Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0B033108.847ON61361328980.0
Kpol_1068.38.847ON5664304164e-43
KLTH0C03718g8.847ON5514493768e-38
SAKL0D01298g8.847ON5514563732e-37
ZYRO0G14322g8.847ON5504143572e-35
TDEL0B005108.847ON5504583396e-33
TPHA0I002908.847ON5694133309e-32
Kwal_27.102248.847ON5464493061e-28
Skud_13.4548.847ON5803842767e-25
YMR282C (AEP2)8.847ON5804402671e-23
Suva_13.4718.847ON5814422671e-23
Smik_13.4958.847ON5764402581e-22
Ecym_46188.847ON5273992552e-22
KLLA0D01408g8.847ON5183582436e-21
KAFR0B039708.847ON4744432133e-17
CAGL0M03069g8.847ON5483741949e-15
NCAS0C003708.847ON4952321795e-13
NDAI0K003408.847ON6242461796e-13
KNAG0J002308.847ON4743671368e-08
ABL119C8.847ON5373541271e-06
TPHA0G008002.300ON54447780.67
NCAS0A153007.546ON1398122771.3
NCAS0G037202.300ON52739742.4
YDR499W (LCD1)1.63ON74787724.4
TBLA0B019401.519ON112773715.8
NCAS0I012803.329ON61666706.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0B03310
         (613 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0B03310 Chr2 complement(772555..774396) [1842 bp, 613 aa] {O...  1120   0.0  
Kpol_1068.3 s1068 (4295..5995) [1701 bp, 566 aa] {ON} (4295..599...   164   4e-43
KLTH0C03718g Chr3 (321675..323330) [1656 bp, 551 aa] {ON} weakly...   149   8e-38
SAKL0D01298g Chr4 (98188..99843) [1656 bp, 551 aa] {ON} weakly s...   148   2e-37
ZYRO0G14322g Chr7 complement(1146574..1148226) [1653 bp, 550 aa]...   142   2e-35
TDEL0B00510 Chr2 (92878..94530) [1653 bp, 550 aa] {ON} Anc_8.847...   135   6e-33
TPHA0I00290 Chr9 complement(55148..56857) [1710 bp, 569 aa] {ON}...   131   9e-32
Kwal_27.10224 s27 (248037..249677) [1641 bp, 546 aa] {ON} YMR282...   122   1e-28
Skud_13.454 Chr13 complement(806601..808343) [1743 bp, 580 aa] {...   110   7e-25
YMR282C Chr13 complement(833356..835098) [1743 bp, 580 aa] {ON} ...   107   1e-23
Suva_13.471 Chr13 complement(816054..817799) [1746 bp, 581 aa] {...   107   1e-23
Smik_13.495 Chr13 complement(816375..818105) [1731 bp, 576 aa] {...   103   1e-22
Ecym_4618 Chr4 complement(1210600..1212183) [1584 bp, 527 aa] {O...   102   2e-22
KLLA0D01408g Chr4 (120712..122268) [1557 bp, 518 aa] {ON} weakly...    98   6e-21
KAFR0B03970 Chr2 complement(830202..831626) [1425 bp, 474 aa] {O...    87   3e-17
CAGL0M03069g Chr13 complement(347584..349230) [1647 bp, 548 aa] ...    79   9e-15
NCAS0C00370 Chr3 (54433..55920) [1488 bp, 495 aa] {ON} Anc_8.847...    74   5e-13
NDAI0K00340 Chr11 complement(64928..66802) [1875 bp, 624 aa] {ON...    74   6e-13
KNAG0J00230 Chr10 (30660..32084) [1425 bp, 474 aa] {ON} Anc_8.84...    57   8e-08
ABL119C Chr2 complement(175840..177453) [1614 bp, 537 aa] {ON} S...    54   1e-06
TPHA0G00800 Chr7 complement(148640..150274) [1635 bp, 544 aa] {O...    35   0.67 
NCAS0A15300 Chr1 (3006855..3011051) [4197 bp, 1398 aa] {ON}            34   1.3  
NCAS0G03720 Chr7 complement(686579..688162) [1584 bp, 527 aa] {O...    33   2.4  
YDR499W Chr4 (1447830..1450073) [2244 bp, 747 aa] {ON}  LCD1Esse...    32   4.4  
TBLA0B01940 Chr2 (445353..448736) [3384 bp, 1127 aa] {ON} Anc_1....    32   5.8  
NCAS0I01280 Chr9 complement(230866..232716) [1851 bp, 616 aa] {O...    32   6.3  

>TBLA0B03310 Chr2 complement(772555..774396) [1842 bp, 613 aa] {ON}
           Anc_8.847 YMR282C
          Length = 613

 Score = 1120 bits (2898), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 561/613 (91%), Positives = 561/613 (91%)

Query: 1   MLTRSYKQCIRSPYYNCNKNNYLKSISNPNDSFLVTNIPWTVNYTPSSLILSKCYSTNIS 60
           MLTRSYKQCIRSPYYNCNKNNYLKSISNPNDSFLVTNIPWTVNYTPSSLILSKCYSTNIS
Sbjct: 1   MLTRSYKQCIRSPYYNCNKNNYLKSISNPNDSFLVTNIPWTVNYTPSSLILSKCYSTNIS 60

Query: 61  ANIPNFDIENDKANNINDLTIYXXXXXXXXXXXXXXQLIQPNYXXXXXXXXXXXXXXXXX 120
           ANIPNFDIENDKANNINDLTIY              QLIQPNY                 
Sbjct: 61  ANIPNFDIENDKANNINDLTIYEKFLKLSKESELKSQLIQPNYTSTNNVNNTDDVNTSDG 120

Query: 121 XXINYKKFVDELIQWHYLDAKALNKLVNKHLNDMNLSIVINLLVKYNHFQPKDSDRLSFK 180
             INYKKFVDELIQWHYLDAKALNKLVNKHLNDMNLSIVINLLVKYNHFQPKDSDRLSFK
Sbjct: 121 TSINYKKFVDELIQWHYLDAKALNKLVNKHLNDMNLSIVINLLVKYNHFQPKDSDRLSFK 180

