGQQD 174

>Smik_6.70 Chr6 (129582..131933) [2352 bp, 783 aa] {ON} YFL009W
           (REAL)
          Length = 783

 Score = 33.9 bits (76), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 50/223 (22%), Positives = 97/223 (43%), Gaps = 36/223 (16%)

Query: 120 LSGVDAELYIYDIRSWDTPIRSFV---DSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYD 176
           ++G D ++    IR +D   + F+     H   +  +K+  +   +L+SGSTD    ++D
Sbjct: 400 ITGADDKM----IRVYDAINKKFLLQLSGHDGGVWALKY--SHDGILVSGSTDRTVRVWD 453

Query: 177 LTETEEEDSLHQVINYSSIHSC----GWLSSRRIFTLSHMETFAIHQLNDKSEVLKEPKP 232
           +   ++    H    ++S   C     + ++R I T S   T  + +L       KE   
Sbjct: 454 I---KKGCCTHVFKGHNSTVRCLDIVEYKNNRYIVTGSRDNTLHVWKLP------KEASA 504

Query: 233 IEFGDIRNDWGC--------NYVIDVYPGYIATGKTEESKGQLKIS-PFNNEKI--DLAE 281
           IE GD  +D+           Y I V  G++A+ +T    G + +S  ++N  I  D+A+
Sbjct: 505 IEHGD-EHDYPLVYHTPEENPYFIGVLRGHMASVRTVSGHGNIVVSGSYDNTLIVWDVAQ 563

Query: 282 DNNIIIPQAHGDEVIRDVFINPNDPSNMYSCGEDGNVKLWKID 324
              + I   H D +   ++   ++     S   D  +K+W ++
Sbjct: 564 MKCLYILSGHTDRIYSTIY--DHERKRCISASMDTTIKIWDLE 604

>KAFR0D03060 Chr4 (604145..606625) [2481 bp, 826 aa] {ON} Anc_2.450
           YMR102C
          Length = 826

 Score = 33.9 bits (76), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 29/54 (53%), Gaps = 6/54 (11%)

Query: 132 IRSWDT----PIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETE 181
           +R W       +++FV  H D +T  KFHPND +  ++G  D    ++ + ++E
Sbjct: 308 VRLWHVDRKESLKTFV--HADFVTGAKFHPNDDRFFITGCLDHKCRLWSIVDSE 359

>Skud_15.437 Chr15 (771566..772951) [1386 bp, 461 aa] {ON} YOR272W
           (REAL)
          Length = 461

 Score = 33.9 bits (76), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 59/123 (47%), Gaps = 11/123 (8%)

Query: 77  ATNESVKIYDLKSNDCIKT-ITNEKNSPFLSLDSLHNMMACGTELSGVDAELYIYDIRSW 135
           + + ++K +DL +  CI T +T+        L SL N++ACG+  S     L+   + + 
Sbjct: 308 SQDHTIKTWDLVTARCIDTRVTSYSLLSIAQLPSL-NLLACGS--SARHITLHDPRLGAS 364

Query: 136 DTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDL-------TETEEEDSLHQ 188
               +  +  H + ++ +   P +  +L SGS DG   ++D+       T T E+ S+ +
Sbjct: 365 SKVTQQQLIGHKNLVSSLDTCPENEYILCSGSHDGTVKVWDVRSTSPMYTITREDKSVQK 424

Query: 189 VIN 191
            +N
Sbjct: 425 GVN 427

>KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {ON}
           Anc_6.276 YPL247C
          Length = 553

 Score = 33.9 bits (76), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 49/112 (43%), Gaps = 13/112 (11%)

Query: 81  SVKIYDLKSNDCIKTITNEKNSPFLSLD-SLHNMMACGTELSGVDA-----------ELY 128
           SV+++DL+S      I     +P  + D S         E S  DA           ++ 
Sbjct: 348 SVRVFDLRSLAHSTIIYEPPTNPVSNADLSQQQNALLRLEPSPTDANVIATFVSESNKIL 407

Query: 129 IYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTET 180
           I D+R+ ++P+   ++ H   I  IK+HP    +L+S S D     +DL  T
Sbjct: 408 ILDMRNSESPVL-VLEGHKSAINQIKWHPTKRYILLSCSDDCQVLYWDLNST 458

>Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222C
           (UTP13) - Protein required for cell viability [contig
           27] FULL
          Length = 823

 Score = 33.9 bits (76), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 24/114 (21%), Positives = 45/114 (39%), Gaps = 11/114 (9%)

Query: 132 IRSWDTPIRSFVDSHHDDIT-----DIKFHPNDSKVL--MSGSTDGYTNIYDLTETEEED 184
           ++ WD   R+ + +  +        D +  P D  VL  ++G  D   N++ L  T++  
Sbjct: 171 VKVWDLVRRNCIHTIQEHAAAVRGLDFRLSPADDGVLELLTGGRDDIVNLFQLNSTKKAK 230

Query: 185 SLHQVINYSSIHSCGWLS----SRRIFTLSHMETFAIHQLNDKSEVLKEPKPIE 234
            +  +  +  I +CG++         +T      F I      S   +  KPIE
Sbjct: 231 LMRTIPVHQQIEACGFIRDSPDGSLFYTAGGDAVFQILSFTSASVAKRTKKPIE 284

>Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {ON}
           complement(90370..91632) [1263 nt, 421 aa]
          Length = 420

 Score = 33.5 bits (75), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 33/57 (57%), Gaps = 3/57 (5%)

Query: 121 SGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDL 177
           SG D   YI+D+RS    ++SF  S + D+  +KF   D   +++GS DG   ++DL
Sbjct: 244 SGSDGYTYIWDVRS-AASVQSFFVS-NSDVNTVKFF-KDGNSIVTGSDDGTLRMFDL 297

>NDAI0C02600 Chr3 complement(605643..606554) [912 bp, 303 aa] {ON} 
          Length = 303

 Score = 33.5 bits (75), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 39/160 (24%), Positives = 78/160 (48%), Gaps = 17/160 (10%)

Query: 25  NYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNNNYNGGSLMVTATNESVKI 84
           N  ++TS  +G I + D ++  +    K     +N+  I   + N G L+    + +++I
Sbjct: 87  NRWMVTSSEDGTIKVWDVRSPSVPRNYK-HNAPVNEVVI---HPNQGELISCDRDGNIRI 142

Query: 85  YDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVD--AELYIYDI-----RSWDT 137
           +DL  N C   IT E++   +SL+SL ++ + G+ L+  +     YI+++      S   
Sbjct: 143 WDLGENQCTHQITPEED---VSLESL-SIASDGSMLAAANDRGNCYIWEMPNHTDASNLK 198

Query: 138 PIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDL 177
           P+++F  +H   +T +    +D K L + S D    I+ +
Sbjct: 199 PVKTF-SAHETYVTRVLL-SSDVKHLATCSADQSARIWSV 236

>TPHA0L02130 Chr12 complement(441224..445750) [4527 bp, 1508 aa] {ON}
            Anc_5.49 YHR186C
          Length = 1508

 Score = 33.9 bits (76), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 66/149 (44%), Gaps = 15/149 (10%)

Query: 71   GSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGV-DAELYI 129
            GSL+VT   + ++++D  S      I  + +S   S+ S  + +A  T + G  D  + +
Sbjct: 1276 GSLLVTGDVKVIRVWDAHSESIEVDIPVKTSSLVTSITS--DQLAGDTVVCGFSDGSIRV 1333

Query: 130  YDIR--SWDTPIRSFVDSH---HDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEED 184
            YD R  S D  +R +  +    H  I  +       + L SG+TDG   ++D+   +   
Sbjct: 1334 YDRRLNSRDAMVRLWRSNEGKKHYPINYVHLQRGGFRELASGTTDGTVELWDIRNQDPIT 1393