Query: 181 SHSELIFKVYQIYIERIEHPILNSNNNSHIQSIAEHSSTPLNPIQLYDLNKVITWFIKAG 240
           SHSELIFKVYQIYIERIEHPILNSNNNSHIQSIAEHSSTPLNPIQLYDLNKVITWFIKAG
Sbjct: 181 SHSELIFKVYQIYIERIEHPILNSNNNSHIQSIAEHSSTPLNPIQLYDLNKVITWFIKAG 240

Query: 241 QLKKATTALMYILKRYNAEIFQIPDSKTIINFLKLYCGGLPTNWRIEPINHRFIKNQGKR 300
           QLKKATTALMYILKRYNAEIFQIPDSKTIINFLKLYCGGLPTNWRIEPINHRFIKNQGKR
Sbjct: 241 QLKKATTALMYILKRYNAEIFQIPDSKTIINFLKLYCGGLPTNWRIEPINHRFIKNQGKR 300

Query: 301 SFKLGNNSSYYRLPSSYKAVYEKVPIQIVEHIKKNTNDMKLSGKLFHFIRTGEFDSTLIY 360
           SFKLGNNSSYYRLPSSYKAVYEKVPIQIVEHIKKNTNDMKLSGKLFHFIRTGEFDSTLIY
Sbjct: 301 SFKLGNNSSYYRLPSSYKAVYEKVPIQIVEHIKKNTNDMKLSGKLFHFIRTGEFDSTLIY 360

Query: 361 SLTSLGRFDLAEQYFKDNWLSDSCDDVELTSDIVIAIFSSYVYNNSNNIEKANKLIQEII 420
           SLTSLGRFDLAEQYFKDNWLSDSCDDVELTSDIVIAIFSSYVYNNSNNIEKANKLIQEII
Sbjct: 361 SLTSLGRFDLAEQYFKDNWLSDSCDDVELTSDIVIAIFSSYVYNNSNNIEKANKLIQEII 420

Query: 421 KRYPDLHLNISTWCRIIRWNIQMWDTTTDFNGEIPYDSFYTMLTYYSNYCSRNSTFKSCH 480
           KRYPDLHLNISTWCRIIRWNIQMWDTTTDFNGEIPYDSFYTMLTYYSNYCSRNSTFKSCH
Sbjct: 421 KRYPDLHLNISTWCRIIRWNIQMWDTTTDFNGEIPYDSFYTMLTYYSNYCSRNSTFKSCH 480

Query: 481 IPYNKMLLGDLYHLFNTKISLNKCLFIMDNCFKKSLFKTPSKVTTKDYQILLKYQKMILK 540
           IPYNKMLLGDLYHLFNTKISLNKCLFIMDNCFKKSLFKTPSKVTTKDYQILLKYQKMILK
Sbjct: 481 IPYNKMLLGDLYHLFNTKISLNKCLFIMDNCFKKSLFKTPSKVTTKDYQILLKYQKMILK 540

Query: 541 YLINDRKLTSNKPLDFIEKYSLDTNNKEQXXXXXXXXXXXXXXXXXXXGNLNANEKNSIE 600
           YLINDRKLTSNKPLDFIEKYSLDTNNKEQ                   GNLNANEKNSIE
Sbjct: 541 YLINDRKLTSNKPLDFIEKYSLDTNNKEQLLEYRLERLEYRKSRKEYYGNLNANEKNSIE 600

Query: 601 KITLLMIKWMKKI 613
           KITLLMIKWMKKI
Sbjct: 601 KITLLMIKWMKKI 613

>Kpol_1068.3 s1068 (4295..5995) [1701 bp, 566 aa] {ON} (4295..5995)
           [1701 nt, 567 aa]
          Length = 566

 Score =  164 bits (416), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 132/430 (30%), Positives = 210/430 (48%), Gaps = 51/430 (11%)

Query: 156 LSIVINLLVKYNHFQPKDSDRLSFKSHS----ELIFKVYQIYIERIEHPILNSNNNSHIQ 211
           LSI IN + K N     D  R+    HS    ELI++++++Y   I              
Sbjct: 125 LSIFINRIYKSN---GHDIKRVIQNHHSLSYTELIYEIFELYTSTIP------------- 168

Query: 212 SIAEHSSTPLNPIQLYDLNKVITWFIKAGQLKKATTALMYILKRYNAEIFQIPDSKTIIN 271
              E     LN + L DLN  IT FIK  QL KA   L YI+      I +I D  T++N
Sbjct: 169 --KESGIIKLNALHLKDLNLFITIFIKEAQLSKAQNVLQYIIDA-EGSIEKITDHDTMVN 225

Query: 272 FLKLYCGGLPTNWRIEPINHRFIKNQGKRSFKLGNNSSYYRLPSSYKAVYEKVPIQIVEH 331
           FL+L CGGLP  W +   ++   K Q K++ +L +NS   R PSSYK+    VP  ++  
Sbjct: 226 FLRLRCGGLPKFWLVPQASYAVTK-QTKKNSRLSSNSPNTRFPSSYKST---VPNTVLFE 281

Query: 332 IKKNTNDMKLSGKLFHFIRTGEFDSTLIYSLTSLGRFDLAEQYFKDNW-LSDSCDDVEL- 389
           +     +M L+ K++    +G  DST++YSL    +  + + + K++W +S   D ++L 
Sbjct: 282 VI----NMILNKKVWKSKHSGILDSTIVYSLAHTFQKQMMDGFIKEHWGISSHGDPLDLF 337

Query: 390 ----------TSDIVIAIFSSYVYNNSNNIEKANKLIQEIIKRYPDLHLNISTWCRIIRW 439
                     +++I+IAI SSY+Y +  NI+ A K++ + I+ YPD+ L+   W R+I+W
Sbjct: 338 IKKKKVASAPSNEILIAIMSSYIYKD-RNIDGAMKILDKFIRMYPDISLDNMFWRRLIQW 396

Query: 440 NIQMWDTTTDFNGEIPYDSFYTMLTYYSNYCSRNSTFKSCHIPYNKMLLGDLYHLFNTKI 499
             ++WD   D  G   Y  +  M  +     +   T K   +PY+  +  + Y LF    
Sbjct: 397 CNRLWDPKIDRQGTFGYGCWNMMKNW-----NGAGTGKDVVLPYDFQIYEEFYRLFKRTN 451

Query: 500 SLNKCLFIMDNCFKKSLFKTPSKVTTKDYQILLKYQKMILKYLINDRKLTSNKPLDFIEK 559
           +      I+ N     L +    V   +  +L KYQ + + +LI  R+    K   FIE+
Sbjct: 452 NGKIAAEIVSNVLIPHLSEKNVAVKKAELNLLNKYQTLAMNWLIERRQF--KKAAFFIEE 509

Query: 560 YSLDTNNKEQ 569
           +S+D NN+ Q
Sbjct: 510 WSIDRNNRIQ 519

>KLTH0C03718g Chr3 (321675..323330) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 551

 Score =  149 bits (376), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 126/449 (28%), Positives = 220/449 (48%), Gaps = 61/449 (13%)

Query: 124 NYKKFVDELIQWHYLDAKALNKLV-NKHLNDMNLSIVINLLVKYNHFQPKDSDRLSFKSH 182
           +Y  F+ EL     +D     K+  N  L+    S  I  L+  N+   K S  L   S 
Sbjct: 101 DYMAFLVELTLQSRMDENFGAKMFQNNDLSIAEFSAFIEGLLSVNNLLHKLSATLPNVSG 160

Query: 183 SELIFKVYQIYIERIEHPILNSNNNSHIQSIAEHSSTPLNPIQLYDLNKVITWFIKAGQL 242
           +E++F +YQ+Y++ +                   +  PL+P+QL+D NK I +FI++ QL
Sbjct: 161 TEMVFSLYQLYLKTV-------------------TPGPLSPLQLHDFNKFIRFFIRSAQL 201

Query: 243 KKATTALMYILKRYNAEIFQIP-DSKTIINFLKLYCGGLPTNWRIEPINHRFIKNQGKRS 301
           +KA T L  ILK  N    Q+P DS T  ++L+L CG LP NW++        +N G RS
Sbjct: 202 RKAQTVLDCILKSNNN---QLPCDSATATHYLQLRCGALPRNWKV------LDENLG-RS 251

Query: 302 FKLGNNSSYYRLPS-SYKAVYEKVPIQIVEHIKKNTNDMKLSGKLFHFIRTGEFDSTLIY 360
            +LG   + Y+L S SYKA+  K  +  +  +    +D K     FH  ++   +S ++Y
Sbjct: 252 TRLGARKNRYQLVSHSYKALDHKSVLTFMSLL----SDPK--SVWFH-RKSAALESAVVY 304

Query: 361 SLTSLGRFDLAEQYFKDNWL-----SDSCDDVELT---SDIVIAIFSSYVYNNSNNIEKA 412
           SL  +G+  L E++   NW       +   D   T   S++++A+ +SY  N   NI  A
Sbjct: 305 SLGFMGQLKLLEEHVWRNWGISLQEHNQVTDASFTSPSSEVLVAVLTSYASN--KNISSA 362

Query: 413 NKLIQEIIKRYPDLHLNISTWCRIIRWNIQMWDTTTDFNGEIPYDSFYTMLTYYSNYCSR 472
             LI   + +YP L L+   W R+ +W+ ++W   TD  GE+    +  M  +++   +R
Sbjct: 363 LHLIDGFMAKYPTLELDHVFWRRLFQWSTRVWSEKTDPRGELSRGCWRVMREWHA---AR 419

Query: 473 NSTFKSCHIPYNKMLLGDLYHLFNTKISLNKCLFIMDNCFKKSLFKTPSKVTTKDYQILL 532
           N       +P + +LL + + + +   +    + +++ C+  S F   + ++  +  +  
Sbjct: 420 NR-----QLPADAVLLNERFVVLSRTNNYRDAIEVVEQCY--SSFFQKANLSRHEAVLFQ 472

Query: 533 KYQKMILKYLINDRKLTSNKPLDFIEKYS 561
           K+ K+ILK + +      +KPL FI+++S
Sbjct: 473 KFAKLILKNMAHLGYY--HKPLKFIKEWS 499

>SAKL0D01298g Chr4 (98188..99843) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 551

 Score =  148 bits (373), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 115/456 (25%), Positives = 224/456 (49%), Gaps = 63/456 (13%)

Query: 124 NYKKFVDELIQWHYLDAKALNKLVNKHL-NDMNLSIVINLLVKYNHFQPKDSDRLSFKSH 182
            + KF+ EL+     D    N++ ++ L   +  S+ +N L+   + + + ++ +    H
Sbjct: 101 EHAKFLVELLLECKSDEGFANRMFSEKLITKLEYSVFVNKLLSNTNLKSELTNLIPGTVH 160

Query: 183 SELIFKVYQIYIERIEHPILNSNNNSHIQSIAEHSSTPLNPIQLYDLNKVITWFIKAGQL 242
           +E++FK+Y+IY + +                    +  L P+QLYDLN+ I  F    QL
Sbjct: 161 TEVLFKLYEIYRDSVV------------------GNATLTPVQLYDLNQFIKRFTGDAQL 202

Query: 243 KKATTALMYILKRYNAEIFQIP-DSKTIINFLKLYCGGLPTNWRIEPINHRFIKNQGKRS 301
            KA   L ++L+ Y +    IP D +T+IN+L+L CG +P NW I P++   +   GK  
Sbjct: 203 AKAQQVLGFVLENYGS----IPRDPQTLINYLELKCGAMPRNWSI-PLSRPEL---GK-- 252

Query: 302 FKLGNNSSYYRLPSSYKAVYEKVPIQIVEHIKKNTNDMKLSGKLFHFIRTGEFDSTLIYS 361
             LG+ S    L  SYK +  +  + +++ + K+        + +H+ R  + ++ +IYS
Sbjct: 253 -TLGSQSFMSNLAHSYKVLETEALLPLIDEMMKD--------RAWHYKRNCDLEAAVIYS 303