Query: 185  SLHQVINYSSIHSCGWLSSRRIFTLSHME 213
            S +       I S    S  RI T++ M+
Sbjct: 1394 SFN-------IGSSNQSSESRISTMTKMQ 1415

>ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} similar
           to uniprot|Q12417 Saccharomyces cerevisiae YPL151C PRP46
           Splicing factor that is found in the Cef1p subcomplex of
           the spliceosome
          Length = 427

 Score = 33.5 bits (75), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 51/106 (48%), Gaps = 11/106 (10%)

Query: 73  LMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYIYDI 132
           ++ ++T+ +V+++D+ +    K +T+ K S  +   SLH      +E S V A     DI
Sbjct: 257 VVSSSTDATVRLWDVTAGKSYKILTHHKRS--VRDFSLHP-----SEFSMVSA--CTDDI 307

Query: 133 RSWDTPIRSFVDSHHDDITDI--KFHPNDSKVLMSGSTDGYTNIYD 176
           RSW  P  + + +   + T I      N   VL +G  DG  + YD
Sbjct: 308 RSWKLPEGALLTNFASESTGIINTLSVNQDDVLFAGGDDGMLSFYD 353

>Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W
           (REAL)
          Length = 1271

 Score = 33.9 bits (76), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 68/162 (41%), Gaps = 12/162 (7%)

Query: 77  ATNESVKIYDLKSNDCIKTITN-EKNSPFLSLDSLHNMMACGTELSGVDAELY-IYDIRS 134
           +T+ S++++ L + D  K + + + +S F  LD  HN       L     ELY I D   
Sbjct: 37  STDSSLELWSLLTTDSEKPMASLQVDSKFNDLDWSHNNKTIAGALDNGTLELYSIGDAHD 96

Query: 135 WDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSLHQVI---- 190
                  F + H   +  +KF+     VL SG  +G   I+D+ +  E  S +  +    
Sbjct: 97  TIVSTAKFSN-HSSSVKTVKFNSKQDNVLASGGNNGEIFIWDMNKCTESPSSYTPLTPGQ 155

Query: 191 ---NYSSIHSCGWLSS-RRIFTLSHMETFA-IHQLNDKSEVL 227
              +   ++S  W  S   +F  +    FA I  L  K EV+
Sbjct: 156 SMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLKAKKEVI 197

 Score = 30.8 bits (68), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 13/59 (22%), Positives = 29/59 (49%)

Query: 124 DAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEE 182
           D  + ++D+R+ +TP+++    H   I  + +   D  +L+S   D    +++    EE
Sbjct: 234 DPSILVWDLRNANTPLQTLSQGHQKGILSLDWCHQDENLLLSSGRDNTVLLWNPESAEE 292

>TBLA0B04390 Chr2 (1014987..1015997) [1011 bp, 336 aa] {ON}
           Anc_8.585 YBR175W
          Length = 336

 Score = 33.5 bits (75), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 33/54 (61%), Gaps = 3/54 (5%)

Query: 123 VDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYD 176
           VD  + I+DI    T +R+ +++H+D +  I F+ NDS +  SGS DG   +YD
Sbjct: 131 VDESIKIWDILH-GTNLRT-INTHNDPVVTIDFN-NDSSIFSSGSHDGLVRLYD 181

>TBLA0F02400 Chr6 complement(590293..591189) [897 bp, 298 aa] {ON}
           Anc_7.338 YLR208W
          Length = 298

 Score = 33.1 bits (74), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 25/137 (18%), Positives = 61/137 (44%), Gaps = 4/137 (2%)

Query: 67  NYNGGSLMVTATNESVKIYDLK--SNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVD 124
           +Y G  L   ++++++KIY++   S+  + T+T  +  P   +D  H            D
Sbjct: 18  DYYGRKLATCSSDKTIKIYEIDGDSHKLLTTLTGHEG-PVWRIDWAHPKFGTILASCSYD 76

Query: 125 AELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPND-SKVLMSGSTDGYTNIYDLTETEEE 183
            ++ I+   +      +    H   +  +K+ P++   VL++ S+DG  ++ +  E   +
Sbjct: 77  GKVIIWKEENGTWSQIAVHSVHSASVNSVKWAPHEYGAVLLAASSDGKISVVEFKENGTQ 136

Query: 184 DSLHQVINYSSIHSCGW 200
           + +    +   ++S  W
Sbjct: 137 NPMVLDAHAVGVNSAAW 153

>KLTH0E10120g Chr5 (916575..919055) [2481 bp, 826 aa] {ON} highly
           similar to uniprot|Q05946 Saccharomyces cerevisiae
           YLR222C UTP13 Nucleolar protein component of the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 826

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 47/114 (41%), Gaps = 11/114 (9%)

Query: 132 IRSWDTPIRSF---VDSHHDDITDIKFHPNDSK----VLMSGSTDGYTNIYDLTETEEED 184
           ++ WD   RS    +  H   +  + F  +D+      L+SG  D   N+Y L  T++  
Sbjct: 171 VKVWDLVRRSCLHTIQEHAAAVRGLDFRVSDADDDVLELLSGGRDDIVNLYQLGSTKKVK 230

Query: 185 SLHQVINYSSIHSCGWLSSRR----IFTLSHMETFAIHQLNDKSEVLKEPKPIE 234
            +  +  +  I +CG++         +T      + I  L   S + K  KPIE
Sbjct: 231 LVKTIPVHQQIEACGFIHDGEHQDLFYTAGGDAVYQILSLATASVIKKTNKPIE 284

>Ecym_1293 Chr1 (595329..596240) [912 bp, 303 aa] {ON} similar to
           Ashbya gossypii AAL009C
          Length = 303

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 48/96 (50%), Gaps = 6/96 (6%)

Query: 25  NYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNNNYNGGSLMVTATNESVKI 84
           N  +++S  +G I + D +T  ++   K     +N+  I   + N G L+    + ++KI
Sbjct: 87  NKWMVSSSEDGTIKVWDVRTPSVQRNYK-HNAPVNEVVI---HPNQGELISCDQDGNIKI 142

Query: 85  YDLKSNDCIKTITNEKNSPF--LSLDSLHNMMACGT 118
           +DL  N C   +  E ++P   LS+ S  +M+  G+
Sbjct: 143 WDLGENQCTHQLALEDDTPLQSLSIASDGSMLVAGS 178

>Smik_14.322 Chr14 (578426..579337) [912 bp, 303 aa] {ON} YNL006W
           (REAL)
          Length = 303

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 70/162 (43%), Gaps = 21/162 (12%)

Query: 25  NYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNNNYNGGSLMVTATNESVKI 84
           N  ++TS  +G I + D ++  I    K     +N+  I   + N G L+    + +++I
Sbjct: 87  NRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVI---HPNQGELISCDRDGNIRI 142

Query: 85  YDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYIYDIRSWDTPIRSFVD 144
           +DL  N C   +T E ++   SL    +M + G+ L+  + +   Y    W+ P  +   
Sbjct: 143 WDLGENQCTHQLTPEDDTSLQSL----SMASDGSMLAAANTKGNCY---VWEMPNHTDA- 194

Query: 145 SHHDDITDIKFH---------PNDSKVLMSGSTDGYTNIYDL 177
           SH   +T  + H          +D K L + S D    ++ +
Sbjct: 195 SHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSI 236

>YNL006W Chr14 (620067..620978) [912 bp, 303 aa] {ON}  LST8Protein
           required for the transport of amino acid permease Gap1p
           from the Golgi to the cell surface; component of the TOR
           signaling pathway; associates with both Tor1p and Tor2p;
           contains a WD-repeat
          Length = 303

 Score = 33.1 bits (74), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 37/162 (22%), Positives = 70/162 (43%), Gaps = 21/162 (12%)

Query: 25  NYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNNNYNGGSLMVTATNESVKI 84
           N  ++TS  +G I + D ++  I    K     +N+  I   + N G L+    + +++I
Sbjct: 87  NRWMVTSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVI---HPNQGELISCDRDGNIRI 142