Query: 362 LTSLGRFDLAEQYFKDNWL----SDSCDDVEL------TSDIVIAIFSSYVYNNSNNIEK 411
           L  +G+F L E+Y K  W     S++  +VE+      TS+++I+I S Y      N+ +
Sbjct: 304 LGYMGQFALLERYIKHTWGVSVSSNTSTEVEVPKNLYPTSNLLISIVSCYAMKG--NLHQ 361

Query: 412 ANKLIQEIIKRYPDLHLNISTWCRIIRWNIQMWDTTTDFNGEIPYDSFYTMLTYYSNYCS 471
           A ++I   + ++P + L    W R+ +W+ ++W+  TD  GE+  +  + ++  + N   
Sbjct: 362 ALQIIDSFLSKFPQIELEPLFWRRLFQWSTRLWNQKTDPKGELS-NGCWQVMKQWHNKQK 420

Query: 472 RNSTFKSCHIPYNKMLLGDLYHLFNTKISLNKCLFIMDNCFKKSLFKTPSKVTTKDYQIL 531
           R+       +P +  +L + Y++     +  + L I D        K    +   +  ++
Sbjct: 421 RS-------LPIDLGILNERYYVLKRTNNFTEALRIHDEALAGLYMK--RNLIDPEVDVI 471

Query: 532 LKYQKMILKYLINDRKLTSNKPLDFIEKYSLDTNNK 567
            K+QK+ILK +    +   +KPL +I ++ L+  N+
Sbjct: 472 KKFQKLILKKMAG--RGYYHKPLKYISEWCLNKRNE 505

>ZYRO0G14322g Chr7 complement(1146574..1148226) [1653 bp, 550 aa]
           {ON} weakly similar to uniprot|P22136 Saccharomyces
           cerevisiae YMR282C AEP2 Mitochondrial protein likely
           involved in translation of the mitochondrial OLI1 mRNA
           exhibits genetic interaction with the OLI1 mRNA 5'-
           untranslated leader
          Length = 550

 Score =  142 bits (357), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 112/414 (27%), Positives = 195/414 (47%), Gaps = 45/414 (10%)

Query: 157 SIVINLLVKYNHFQPKDSDRLSFKSHSELIFKVYQIYIERIEHPILNSNNNSHIQSIAEH 216
           S+ IN L+       K S+ +    H+ELI+K+Y+ Y + I               + +H
Sbjct: 133 SLFINKLLSEEELDVKLSNVIPDTPHTELIYKLYEFYCDHI---------------VDQH 177

Query: 217 SSTPLNPIQLYDLNKVITWFIKAGQLKKATTALMYI-LKRYNAEIFQIPDSKTIINFLKL 275
           + TPL   QLYDLN  +  FI   QL KA   L +I L+R   ++    D + +I FL+L
Sbjct: 178 NLTPL---QLYDLNLFLKTFIAEAQLSKAHNVLDFILLRRPLNDLLANTDVEILIQFLRL 234

Query: 276 YCGGLPTNWRIEPINHRFIKNQGKRSFKLGNNSSYYRLPSSYKAVYEKVPIQIVEHIKKN 335
            CG L   W+I+P + R        +  LG  +S   L  SYK   EKV +QI+  +   
Sbjct: 235 KCGALSKFWKIQPASQR-----NSTAITLGEKASDCHLAKSYKFQNEKVLLQIINSVLGE 289

Query: 336 TNDMKLSGKLFHFIRTGEFDSTLIYSLTSLGRFDLAEQYFKDNWLSDSCDDVEL--TSDI 393
            N        +   R+ + D+ +IYSL  LG+ DL E+Y    W     + V+    SD+
Sbjct: 290 HN--------WKNRRSPKLDAAIIYSLGYLGQTDLIEKYVNRTWSPSKDEGVKTNPNSDL 341

Query: 394 VIAIFSSYVYNNSNNIEKANKLIQEIIKRYPDLHLNISTWCRIIRWNIQMWDTTTDFNGE 453
           ++A+ +SY      N+ K  +++   I+ YP++ L+   W R+++ +  +WD   D    
Sbjct: 342 LVAVLTSYCVKEG-NMRKGLEVLDRFIRDYPEVELDPLFWRRLLQLSSLLWDKKRDRKAT 400

Query: 454 IPYDSFYTMLTYYSNYCSRNSTFKSCHIPYNKMLLGDLYHLFNTKISLNKCLFIMDNCFK 513
           + +  +  M  +++         +   IPY+  ++ +LY +F    + N  L ++   F 
Sbjct: 401 LSHGCWTIMKQWHAQ--------RQRKIPYDYGIMKELYPIFVRTKNKNGALEVITKSFF 452

Query: 514 KSLFKTPSKVTTKDYQILLKYQKMILKYLINDRKLTSNKPLDFIEKYSLDTNNK 567
            +  +    +   +  +L KYQ+ ILK +    K   +K  +F +++S  + NK
Sbjct: 453 GAFIQPEFTIRPNELSLLCKYQRFILKMIA--LKGNYHKGFEFCQEWSFSSTNK 504

>TDEL0B00510 Chr2 (92878..94530) [1653 bp, 550 aa] {ON} Anc_8.847
           YMR282C
          Length = 550

 Score =  135 bits (339), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 118/458 (25%), Positives = 207/458 (45%), Gaps = 60/458 (13%)

Query: 123 INYKKFVDELIQWHYLDAKALNK------LVNKHLNDMNLSIVINLLVKYNHFQPKDSDR 176
           +  K++VD LI  H +    LN+         K L+    S  IN L+       K S+ 
Sbjct: 94  LRRKEYVDFLI--HVMVQNHLNRNYIKSLFETKELSTSEFSTFINRLLLEKDLDLKLSNI 151

Query: 177 LSFKSHSELIFKVYQIYIERIEHPILNSNNNSHIQSIAEHSSTPLNPIQLYDLNKVITWF 236
           +    H+E+IF +YQIY   +   I +S N              L P+Q++D+N+ I  F
Sbjct: 152 IPDTVHTEIIFNLYQIYCTYV---IKDSQNG-------------LTPLQVHDINRFIKRF 195