Query: 85  YDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYIYDIRSWDTPIRSFVD 144
           +DL  N C   +T E ++   SL    +M + G+ L+  + +   Y    W+ P  +   
Sbjct: 143 WDLGENQCTHQLTPEDDTSLQSL----SMASDGSMLAAANTKGNCY---VWEMPNHTDA- 194

Query: 145 SHHDDITDIKFH---------PNDSKVLMSGSTDGYTNIYDL 177
           SH   +T  + H          +D K L + S D    ++ +
Sbjct: 195 SHLKPVTKFRAHSTYITRILLSSDVKHLATCSADHTARVWSI 236

>ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR131C
           (RRB1)
          Length = 521

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 60/122 (49%), Gaps = 25/122 (20%)

Query: 82  VKIYDLKSNDCIKTITNEKNSPFLSL---DSLHNMMACGTELS-----GVDAELY-IYDI 132
           V+I+D++S         +K+ P LS+   D+  N+M+   ++S     G D   + ++D+
Sbjct: 357 VRIWDIRS---------KKHKPALSVKVSDTDVNVMSWNQKISYLLATGDDNGTWGVWDL 407

Query: 133 RSWD------TPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSL 186
           R +       +P+  + D H   IT I F+P D  ++   S D    ++DL+   +++ +
Sbjct: 408 RQFSNQQGGVSPVAQY-DFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEI 466

Query: 187 HQ 188
            Q
Sbjct: 467 KQ 468

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 50/109 (45%), Gaps = 4/109 (3%)

Query: 95  TITNEKNSPFLSLDSLHNMMACGTELSG-VDAELYIYDIRS--WDTPIRSFVDSHHDDIT 151
           TI N  N     LD    ++  G  L+G     +++    S  W T  + F   ++  I 
Sbjct: 278 TIKNHGNVEGYGLD-WSPLIKTGALLTGDCSGRVFLTQRTSSKWITDKQPFTVDNNKSIE 336

Query: 152 DIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSLHQVINYSSIHSCGW 200
           DIK+ P+++ V  +   DG+  I+D+   + + +L   ++ + ++   W
Sbjct: 337 DIKWSPSENTVFATCGVDGHVRIWDIRSKKHKPALSVKVSDTDVNVMSW 385

>ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL138C
          Length = 1361

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 33/65 (50%), Gaps = 8/65 (12%)

Query: 116 CGTELSGVDAELYIYDI---RSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYT 172
           CGT  S     + IYDI    + D+P+ + +  H   I  + F+   + +L+SG  DG  
Sbjct: 202 CGTSTS-----VSIYDINRASAKDSPLITTLSEHSRSINSVDFNMGQTHLLISGGQDGCI 256

Query: 173 NIYDL 177
            ++DL
Sbjct: 257 KVWDL 261

>SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1353

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 35/70 (50%), Gaps = 8/70 (11%)

Query: 116 CGTELSGVDAELYIYDI---RSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYT 172
           CGT  S     + +YDI    + D P+ + +  H   I  + F+ + + +L+SG  DG  
Sbjct: 200 CGTSTS-----VSVYDINKTSTIDNPLVTTLSEHTRSINSVDFNMSQTNLLISGGQDGCI 254

Query: 173 NIYDLTETEE 182
            ++DL  ++ 
Sbjct: 255 KVWDLRSSQR 264

>KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.399
           YNL006W
          Length = 303

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 38/156 (24%), Positives = 72/156 (46%), Gaps = 9/156 (5%)

Query: 25  NYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNNNYNGGSLMVTATNESVKI 84
           N  +++S  +G I + D ++  I    K     +N+  I   + N G L+    + +++I
Sbjct: 87  NKWMVSSSEDGTIKVWDVRSPSIPRNYK-HNAPVNEVVI---HPNQGELISCDRDGNIRI 142

Query: 85  YDLKSNDCIKTITNEKNSPFLSLDSLHN---MMACGTELSGVDAELYIYDIRSWDTPIRS 141
           +DL  N C   +T E + P  S+    +   ++A  T+ +    E+  +   S   P+  
Sbjct: 143 WDLGENQCTHQLTPEDDIPLQSISVASDGSMLVAANTKGNCFVWEMPNHTDASNLKPVTK 202

Query: 142 FVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDL 177
           F  +H+D IT I    +D K L + S D  T ++ +
Sbjct: 203 F-KAHNDYITRILL-SSDVKHLATCSADHTTRVWSI 236

>YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}
           TAF5Subunit (90 kDa) of TFIID and SAGA complexes,
           involved in RNA polymerase II transcription initiation
           and in chromatin modification
          Length = 798

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 37/183 (20%), Positives = 86/183 (46%), Gaps = 16/183 (8%)

Query: 8   LTSFGSNN---WCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIV 64
           L S+  +N   W + F PL +Y    + S+ + + L W  + I   ++I    +ND + V
Sbjct: 560 LVSYKGHNHPVWDVSFSPLGHY--FATASHDQTARL-WSCDHIY-PLRIFAGHLNDVDCV 615

Query: 65  NNNYNGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHN--MMACGTELSG 122
           + + NG  +   +++++ +++D+ + D ++       +P +S+    +   ++ G+E   
Sbjct: 616 SFHPNGCYVFTGSSDKTCRMWDVSTGDSVRLFLGH-TAPVISIAVCPDGRWLSTGSE--- 671

Query: 123 VDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEE 182
            D  + ++DI +    ++       + I  + +   +  VL+SG  D    ++DL +   
Sbjct: 672 -DGIINVWDIGTGKR-LKQMRGHGKNAIYSLSYS-KEGNVLISGGADHTVRVWDLKKATT 728

Query: 183 EDS 185
           E S
Sbjct: 729 EPS 731

>KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]
           {ON} similar to uniprot|P42841 Saccharomyces cerevisiae
           YNL317W PFS2 Integral subunit of the pre-mRNA cleavage
           and polyadenylation factor (CPF) complex plays an
           essential role in mRNA 3'-end formation by bridging
           different processing factors and thereby promoting the
           assembly of the processing complex
          Length = 451

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 48/106 (45%), Gaps = 8/106 (7%)

Query: 82  VKIYDLKSNDCIKTITNEKNSPFLS--LDSLHNMMACGTELSGVDAELYIYDIRSWDTPI 139
           +K++D +S  CI TI   K++   +    +  NM+A  ++    D    ++DIR     +
Sbjct: 233 IKLWDPRSGQCISTILGCKHTIISTKFQPTKGNMLAVISK----DKSCRVFDIRQNMKEL 288

Query: 140 RSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDS 185
             + D    D   + +HP +  +   G  DG    +DL +  ++ S
Sbjct: 289 AVYRD--ESDYMSLTWHPINESIFTVGCYDGSMKHFDLMQEPQDSS 332

>TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON}
           Anc_8.631 YOR212W
          Length = 433

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 36/76 (47%), Gaps = 8/76 (10%)

Query: 102 SPFLSLDSLHNMMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSK 161
           SP  + +  +   +CG+     D  +Y++D+R+       FV     DI  ++F   D  
Sbjct: 241 SPSSAENGTNTFASCGS-----DGYIYLWDVRTGSVAQTFFV--SDSDINAVQFF-KDGN 292

Query: 162 VLMSGSTDGYTNIYDL 177
            L SGS DG   ++DL
Sbjct: 293 ALASGSDDGIIRLFDL 308

>TPHA0D04480 Chr4 complement(970967..974989) [4023 bp, 1340 aa] {ON}
           Anc_7.310 YDL195W
          Length = 1340

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 45/91 (49%), Gaps = 12/91 (13%)

Query: 96  ITNEKNSPFLSLD----------SLHNMMACGTELSGVDAELYIYDIRSWDTPIRSFVDS 145
           I+++ + P LS+D          S+ N M  G   +G   +L+  D +     I SF D 
Sbjct: 54  ISSKSDIPVLSIDVDSTFNDLSWSIDNEMIAGAMQNGT-IQLFKTDKKESLEKIGSFEDE 112

Query: 146 HHDDITDIKFHPNDSKVLMSGSTDGYTNIYD 176
             D IT IKF+   + VL+SGS+ G   ++D
Sbjct: 113 AQD-ITIIKFNNKQNNVLLSGSSTGKILVWD 142

>CAGL0M02563g Chr13 complement(295156..296529) [1374 bp, 457 aa]
           {ON} weakly similar to uniprot|Q03010 Saccharomyces
           cerevisiae YPL139c UME1 or uniprot|Q12206 Saccharomyces
           cerevisiae YOR229w WTM2 or uniprot|Q12363 Saccharomyces
           cerevisiae YOR230w WTM1
          Length = 457

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 40/159 (25%), Positives = 68/159 (42%), Gaps = 29/159 (18%)

Query: 37  ISILDWKTNQIKDKIKIGETSIND--------FEIVNNNYNGGSLMVTAT--NESVKIYD 86
           +S++D     I +K ++ E  +ND        F++   + NG  ++V+    NE   +  
Sbjct: 164 VSMVDGGAKIIPNKYELEEDFVNDSLNKIDFDFDL---SLNGEKIIVSQAVLNEDRTVIK 220

Query: 87  LKSNDCIKTITNEKNSPFLSLD-----SLHNMMACGTELSGV---DAELYIYDIRSWDTP 138
           + SN     I  +     +SLD     S+HN+      + G       LY YD R+  TP
Sbjct: 221 VFSN-----IDKDLGKLLISLDLPGTKSVHNIKFYNDNIFGFCDNSGNLYFYDSRNLATP 275

Query: 139 IRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDL 177
           I    + H   I    F P    +L++G  +G  N +D+
Sbjct: 276 IWKIENEH---ILSFAFSPLVETLLITGGANGIINFWDV 311

>KAFR0A06490 Chr1 complement(1314794..1316098) [1305 bp, 434 aa]
           {ON} Anc_4.123 YAR003W
          Length = 434

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 42/189 (22%), Positives = 74/189 (39%), Gaps = 47/189 (24%)

Query: 17  CLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNNNYNGGSLMVT 76
           CL+F P  +Y L     NG I + D  T +   K+     +I   +    +YNG  L+  
Sbjct: 31  CLRFSPFGDY-LAVGCYNGTIIVYDMDTMR-PIKLFFSNQAIYGLDW---SYNGKYLLSC 85

Query: 77  ATNESVKIYDLKSND------------------------CIKTITNEKNSPFL--SLDSL 110
           + +  VK++DL  +D                        C+ T+  EKN+  +   LDS 
Sbjct: 86  SRDWHVKVWDLDLDDEPCGSVCFDGPVWGCNWIDSDRLSCVATVYEEKNAYLVDFELDSE 145

Query: 111 HNMMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSK--VLMSGST 168
            N +         D E+ I + + +              +     HPN +   ++++G++
Sbjct: 146 SNKLEGKIRPLRGDTEVEIANEQGY--------------VLTSTLHPNSNSGTIIITGTS 191

Query: 169 DGYTNIYDL 177
            G+ N Y L
Sbjct: 192 KGFINFYRL 200

>ABL024W Chr2 (353682..355886) [2205 bp, 734 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR102C and YKL121W
          Length = 734

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 137 TPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSL 186
           T +++FV  H D +T ++FHP+D +   SG  D     + + E E  ++ 
Sbjct: 246 TSLKTFV--HPDFVTCVRFHPHDDRFFFSGCLDHTVRTWSILEGEVAEAF 293

>ZYRO0F06314g Chr6 (526555..527850) [1296 bp, 431 aa] {ON} similar
           to uniprot|P18851 YOR212W Saccharomyces cerevisiae STE4
           G protein beta subunit
          Length = 431

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 41/195 (21%), Positives = 84/195 (43%), Gaps = 24/195 (12%)

Query: 146 HHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSLHQVINYSSIHSCGWLSSRR 205
           H++ ++D ++  +DSK ++S S DG+  I+D     +++++   ++   + +CG      
Sbjct: 96  HNNKVSDFRWS-SDSKSILSASQDGFMLIWDTDTGLKKNAIP--LDSQWVLTCG------ 146

Query: 206 IFTLSHMETFAIH-QLNDKSEVLKEPKPIEFGDIRNDWGCNYVIDVYPGYIA-TGKTEES 263
              +S     A+   LN+   + + P+     D +       +   + GYI+ T  T+ +
Sbjct: 147 ---ISPSGNLAVSGGLNNNCTIYRVPR-----DSKVQQSVVSIFKGHTGYISDTAFTDNA 198

Query: 264 KGQLKISPFNNEKIDLAEDNNIIIPQAHGDEVIRDVFINPNDPSNMY-SCGEDGNVKLWK 322
                         D+ +   +     H  +V+      PN  SN++ SCG DG   +W 
Sbjct: 199 HVVTASGDMTCAYWDIPKTKRVREYADHLGDVLSLSLPPPNTNSNLFASCGSDGYAFVWD 258

Query: 323 IDTTTKSLKIPEHFF 337
               T+S  + + FF
Sbjct: 259 ----TRSTNVAQTFF 269

>Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa]
           {ON} YDL195W (SEC31) - Component (p150) of COPII coat of
           secretory pathway vesicles [contig 161] FULL
          Length = 1296

 Score = 33.5 bits (75), Expect = 1.2,   Method: Composition-based stats.
 Identities = 20/77 (25%), Positives = 36/77 (46%), Gaps = 9/77 (11%)

Query: 111 HNMMACGTELSGVDAELYIYDIRSWDTP-----IRSFVDSHHDDITDIKFHPNDSKVLMS 165
           HN++  G    G   E+YI+D    +TP     +     +  D+I  + ++ N   V  S
Sbjct: 117 HNVLCSG----GSKGEIYIWDANKIETPGYAPFVPGTAMTPMDEIYSLAWNQNQGHVFAS 172

Query: 166 GSTDGYTNIYDLTETEE 182
             + G+ +I+DL   +E
Sbjct: 173 AGSSGFASIWDLKAKKE 189

>KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1321

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 8/65 (12%)

Query: 116 CGTELSGVDAELYIYDI---RSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYT 172
           CGT  S     + IYDI    + D P+ + +  H   I  + F+   + +L+SG  DG  
Sbjct: 196 CGTSTS-----VAIYDINKTSAIDNPVVTSLSEHTRSINSVDFNMVQTSLLISGGQDGCI 250

Query: 173 NIYDL 177
            I+DL
Sbjct: 251 KIWDL 255

>YNL253W Chr14 (170018..171286) [1269 bp, 422 aa] {ON}  TEX1Protein
           involved in mRNA export, component of the transcription
           export (TREX) complex
          Length = 422

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 54/107 (50%), Gaps = 10/107 (9%)

Query: 70  GGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLH--NMMACGTELSGVDAEL 127
           G + +  + + +  ++++KS  C + I N+ NS   +LD  H   ++   TE    D  +
Sbjct: 265 GRNFITGSIDGNCYVWNMKSL-CCELIINDLNSAVTTLDVCHLGKILGICTE----DEMV 319

Query: 128 YIYDIRSWDT-PIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTN 173
           Y YD+ S +    +S  +   D +  +KF+P+ S  +MSG  D  +N
Sbjct: 320 YFYDLNSGNLLHSKSLANYKTDPV--LKFYPDKSWYIMSGKNDTLSN 364

>Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa]
           {ON} complement(112044..114575) [2532 nt, 844 aa]
          Length = 843

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 37/185 (20%), Positives = 89/185 (48%), Gaps = 16/185 (8%)