Query: 237 IKAGQLKKATTALMYILKRYNAE-IFQIPDSKTIINFLKLYCGGLPTNWRIEPINHRFIK 295
           I   QLKKA   L +++ +     I Q  D +TI  FL+L CG L   WR++  + +   
Sbjct: 196 IDEAQLKKAQECLQFLIDKQGLHNILQSGDVETITQFLQLRCGALQKFWRVDSNSTKV-- 253

Query: 296 NQGKRSFKLGNNSSYYRLPSSYKAVYEKVPIQIVEHIKKNTNDMKLSGKLFHFIRTGEFD 355
                   LG +S +++ P SY  + E+  ++IV  + K+        K +    +   D
Sbjct: 254 --------LGEDSKHFKSPKSYNLLKEQPFLEIVNFLLKD--------KSWRLRSSPIID 297

Query: 356 STLIYSLTSLGRFDLAEQYFKDNWLSDSCDDVELTS------DIVIAIFSSYVYNNSNNI 409
           S ++YSL++LG+  L +QY +  W       V + +      +++I I S+Y   N +  
Sbjct: 298 SAIVYSLSNLGQTKLIDQYIQLKWGISEDGHVAVKNEAVPGHEVLINIVSAYCLKNGDT- 356

Query: 410 EKANKLIQEIIKRYPDLHLNISTWCRIIRWNIQMWDTTTDFNGEIPYDSFYTMLTYYSNY 469
            K  +++ + +K+YP   L    W R+++ +   WD   D    + +  +  M  ++   
Sbjct: 357 GKGLRILDQFMKKYPQTELEKLFWRRLLQLSFHNWDKQKDKKALVCHGCWNIMKQWHEQ- 415

Query: 470 CSRNSTFKSCHIPYNKMLLGDLYHLFNTKISLNKCLFIMDNCFKKSLFKTPSKVTTKDYQ 529
                  K   I Y+   L  LY LF    +      ++  CF     K P +++  +  
Sbjct: 416 -------KGVSITYDSGTLRLLYQLFKFTRNGRGAAEVVRTCFSSVYAKQPYQISKDEMD 468

Query: 530 ILLKYQKMILKYLINDRKLTSNKPLDFIEKYSLDTNNK 567
           +LL +QK+ LK +    K   N+PL  I+++++D  N+
Sbjct: 469 LLLMFQKLALKTMA--LKGRYNEPLQLIKEWNVDKINQ 504

>TPHA0I00290 Chr9 complement(55148..56857) [1710 bp, 569 aa] {ON}
           Anc_8.847 YMR282C
          Length = 569

 Score =  131 bits (330), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 108/413 (26%), Positives = 188/413 (45%), Gaps = 68/413 (16%)

Query: 182 HSELIFKVYQIYIERIEHPILNSNNNSHIQSIAEHSSTPLNPIQLYDLNKVITWFIKAGQ 241
           HSE++FK++Q+Y   I                    S  L+ + L D+N  I +FI  G 
Sbjct: 156 HSEMVFKLFQLYGNAI-------------------GSDKLSLLSLRDMNLFIEFFINEGH 196

Query: 242 LKKATTALMYILKRYNAEIFQIPDSKTIINFLKLYCGGLPTNWRIE------PINHRFIK 295
           L +A   L ++L +  + I  + D  T+ ++L+L CG LP  W  +          +F  
Sbjct: 197 LGRAEIVLTFVLNKTRS-ILDLYDVDTVTHYLQLRCGALPRYWMFQNKSAELAYKDKFGN 255

Query: 296 NQGKRSFKLGNNSSYYRLPSSYKAVYEKVPIQIVEHIKKNTNDMKLSGKLFHFIRTGEFD 355
              K   +LG  +   +L + YK +    P+ +++   K   D K          + + D
Sbjct: 256 RLSKYKTRLGRKNFAVKLTNRYKIL---DPLGVLKIANKIITDDKWKSN-----HSAKLD 307

Query: 356 STLIYSLTSLGRFDLAEQYFKDNW-----LSDSCDDVE----------LTSDIVIAIFSS 400
           +T++YSL   G+      Y    W     +SD   DV           L S+++ AI SS
Sbjct: 308 ATVVYSLCYSGQLSNIPSYINSRWNVDISMSDGNSDVGTQISNEASKPLPSEVMEAILSS 367

Query: 401 YVYNNSNNIEKANKLIQEIIKRYPDLHLNISTWCRIIRWNIQMWDTTTDFNGEIPYDSFY 460
           Y Y++ + IE+A  +I +I+  YP+L LN   W R+++W++  WD   D  G + Y  F 
Sbjct: 368 YSYDDKS-IERAINIIDKIMNSYPNLELNQQFWRRLMQWSVLCWDHKLDRKGSLVYGCFK 426

Query: 461 TMLTYYSNYCSRNSTFKSCHIPYNKMLLGDLYHLF----NTKISLNKCLFIMDNCFKKSL 516
           T+  Y+          +S  I +++ LL +LY L     N++I+       M   F    
Sbjct: 427 TLKKYHE--------MRSIRINFDEGLLQELYTLVYYTKNSRIAAEVVSEFMPQFF---- 474

Query: 517 FKTPSKVTTKDYQILLKYQKMILKYLINDRKLTSNKPLDFIEKYSLDTNNKEQ 569
           +K   ++T  + ++L  +QK  +  ++  +   +    +FIEK+S+D  NKE+
Sbjct: 475 YKRSDEITFGERKLLFYFQKRSIDGMLGKKDYFTAS--NFIEKWSMDNQNKEE 525

>Kwal_27.10224 s27 (248037..249677) [1641 bp, 546 aa] {ON} YMR282C
           (AEP2) - basic, hydrophilic 67.5 kDa protein [contig 39]
           FULL
          Length = 546

 Score =  122 bits (306), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 110/449 (24%), Positives = 213/449 (47%), Gaps = 61/449 (13%)