Query: 8   LTSFGSNN---WCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIV 64
           L S+  +N   W + F P+ +Y    + S+ + + L W  + I   ++I    ++D + V
Sbjct: 598 LVSYKGHNHPVWDVAFSPMGHY--FATASHDQTARL-WSCDHIYS-LRIFAGHLSDVDCV 653

Query: 65  NNNYNGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHN--MMACGTELSG 122
             + NG  +   +++++ +++D+ + + ++       +P +SL    +   +A G+E   
Sbjct: 654 TFHPNGCYVFTGSSDKTCRMWDVSTGETVRLFLGH-TAPVVSLGVSPDGRWLASGSE--- 709

Query: 123 VDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEE 182
            D  + ++DI S    ++       + +  I F   +  V++SG TD    ++D+ ++  
Sbjct: 710 -DGLINVWDIGSGKR-LKQMRGHGRNAVNSIVF-SQEGTVIISGGTDNSVRVWDMYKSNN 766

Query: 183 EDSLH 187
           E S++
Sbjct: 767 ESSIN 771

>NCAS0J01100 Chr10 (187994..189307) [1314 bp, 437 aa] {ON} Anc_4.123
           YAR003W
          Length = 437

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 49/116 (42%), Gaps = 5/116 (4%)

Query: 94  KTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYIYDIRSWDTPIRSFVDSHHDDITDI 153
           +T+ N   +  L      N +A G   S  D  +Y  D       + S   +H   I  I
Sbjct: 21  RTLENPLRTECLQFSPCGNYLALGC--STGDVVIYDMDTFRPSCILGSKFGAHTRIIQSI 78

Query: 154 KFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSLHQVINYSSIHSCGWLSSRRIFTL 209
            + P D + L++GS D    ++DL   E+   L+++   S I +C W +   +  +
Sbjct: 79  SWSP-DGRYLLTGSGDWIVKVWDLQSPEQ--PLNELAFDSPIWNCQWFNVESLLCI 131

>KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1159

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 126 ELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEE 182
           +++I+D+R   TP+      H+  +  I F   +   +MS S DG    +DL++ E+
Sbjct: 182 DVFIWDLRHGSTPLHKLT-GHNSGVNSIDFSRFEENKIMSSSNDGTVKFWDLSKEEK 237

>ZYRO0F09922g Chr6 complement(805666..807033) [1368 bp, 455 aa] {ON}
           similar to uniprot|P40968 Saccharomyces cerevisiae
           YDR364C CDC40 Pre-mRNA splicing factor important for
           catalytic step II of pre-mRNA splicing and plays a role
           in cell cycle progression required for DNA synthesis
           during mitosis and meiosis has WD repeats
          Length = 455

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 67/312 (21%), Positives = 126/312 (40%), Gaps = 31/312 (9%)

Query: 17  CLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNNNYNGGSLMVT 76
            L+F P   +  L+  ++  + I D+   +I  +  IG +     + VN N +G S +  
Sbjct: 167 ALQFLPKTGHLFLSGGNDNILKIWDFYHERICLRDYIGHS--KPIKTVNFNEDGNSFLSA 224

Query: 77  ATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLH-NMMACGTELSGVDAELYIYDIR-S 134
           + +++VK++D ++               L     H N    G   S ++     YD R +
Sbjct: 225 SFDQNVKLWDTETGQVKSRYRYNATPNDLKYRPGHLNEFVVGLSNSKINH----YDDRVA 280

Query: 135 WDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSLHQVINYSS 194
            +  +    D H   I  ++F P+ SK L+S S D    I+   E +    + Q+ + ++
Sbjct: 281 ANQGLVQVYDHHLSSILSLEFFPDGSK-LISSSEDKTVRIW---ENQVNIPIKQISD-TA 335

Query: 195 IHSCGWLS---SRRIFTLSHMETFAIHQLNDKSEVLKEPKPIEFGDIRNDWGCNYVIDVY 251
            HS  +L        F    M+   I+    K +  + P     G     +G +  ID  
Sbjct: 336 QHSMPFLRVHPEHHYFCAQSMDN-VIYSFGMKPKYRRHPNKFFSGHQSAGYGIH--IDFS 392

Query: 252 PG--YIATGKTEESKGQLKISPFNNEKIDLAEDNNIIIPQAHGDEVIRDVFINPNDPSNM 309
           P   YI +G   +S+G+L +  +   KI       +   +  G + +  V  +P + S +
Sbjct: 393 PDGHYIISG---DSRGKLMVWDWTTTKI-------LKTLEVPGRQPVTQVAWHPQETSKV 442

Query: 310 YSCGEDGNVKLW 321
              G  G + L+
Sbjct: 443 LCSGNMGKIHLF 454

>AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR084C (TUP1)
          Length = 629

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 49/109 (44%), Gaps = 8/109 (7%)

Query: 69  NGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGV-DAEL 127
           +G  L   A ++ ++I+DL +   + T+   +   +    SL    A    +SG  D  +
Sbjct: 363 DGKYLATGAEDKLIRIWDLTTKKILMTLQGHEQDIY----SLDYFPAGDKLVSGSGDRTV 418

Query: 128 YIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYD 176
            I+D+R+      S   S  D +T +   P D K + +GS D    ++D
Sbjct: 419 RIWDLRTGQC---SLTLSIEDGVTTVAVSPGDGKYIAAGSLDRTVRVWD 464

>NCAS0F01450 Chr6 complement(287070..289796) [2727 bp, 908 aa] {ON}
           Anc_2.450 YKL121W
          Length = 908

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 2/45 (4%)

Query: 137 TPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETE 181
           T +++F   H D +T ++FHP D +  +SG  D    ++ + E E
Sbjct: 360 TSLKTF--QHQDFVTCVRFHPTDDRFFISGCLDHKVRLWSILENE 402

>Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}
           similar to Ashbya gossypii AAL157C
          Length = 484

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 81/192 (42%), Gaps = 38/192 (19%)

Query: 148 DDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSLHQVINYSSIHSCGWLSSRRIF 207
           D+IT +KF+ N++ +L+S  +D    +YDL        + Q +  +S+  C W       
Sbjct: 216 DNITAVKFNQNEADLLLSSGSDNSVVLYDLRTNSPTQKIVQTMKTNSM--C-W------- 265

Query: 208 TLSHMETFAIHQLNDKSEVLKEPKPIEFGDIRNDWGCNYVIDVYPGYIATGKTEESKGQL 267
             + ME F     N       E +   + D+RN    +  + V+  +++      +   +
Sbjct: 266 --NPMEPFNFVTAN-------EDQNAYYYDMRN---MSRALHVFKDHVS------AIMDV 307

Query: 268 KISPFNNEKIDLAEDNNII---IPQAHGDEV-----IRDVFINP--NDPSNMYSCGEDGN 317
            ISP   E +  + D  I    I   H  EV     ++ VF      D   + S  +DGN
Sbjct: 308 DISPTGEEIVTGSYDKTIRIFNIKHGHSREVYHTKRMQHVFQVKFTMDSKYIVSGSDDGN 367

Query: 318 VKLWKIDTTTKS 329
           V+LW+ +   +S
Sbjct: 368 VRLWRSNAYERS 379

>KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.401
           YMR131C
          Length = 517

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 43/194 (22%), Positives = 88/194 (45%), Gaps = 29/194 (14%)

Query: 16  WCLKFKPLYNYG-LLTSLSNGEISILDWKTNQ-IKDKIKIGETSINDFEIVNNNYNGGSL 73
           + L + P+   G LLT   +G+I      T++ I DK      +    E +  +    ++
Sbjct: 283 YALDWSPMIKNGALLTGDCSGQIYFTQRHTSKWITDKQPFTAENNKSVEDIQWSRTESTV 342

Query: 74  MVTATNES-VKIYDLKSNDCIKTITNEKNSPFLSLDSLH---NMMACGTEL-----SGVD 124
             +A  +  ++I+D +S         +K+ P LS+ + +   N+++   ++     SG D
Sbjct: 343 FASAGCDGYIRIWDTRS---------KKHKPALSVKASNTDVNVISWSEKIGYLLASGDD 393

Query: 125 AELY-IYDIRSWD-------TPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYD 176
             L+ ++D+R +         P+  + D H   IT I F+P D  ++   S D    ++D
Sbjct: 394 NGLWGVWDLRQFSPDNINDVQPVAQY-DFHKGAITSINFNPLDDSIIAVASEDNTVTLWD 452

Query: 177 LTETEEEDSLHQVI 190
           L+   +++ + Q I
Sbjct: 453 LSVEADDEEIKQQI 466

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 48/111 (43%), Gaps = 4/111 (3%)

Query: 93  IKTITNEKNSPFLSLDSLHNMMACGTELSG-VDAELYIYDIRS--WDTPIRSFVDSHHDD 149
           I T+ N  N    +LD    M+  G  L+G    ++Y     +  W T  + F   ++  
Sbjct: 271 IHTVRNHGNVEGYALD-WSPMIKNGALLTGDCSGQIYFTQRHTSKWITDKQPFTAENNKS 329

Query: 150 ITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSLHQVINYSSIHSCGW 200
           + DI++   +S V  S   DGY  I+D    + + +L    + + ++   W
Sbjct: 330 VEDIQWSRTESTVFASAGCDGYIRIWDTRSKKHKPALSVKASNTDVNVISW 380

>KNAG0G02820 Chr7 (623677..625050) [1374 bp, 457 aa] {ON} Anc_8.721
           YOR272W
          Length = 457

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 66/137 (48%), Gaps = 16/137 (11%)

Query: 64  VNNNYNGGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLH--NMMACGTELS 121
           +N+N  G S+   + + S+K +DL  + C+ T T   +   LS+  L   N++ACG+  S
Sbjct: 294 LNDNTVGYSV---SQDHSIKTWDLVMSRCVDTKTTSYS--LLSMVQLPTLNLLACGS--S 346

Query: 122 GVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDL---- 177
                L+   + S     +  +  H + +  +   P +  ++ SGS DG   ++D+    
Sbjct: 347 ARHITLHDPRVDSSSKITQQQLVGHKNFVVSLDTCPENEYIICSGSHDGTVKVWDIRSQD 406

Query: 178 ---TETEEEDSLHQVIN 191
              T T E++++ + IN
Sbjct: 407 AMYTITREDENVKKGIN 423

>NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {ON}
           Anc_7.310
          Length = 1276

 Score = 33.1 bits (74), Expect = 1.4,   Method: Composition-based stats.
 Identities = 41/178 (23%), Positives = 78/178 (43%), Gaps = 14/178 (7%)

Query: 18  LKFKPLYNYGLLTSLSNGEISILDWK-----TNQIKDKIKIGETSINDFEIVNNNYNGGS 72
           L+F P     L ++ +NGEI I D       T+       I  ++ ++ + V+ N +   
Sbjct: 119 LRFNPKQQNVLASAGNNGEILIWDINKTLSSTDYSPSAPGIAMSTQDEIKSVSWNKSLAH 178

Query: 73  LMVTA--TNESVKIYDLKSNDCIKTI--TNEKN--SPFLSLDSLH-NMMACGTELSGVDA 125
           +  +A  T     I+DLK+   +  +  T+ K    P L++   H  +       SG D+
Sbjct: 179 VFASAGDTTTYASIWDLKAKKEVIHLNYTSPKTGLKPNLAVVEWHPKVTTYVATASGSDS 238

Query: 126 E--LYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETE 181
           +  + I+D+R+ + P+ +    H   I  + +   D  +L+S   DG   ++D    E
Sbjct: 239 DPVILIWDLRNSNMPMTTLEGPHTKGIMSLDWCTKDESLLLSSGRDGIVALWDTKANE 296

>Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {ON}
           complement(61507..62967) [1461 nt, 487 aa]
          Length = 486

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 59/125 (47%), Gaps = 24/125 (19%)

Query: 81  SVKIYDLKS-------------NDCIKTITNEKNSP--FLSLD---SLHNMMACGTELSG 122
           SV+++DL+S              +   T+T+ + SP   L L    S  N+MA       
Sbjct: 290 SVRVFDLRSLAHSTIIYESNSDQNGSDTLTDNEKSPSALLRLQPSPSDPNVMATF----A 345

Query: 123 VDAE-LYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETE 181
           +D++ + I D+R+  +P+ + ++ H   +  IK+HP  S VL+S   D     +DL E  
Sbjct: 346 LDSKSILILDMRNPGSPVLT-LEGHSAAVNQIKWHPKKSNVLLSCGDDCQVLYWDLNEWL 404

Query: 182 EEDSL 186
              SL
Sbjct: 405 SPTSL 409

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 14/57 (24%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 121 SGVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDL 177
           S +D    ++D++S    +R+ + +H  ++ D+KF  + +++  S   DG   ++DL
Sbjct: 241 SSIDTTCIVWDLQS-SNYVRTQLIAHDSEVFDVKFLAHSTQLFASCGGDGSVRVFDL 296

>ZYRO0G10472g Chr7 complement(844939..846621) [1683 bp, 560 aa] {ON}
           similar to uniprot|P53197 Saccharomyces cerevisiae
           YGL003C CDH1 CDC20 homolog 1 protein required for Clb2
           and Ase1 degradation
          Length = 560

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 66/137 (48%), Gaps = 11/137 (8%)

Query: 70  GGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHN-MMACGTELSGVDAELY 128
           G  L V   N  V+IYD+    CI+T++   +   ++  S +N ++  G+     D  + 
Sbjct: 308 GSHLAVGQGNGLVEIYDVVKKKCIRTLSGHMDR--VACLSWNNYVLTSGSR----DRRIL 361

Query: 129 IYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSLHQ 188
             D+R  D+     +++H  ++  +K++ +D+K L SG  D    +YD T      + ++
Sbjct: 362 HRDVRIPDSYFER-IEAHTQEVCGLKWNVDDNK-LASGGNDNMLFVYDSTARNPVLTFNE 419

Query: 189 VINYSSIHSCGWLSSRR 205
             + +++ +  W   +R
Sbjct: 420 --HTAAVKAMAWSPHKR 434

>Ecym_6228 Chr6 (425765..427102) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii AER337W
          Length = 445

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 55/119 (46%), Gaps = 13/119 (10%)

Query: 82  VKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYIYDIR--SWDTPI 139
           +K +DL ++ C+ T T   +   +       ++ACG+        + ++D R  S    I
Sbjct: 297 IKTWDLVTSRCVDTKTTSYSLLSIVEMPARRLLACGSSAR----HIILHDPRMDSSSKII 352

Query: 140 RSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDL-------TETEEEDSLHQVIN 191
           +  +  H++ +  +   P +  +L SGS DG   ++D+       T T E+ S+ + IN
Sbjct: 353 QKQLIGHNNFVVSLDTCPENEYMLCSGSHDGTVRVWDVRSDAPLYTITREDKSVQKGIN 411

>NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {ON}
           Anc_8.435
          Length = 857

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 53/121 (43%), Gaps = 22/121 (18%)

Query: 75  VTATNESVKIYDL-------------KSNDCIKTITNEKNSPFLSLDSLHNMMACGTELS 121
           +   ++++KIY+L             +S   IKT+     S  +  DS   ++A G    
Sbjct: 81  IALQSQALKIYNLTAIEGETTMNTKQQSLQPIKTLKLSSPSYIMDCDSTSTLVAVG---- 136

Query: 122 GVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSK---VLMSGSTDGYTNIYDLT 178
           G D  + + DI   +  I      H   I+ +KF+ N+     +L SG T+G   I+DL 
Sbjct: 137 GTDGSIIVVDIE--NGFITHSFKGHGGTISSVKFYGNNDTNCWLLCSGDTNGMVKIWDLV 194