Query: 124 NYKKFVDELIQWHYLDAKALNKLVNKHLNDMN-LSIVINLLVKYNHFQPKDSDRLSFKSH 182
           +Y KF+ EL     L++   +K+   +L   N  S ++N L+   +   K    L     
Sbjct: 96  DYIKFMIELTIQSKLNSNFSHKIFEDNLLTPNEFSTLLNGLLTERNLSTKLETVLPSVQS 155

Query: 183 SELIFKVYQIYIERIEHPILNSNNNSHIQSIAEHSSTPLNPIQLYDLNKVITWFIKAGQL 242
           +E+IF +YQ Y+  I                    +  LNP+QL+DLN  + +FI+  QL
Sbjct: 156 TEMIFGLYQTYLMTI-------------------PAGSLNPLQLHDLNSFVQYFIETAQL 196

Query: 243 KKATTALMYILKRYNAEIFQIP-DSKTIINFLKLYCGGLPTNWRIEPINHRFIKNQGKRS 301
            KA   L  IL   N    Q+P D+ T I++L+L CG LP NW++         ++   S
Sbjct: 197 GKAQIVLDRILASNND---QLPCDTTTGIHYLQLRCGALPRNWKV-------FDSRVGHS 246

Query: 302 FKLGNNSSYYR-LPSSYKAVYEKVPIQIVEHIKKNTNDMKLSGKLFHFIRTGEFDSTLIY 360
            +LG++ +  + +  +YKA+ +   ++ V  +    ++       FH  ++   ++ +IY
Sbjct: 247 CRLGSHRNKSQPVSHTYKALDQSSVLEFVNVLNDENSEW------FH-KKSPTLEAAVIY 299

Query: 361 SLTSLGRFDLAEQYFKDNW--------LSDSCDDVELTSDIVIAIFSSYVYNNSNNIEKA 412
           SL  +G+  L +++    W        L+   ++V  + +++IAIF+S+   +   +   
Sbjct: 300 SLGFMGQLTLLKEHIAVRWGITELGASLATEVNEVPPSPEVLIAIFTSFA--SHQEVTLG 357

Query: 413 NKLIQEIIKRYPDLHLNISTWCRIIRWNIQMWDTTTDFNGEIPYDSFYTMLTYYSNYCSR 472
            +L+   I +Y +++L+I  W R+ +W   +WD  TD  G++    +  M  ++      
Sbjct: 358 LRLMDAFITKYSEINLDIVFWRRLFQWTNLVWDVKTDPRGDLSRGCWRVMTEWHEK---- 413

Query: 473 NSTFKSCHIPYNKMLLGDLYHLFNTKISLNKCLFIMDNCFKKSLFKTPSKVTTKDYQILL 532
                S  +  +  LL + Y +     +  + L ++   F + L++ P+ +++K+  I+ 
Sbjct: 414 ----GSKKLQPDTTLLNERYFVLAQTNNYKEALTVISQSFPQ-LYEKPT-LSSKEMAIVQ 467

Query: 533 KYQKMILKYLINDRKLTSNKPLDFIEKYS 561
           KY K++LK +        +KPL FI ++S
Sbjct: 468 KYSKLVLKSMAELGYY--HKPLTFITEWS 494

>Skud_13.454 Chr13 complement(806601..808343) [1743 bp, 580 aa] {ON}
           YMR282C (REAL)
          Length = 580

 Score =  110 bits (276), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 102/384 (26%), Positives = 181/384 (47%), Gaps = 45/384 (11%)

Query: 182 HSELIFKVYQIYIERIEHPILNSNNNSHIQSIAEHSSTPLNPIQLYDLNKVITWFIKAGQ 241
           +SE  FK++ +Y E+++            +      +T L+  +++DLN +I  FI+ GQ
Sbjct: 166 YSEFWFKLFSLYAEKVDTR----------RDQVNLRNTALDSCEIFDLNLLIKNFIELGQ 215

Query: 242 LKKATTALMYILKRYNAEIFQIP---DSKTIINFLKLYCGGLPTNWRIEPINHRFIKNQG 298
           L KA   L +IL R N +I   P   D  TI++FL+L CG L   W+I P N    +NQ 
Sbjct: 216 LSKAQKILSFILDR-NPDILLSPRNADIGTIVHFLQLRCGALTAYWKI-PDNSGRKQNQL 273

Query: 299 KRSFKLGNNSSYYRLPSSYKAVYEKVPIQIVEHIKKNTNDMKLSGKLFHFIRTGEFDSTL 358
           +R  +LG  ++  RL S+YKA+  +  ++I         D+ L  K   F+ + +  STL
Sbjct: 274 RRMVRLGAKNTSIRLSSTYKAMDHQTLLKIA--------DLVLQDK--RFLNSEDLLSTL 323

Query: 359 IYSLTSLGRFDLAEQYFKDNWLSDSCD---DVEL-------TSDIVIAIFSSYVYNNSNN 408
           I S   LG+  + E+  +  W   S +    V +       +S I+I+I  S+ + N  +
Sbjct: 324 IQSFGHLGQTQILERCIEHIWQISSQEFPSHVAIKPRGCYPSSKILISILVSF-HLNDKD 382

Query: 409 IEKANKLIQEIIKRYPDLHLNISTWCRIIRWNIQMWDTTTDFNGEIPYDSFYTMLTYYSN 468
           + +   ++   IK YP++ L+   W R+++ +   W    D         ++ M  +Y +
Sbjct: 383 LHRGLSILDSFIKHYPEVKLDALFWRRLLQLSHFAWTPVNDKRAASIVKCWHLMKHWYES 442

Query: 469 YCSRNSTFKSCHIPYNKMLLGDLYHLFNTKISLNKCLFIMDNCFKKSLFKTPSKVTTKDY 528
                   K      +   L  LY +     + +  + ++ + FK  + K  +    K  
Sbjct: 443 --------KELSPSVDYETLRQLYEVMKKTGNFSLGIDVLKS-FKSGIEKMRTANPEKLE 493