Query: 179 E 179
           +
Sbjct: 195 K 195

>CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} similar
           to uniprot|P16649 Saccharomyces cerevisiae YCR084c TUP1
           general transcription repressor
          Length = 643

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 56/124 (45%), Gaps = 22/124 (17%)

Query: 69  NGGSLMVTATNESVKIYDLKSNDCI-------KTITNEKNSPFLSLDSLHNMMAC----G 117
           N G  + T  N++ KI+++ + + +       KT T + NS   S   L+    C    G
Sbjct: 328 NNGEYLATGCNKTTKIFEVATGNLVTELVDDTKTGTEDANSA--SSADLYIRSVCFSPDG 385

Query: 118 TELS-GVDAELYIYDIRSWDTPIRSFV---DSHHDDITDIKFHPNDSKVLMSGSTDGYTN 173
             L+ G + +L    IR WD   R  V     H  DI  + +  + +K L+SGS D    
Sbjct: 386 KFLATGAEDKL----IRIWDIAQRKIVMVLRGHEQDIYSLDYFQSGNK-LVSGSGDRTIR 440

Query: 174 IYDL 177
           I+DL
Sbjct: 441 IWDL 444

>KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {ON}
           Anc_8.631 YOR212W
          Length = 425

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 3/56 (5%)

Query: 122 GVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDL 177
           G D   YI+DIR+  +    FV +   D+  ++F   D   + +GS DG  N+YDL
Sbjct: 247 GSDGYTYIWDIRTPGSVQNFFVSNR--DVNTLQFF-KDGNSIATGSDDGMVNLYDL 299

>ZYRO0B15268g Chr2 complement(1243795..1244396,1244475..1245684)
           [1812 bp, 603 aa] {ON} weakly similar to uniprot|P50082
           Saccharomyces cerevisiae YGR225W AMA1 Required for
           sporulation highly induced during sporulation activator
           of meiotic anaphase promoting complex Required for
           sporulation highly induced during sporulation
          Length = 603

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 61/148 (41%), Gaps = 9/148 (6%)

Query: 21  KPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSIN-DFEIVNNNYNGGSLMVTATN 79
           KPL+ Y    S++   IS + W T   +DK+ IGE   +    IV    N         +
Sbjct: 322 KPLFEY---QSMTLRGISCVQWYTKSFEDKLLIGEECGDISHLIVKRRKNSLGFDPEIYD 378

Query: 80  ESVKIYDLKSNDCI-KTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYIYDIRSWDTP 138
               I    S +C+ K   + +    +S++   +++A G    G D    ++DI S   P
Sbjct: 379 NENLIPQSWSLECLAKFQAHAQQVCGISMNEDSDLLAVG----GNDNTCTLWDISSIQHP 434

Query: 139 IRSFVDSHHDDITDIKFHPNDSKVLMSG 166
              F+  H   +  + F P    +L +G
Sbjct: 435 KLKFILPHKAAVKALAFCPWSKSLLATG 462

>KLLA0D06787g Chr4 (586289..587599) [1311 bp, 436 aa] {ON} similar
           to uniprot|P18851 YOR212W Saccharomyces cerevisiae STE4
           G protein beta subunit
          Length = 436

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 31/56 (55%), Gaps = 3/56 (5%)

Query: 122 GVDAELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDL 177
           G D   Y++D+R  ++    F+     D++ IKF  N+ +  M+GS DG   ++DL
Sbjct: 240 GSDGYAYLWDVRQPNSAQSFFISD--SDVSAIKFF-NNGESFMAGSDDGSARLFDL 292

>NCAS0B00480 Chr2 (69598..70968) [1371 bp, 456 aa] {ON} Anc_8.721
          Length = 456

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 50/106 (47%), Gaps = 6/106 (5%)

Query: 77  ATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLH--NMMACGTELSGVDAELYIYDIRS 134
           + + ++K +DL +  CI T T   +   LSL  L   N++ACG+  S     L+   + +
Sbjct: 303 SQDHTIKTWDLVTARCIDTKTTSYS--LLSLTQLPTLNLLACGS--SARHITLHDPRMGA 358

Query: 135 WDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTET 180
                +  +  H + +  +   P +  +L SGS DG   ++D+  T
Sbjct: 359 SSKVTQHQLIGHKNFVVSLDTCPENEYILCSGSHDGTVKVWDVRST 404

>NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.401
           YMR131C
          Length = 512

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 42/187 (22%), Positives = 88/187 (47%), Gaps = 19/187 (10%)

Query: 16  WCLKFKPLYNYG-LLTSLSNGEISILDWKTNQ-IKDKIKIGETSINDFEIVNNNYNGGSL 73
           + L + P    G LLT   +G+I      T++ + DK     ++    E +  +   G++
Sbjct: 278 YALDWSPSIQTGALLTGDCSGQIYFTQRHTSKWVTDKQPFTVSNNKSIEDIQWSRTEGTV 337

Query: 74  MVTATNES-VKIYDLKSNDCIKTITNEKNSPFLSL----DSLHNMMACGTELSGVDAELY 128
             +A  +  ++I+D +S      I+ + ++  +++    D L  ++A G + +GV     
Sbjct: 338 FASAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKLGYLLASGDD-NGV---WG 393

Query: 129 IYDIRSW--DT-----PIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETE 181
           ++D+R +  DT     P+  + D H   IT I F+P D  ++   S D    ++DL+   
Sbjct: 394 VWDLRQFSPDTANSVQPVAQY-DFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEA 452

Query: 182 EEDSLHQ 188
           +++ + Q
Sbjct: 453 DDEEIKQ 459

>SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} similar
           to uniprot|P20053 Saccharomyces cerevisiae YPR178W PRP4
           Splicing factor component of the U4/U6-U5 snRNP complex
          Length = 470

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 48/106 (45%), Gaps = 6/106 (5%)

Query: 71  GSLMVTATNESVK-IYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYI 129
           GSL+ +   +SV  ++DL+S   I  +      P   LD   N     T     D  + +
Sbjct: 323 GSLLCSTGLDSVGLVWDLRSGKSIMALEGHIK-PIYGLDWSPNGYDIAT--GSADGTIRL 379

Query: 130 YDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIY 175
           +D+R     I   + +H+  ++++KF   +   L+S S D   NIY
Sbjct: 380 WDVRK--VGILGALPAHNSIVSEVKFDKANGHYLVSSSYDKTLNIY 423

>KLLA0D15873g Chr4 (1334131..1335426) [1296 bp, 431 aa] {ON} similar
           to uniprot|P35184 Saccharomyces cerevisiae YIR012W SQT1
           Protein involved in a late step of 60S ribosomal subunit
           assembly or modification contains multiple WD repeats
           interacts with Qsr1p in the two-hybrid system
          Length = 431

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 40/72 (55%), Gaps = 7/72 (9%)

Query: 18  LKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGE-TSINDFEIVNNNYNGGSLMVT 76
           L+F  +  + L+ S  NG++ I D +T Q +  + +G    + DF ++ N    GS ++T
Sbjct: 363 LQFDTINGHNLIASCINGKVYIFDARTGQ-EVHVCVGHNMGVLDFVVIEN----GSKLIT 417

Query: 77  ATNESVK-IYDL 87
           A +E V  I+DL
Sbjct: 418 AGDEGVSLIFDL 429

>Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}
           YPL247C (REAL)
          Length = 522

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 51/119 (42%), Gaps = 27/119 (22%)

Query: 81  SVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDA--------------- 125
           SV+++DL+S      I    +SP     S  N  A    L G DA               
Sbjct: 311 SVRVFDLRSLAHSTIIYEPPSSPA----SGPNAGATTPSLKGSDALLRLEPSPYDPNVLA 366

Query: 126 -------ELYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDL 177
                  ++ I D+R+ ++PI + ++ H   + +IK+HP    VL+S S D     +DL
Sbjct: 367 TFAADSNKIIILDMRNPESPILN-LEGHTCSVNEIKWHPTKRNVLLSCSDDCQALYWDL 424

>NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672
          Length = 431

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 47/102 (46%), Gaps = 11/102 (10%)

Query: 77  ATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYIYDIRSWD 136
           +T+ +++++D+ +   +K IT+ K S       + N+    TE S   +     DIRSW 
Sbjct: 265 STDATIRLWDIVAGKSMKVITHHKKS-------VRNIAFHPTEFSM--SSCSANDIRSWK 315

Query: 137 TPIRSFVDSHHDDITDI--KFHPNDSKVLMSGSTDGYTNIYD 176
            P    + + + D   I      N   VL +GS +G  + YD
Sbjct: 316 LPEGGLLTNFNSDGLGIINTLSINQDDVLFAGSDNGMLSFYD 357

>YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}
           SEC31Component of the Sec13p-Sec31p complex of the COPII
           vesicle coat, required for vesicle formation in ER to
           Golgi transport; mutant has increased aneuploidy
           tolerance
          Length = 1273

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 70/163 (42%), Gaps = 14/163 (8%)

Query: 77  ATNESVKIYDLKSNDCIKTITN-EKNSPFLSLDSLHNMMACGTELSGVDAELYIYDIRSW 135
           +T+ S++++ L + D  K I + + +S F  LD  HN       L   +  L +Y     
Sbjct: 37  STDSSLELWSLLAADSEKPIASLQVDSKFNDLDWSHNNKIIAGALD--NGSLELYSTNEA 94

Query: 136 DTPIRSFV--DSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEEDSLHQVI--- 190
           +  I S     +H   +  +KF+     VL SG  +G   I+D+ +  E  S +  +   
Sbjct: 95  NNAINSMARFSNHSSSVKTVKFNAKQDNVLASGGNNGEIFIWDMNKCTESPSNYTPLTPG 154

Query: 191 -NYSSIH---SCGWLSS-RRIFTLSHMETFA-IHQLNDKSEVL 227
            + SS+    S  W  S   +F  +    FA I  L  K EV+
Sbjct: 155 QSMSSVDEVISLAWNQSLAHVFASAGSSNFASIWDLKAKKEVI 197

>NCAS0I02490 Chr9 complement(465916..467796) [1881 bp, 626 aa] {ON}
           Anc_3.95 YDR488C
          Length = 626

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 22/34 (64%)

Query: 143 VDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYD 176
           V+ H  D+T ++FHP +  +L SGS D   +++D
Sbjct: 487 VNFHSSDVTSLRFHPQNDDLLCSGSMDWNCHLWD 520

>Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 40/185 (21%), Positives = 86/185 (46%), Gaps = 19/185 (10%)

Query: 18  LKFKPLYNYG-LLTSLSNGEISILDWKTNQ-IKDKIKIGETSINDFEIVNNNYNGGSLMV 75
           L + PL   G LL+   +G+I      T++ + DK     ++    E +  +    ++  
Sbjct: 277 LDWSPLIKTGALLSGDCSGQIYFTQRHTSRWVTDKQPFTVSNNKSIEDIQWSRTESTVFA 336

Query: 76  TATNES-VKIYDLKSNDCIKTITNEKNSPFLSL----DSLHNMMACGTELSGVDAELYIY 130
           TA  +  ++I+D +S      I+ + ++  +++    D +  ++A G +    +    ++
Sbjct: 337 TAGCDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDD----NGTWGVW 392

Query: 131 DIRSW-----DT--PIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEE 183
           D+R +     DT  P+  + D H   IT I F+P D  ++  GS D    ++DL+   ++
Sbjct: 393 DLRQFTPSNADTVQPVAQY-DFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADD 451

Query: 184 DSLHQ 188
           + + Q
Sbjct: 452 EEIKQ 456

 Score = 30.8 bits (68), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 20/91 (21%), Positives = 41/91 (45%), Gaps = 3/91 (3%)

Query: 113 MMACGTELSG-VDAELYIYDIRS--WDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTD 169
           ++  G  LSG    ++Y     +  W T  + F  S++  I DI++   +S V  +   D
Sbjct: 282 LIKTGALLSGDCSGQIYFTQRHTSRWVTDKQPFTVSNNKSIEDIQWSRTESTVFATAGCD 341

Query: 170 GYTNIYDLTETEEEDSLHQVINYSSIHSCGW 200
           GY  I+D    + + ++    + + ++   W
Sbjct: 342 GYIRIWDTRSKKHKPAISVKASNTDVNVISW 372

>Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar to
           Ashbya gossypii ADR242C
          Length = 522

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 45/196 (22%), Positives = 89/196 (45%), Gaps = 41/196 (20%)

Query: 18  LKFKPLYNYG-LLTSLSNGEISILD-----WKTNQIKDKIKIGETSINDFEIVNNNYNGG 71
           L + PL   G +LT   +G + +       W T+  K    +G    N+  I +  ++  
Sbjct: 290 LDWSPLIKTGSILTGDCSGRVYLTQRTASRWVTD--KQPFTVG----NNKSIEDIQWSRA 343

Query: 72  SLMVTAT---NESVKIYDLKSNDCIKTITNEKNSPFLSL---DSLHNMMACGTEL----- 120
            + V AT   +  ++I+D +S         +K+ P LS+   D+  N+M+   ++     
Sbjct: 344 EMTVFATCGVDGHIRIWDTRS---------KKHKPALSVMVSDTDVNVMSWNEKIGYLLA 394

Query: 121 SGVDAELY-IYDIRSWD-------TPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYT 172
           SG D+  + ++D+R +        TP+  + + H   IT I F+P D  ++   S D   
Sbjct: 395 SGDDSGTWGVWDLRQFSAQNTEKTTPVAQY-NFHKAAITSISFNPLDESIIAVASEDNTV 453

Query: 173 NIYDLTETEEEDSLHQ 188
            ++DL+   +++ + Q
Sbjct: 454 TLWDLSVEADDEEIKQ 469

>Suva_4.427 Chr4 (751909..752856) [948 bp, 315 aa] {ON} YBR175W
           (REAL)
          Length = 315

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 3/48 (6%)

Query: 132 IRSWDT---PIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYD 176
           I+ WDT    +   + +H + +  +    NDS +L SGS DG   I+D
Sbjct: 120 IKIWDTLNGSLMKTISAHSEAVVSVDVPTNDSSILSSGSYDGLIRIFD 167

>TPHA0L01080 Chr12 (226790..229297) [2508 bp, 835 aa] {ON} Anc_8.435
           YLR222C
          Length = 835

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 53/119 (44%), Gaps = 9/119 (7%)

Query: 73  LMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLDSLHNMMACGTELSGVDAELYIYDI 132
           L   +  + +KI+ L +   +K++     S  L  D    ++A G    G D  + + DI
Sbjct: 88  LCYVSQAQLLKIFKLSTGKIVKSMKISSPSYVLETDPTSTLLAIG----GTDGSVTVIDI 143

Query: 133 RSWDTPIRSFVDSHHDDITDIKFHP---NDSKVLMSGSTDGYTNIYDLTETEEEDSLHQ 188
              +  I   +  H   I+ +KF+     ++ +L SG T+G   I+DL   +   +L +
Sbjct: 144 E--NGYITHSLKGHGATISSLKFYGEQHTNTWLLSSGDTNGMVKIWDLVSRKAIHTLQE 200

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.134    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,229,220
Number of extensions: 2128900
Number of successful extensions: 8554
Number of sequences better than 10.0: 576
Number of HSP's gapped: 8595
Number of HSP's successfully gapped: 669
Length of query: 403
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 291
Effective length of database: 40,638,807
Effective search space: 11825892837
Effective search space used: 11825892837
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 67 (30.4 bits)