Query: 529 QILLKYQKMILKYLINDRKLTSNK 552
            IL+KYQK I+K L+N  K+++ +
Sbjct: 494 AILIKYQKCIIKQLVNRGKISAAR 517

>YMR282C Chr13 complement(833356..835098) [1743 bp, 580 aa] {ON}
           AEP2Mitochondrial protein, likely involved in
           translation of the mitochondrial OLI1 mRNA; exhibits
           genetic interaction with the OLI1 mRNA 5'-untranslated
           leader
          Length = 580

 Score =  107 bits (267), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 112/440 (25%), Positives = 205/440 (46%), Gaps = 48/440 (10%)

Query: 137 YLDAKALNKLVNKHLNDMNLSIVINLLVKYNHFQPKDSDRLSFKSHSELIFKVYQIYIER 196
           YL AK ++      L+  +LS +++ L     FQ +   R     +SE  FK++ +Y E+
Sbjct: 122 YLFAKTVDPEPKDVLSLEDLSFLLSKLYT-QRFQIRRICRDINAKYSEFWFKLFSLYAEK 180

Query: 197 IEHPILNSNNNSHIQSIAEHSSTPLNPIQLYDLNKVITWFIKAGQLKKATTALMYILKRY 256
           ++       N  ++++      T L+  +++D N +I  FI+ GQL KA   L +IL R 
Sbjct: 181 VD----AKRNQVNLRN------TKLDACEIFDANLMIKNFIELGQLGKAQKILSFILDR- 229

Query: 257 NAEIFQIP---DSKTIINFLKLYCGGLPTNWRIEPINHRFIKNQGKRSFKLGNNSSYYRL 313
           N +I   P   D  TI++FL+L CG L   W+I P N    +   ++  +LG  ++  RL
Sbjct: 230 NPDILLSPKNADISTIVHFLQLRCGALAPYWKI-PDNSEQKQGFLRKMVRLGAKNTSIRL 288

Query: 314 PSSYKAVYEKVPIQIVEHIKKNTNDMKLSGKLFHFIRTGEFDSTLIYSLTSLGRFDLAEQ 373
            S+YKA+  +  ++I         D+ L  K    + + +  STLI S   LG+  + E+
Sbjct: 289 SSTYKAMDHQTLLKIA--------DLALQEK--KLLNSEDLLSTLIQSFGHLGQTQILER 338

Query: 374 YFKDNWLSDSCD----------DVELTSDIVIAIFSSYVYNNSNNIEKANKLIQEIIKRY 423
             +  W     +              +S I+++I  S+ Y N +++ +   ++   IK Y
Sbjct: 339 CIEHIWQISPQEFPSHVVIKHRGCYPSSKILVSILVSF-YFNDHDLHRGLSILDSFIKHY 397

Query: 424 PDLHLNISTWCRIIRWNIQMWDTTTDFNGEIPYDSFYTMLTYYSNYCSRNSTFKSCHIPY 483
           PD+ L+   W R+ + +   W    D         ++ M  +Y++   R S      + Y
Sbjct: 398 PDVKLDALFWRRLFQLSHFAWTPANDKKATSVVRCWHLMKQWYASKRLRPS------VDY 451

Query: 484 NKMLLGDLYHLFNTKISLNKCLFIMDNCFKKSLFKTPSKVTTKDYQILLKYQKMILKYLI 543
               L  LY +     +    + ++ + FK  + +T ++   K   I++KYQK I+K L+
Sbjct: 452 ET--LRQLYDIMKKTGNFPLGIDVLRS-FKPGIERTRAENAGKVNNIIIKYQKCIIKELV 508

Query: 544 NDRKLTSNKPLDFIEKYSLD 563
           N  + ++ +  +FI+ Y  D
Sbjct: 509 NRGRFSAVR--EFIDSYGFD 526

>Suva_13.471 Chr13 complement(816054..817799) [1746 bp, 581 aa] {ON}
           YMR282C (REAL)
          Length = 581

 Score =  107 bits (267), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 111/442 (25%), Positives = 207/442 (46%), Gaps = 52/442 (11%)

Query: 137 YLDAKALNKLVNKHLNDMNLSIVINLLVKYNHFQPKDSDRLSFKSHSELIFKVYQIYIER 196
           YL  KA+N    + L+  +LS ++N L     F+ K   +     +SE  FK++ +Y E+
Sbjct: 123 YLFVKAINSEARETLSLEDLSFLLNNLYS-QRFEIKKICKDINVRYSEFWFKLFSLYAEK 181

Query: 197 IEHPILNSNNNSHIQSIAEHSSTPLNPIQLYDLNKVITWFIKAGQLKKATTALMYILKRY 256
           ++       N  ++++ A  SS      +++D+N +I  FI+ GQL KA   L +IL R 
Sbjct: 182 VD----VKRNQINLRNTALDSS------EIFDMNLIIKNFIELGQLGKAQKVLSFILDR- 230

Query: 257 NAEIFQIP---DSKTIINFLKLYCGGLPTNWRIEPINHRFIKNQGKRSFKLGNNSSYYRL 313
           N++I   P   D  TII+FL+L CG L   W++ P N    +   ++  +LG  ++  R+
Sbjct: 231 NSDILLSPKNADIGTIIHFLQLRCGALAAYWKM-PDNSE--QKYSRKMVRLGAKNTSIRI 287

Query: 314 PSSYKAVYEKVPIQIVEHIKKNTNDMKLSGKLFHFIRTGEFDSTLIYSLTSLGRFDLAEQ 373
            SSYKA+  +  ++I + + +              + + +  STLI S   LG+  + E+
Sbjct: 288 TSSYKAMDHQTLLKIADLVLQKE----------RLLNSEDLLSTLIQSFGHLGQTQILER 337

Query: 374 YFKDNW------------LSDSCDDVELTSDIVIAIFSSYVYNNSNNIEKANKLIQEIIK 421
             +  W            +         +S I+I+I  S+ + N N++ +   ++   IK
Sbjct: 338 CIEHIWQISLQEFPSHATIKPKTRGCCPSSKILISILVSF-HLNDNDLHRGLSILDSFIK 396

Query: 422 RYPDLHLNISTWCRIIRWNIQMWDTTTDFNGEIPYDSFYTMLTYYSNYCSRNSTFKSCHI 481
            YP++ ++   W R+ + +   W  T D         ++ M  ++ +        K   +
Sbjct: 397 HYPEVKVDELFWRRLFQLSHFAWTPTHDKRATSIVRCWHLMKQWHES--------KGFSL 448

Query: 482 PYNKMLLGDLYHLFNTKISLNKCLFIMDNCFKKSLFKTPSKVTTKDYQILLKYQKMILKY 541
             +   L  LY L     + +  + ++ N FK  + +T +  T K   I++K+QK I+K 
Sbjct: 449 SVDYETLRQLYDLTKKTGNYSLGIDVLQN-FKPGITRTSAMKTEKINGIVIKHQKYIIKQ 507

Query: 542 LINDRKLTSNKPLDFIEKYSLD 563
           L+N  K ++ +  +FI  +S D
Sbjct: 508 LVNRGKTSAAR--EFINDFSFD 527

>Smik_13.495 Chr13 complement(816375..818105) [1731 bp, 576 aa] {ON}
           YMR282C (REAL)
          Length = 576

 Score =  103 bits (258), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 108/440 (24%), Positives = 202/440 (45%), Gaps = 48/440 (10%)

Query: 137 YLDAKALNKLVNKHLNDMNLSIVINLLVKYNHFQPKDSDRLSFKSHSELIFKVYQIYIER 196
           YL  K ++      L+   LS ++N L     FQ +   R     +SE  FK++ +Y E+
Sbjct: 118 YLFTKTVDSGPRNSLSLAELSFLLNKLYSL-RFQIRGICRDIKVKYSEFWFKIFSLYAEK 176

Query: 197 IEHPILNSNNNSHIQSIAEHSSTPLNPIQLYDLNKVITWFIKAGQLKKATTALMYILKRY 256
           ++         +HI       +T L+  +++D+N +I  FI+ GQL KA   L +I+ R 
Sbjct: 177 VD------AKRNHINL----RNTTLDACEIFDINLLIRNFIELGQLGKAQKILTFIIDR- 225

Query: 257 NAEIFQIP---DSKTIINFLKLYCGGLPTNWRIEPINHRFIKNQGKRSFKLGNNSSYYRL 313
           N +I   P   D  T+++FLKL CG L   W+I P N    + Q ++  +LG  ++  RL
Sbjct: 226 NPDILLSPNNADIGTMVHFLKLRCGALAAYWKI-PDNSGQDQKQLRKIVRLGAKNTSIRL 284

Query: 314 PSSYKAVYEKVPIQIVEHIKKNTNDMKLSGKLFHFIRTGEFDSTLIYSLTSLGRFDLAEQ 373
            S+YK +  +  ++I         D+ L  K   F+ + +  STLI S   LG+  + E+
Sbjct: 285 SSTYKVMDHQTLLKIA--------DLVLHEK--RFLNSEDLLSTLIQSFGHLGQTQILER 334

Query: 374 YFKDNW----------LSDSCDDVELTSDIVIAIFSSYVYNNSNNIEKANKLIQEIIKRY 423
             +  W          ++        +S I+I+I  S+ YN+ N++ +   ++   IK Y
Sbjct: 335 CIEHIWHITTQEFPSHVAIKPRGCYPSSKILISILVSFHYND-NDLHRGLSILDSFIKHY 393

Query: 424 PDLHLNISTWCRIIRWNIQMWDTTTDFNGEIPYDSFYTMLTYYSNYCSRNSTFKSCHIPY 483
           P++ L+   W R+ + +   W    D         ++ M  ++ +        K   +  
Sbjct: 394 PEVKLDALFWRRLFQLSNFAWTPAKDKKATSVIRCWHLMKQWHVS--------KGLSLSV 445

Query: 484 NKMLLGDLYHLFNTKISLNKCLFIMDNCFKKSLFKTPSKVTTKDYQILLKYQKMILKYLI 543
           +   L  LY +     +    + ++ + FK  + +     + K   +L+KYQK I+K L+
Sbjct: 446 DYETLRQLYDIMKKTGNFPLGIDVLKS-FKSGIERLRETNSDKLNIVLIKYQKYIIKQLV 504

Query: 544 NDRKLTSNKPLDFIEKYSLD 563
           +  ++++ +  +FI  +  D
Sbjct: 505 DRGRISAVR--EFINDFGFD 522

>Ecym_4618 Chr4 complement(1210600..1212183) [1584 bp, 527 aa] {ON}
           similar to Ashbya gossypii ABL119C
          Length = 527

 Score =  102 bits (255), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 93/399 (23%), Positives = 174/399 (43%), Gaps = 50/399 (12%)

Query: 187 FKVYQIYIERIEHPILNSNNNSHIQSIAEHSSTPLNPIQLYDLNKVITWFIKAGQLKKAT 246
           F + +   E +  P+ N     ++  +     T   P++L+DLNK   WF+   +LK A 
Sbjct: 117 FSLKEAIPENMVVPLANKLYQFYMAILEREKKTRFTPMELHDLNKFSNWFLNENKLKLAR 176

Query: 247 TALMYILKRYNAEIFQIP-DSKTIINFLKLYCGGLPTNWRIEPINHRFIKNQGKRSFKLG 305
             L  IL++  +E  Q+P D +T++ + +LY G L + W    +       Q     KL 
Sbjct: 177 KVLQQILRQTGSE--QLPRDHQTLVTYFQLYLGSLASLWPTPKV-------QSACYDKLV 227

Query: 306 NNSSYYRLPS--SYKAVYEKVPIQIVEHIKKNTNDMKLSGKLFHFIRTGEFDSTLIYSLT 363
             S   R P    Y ++ E +   +++ + +N +        +  +R+ E D+ ++YSL 
Sbjct: 228 RGS---RRPKYVVYNSLPEGIMYDVLQKLLENDD--------WKHLRSSELDAKILYSLC 276

Query: 364 SLGRFDLAEQYFKDNW-LSDSCDDVEL------------TSDIVIAIFSSYVYNNSNNIE 410
              R DL E + +  W + D    VE              S+++IAI +S+ Y   N++E
Sbjct: 277 HYNRMDLFEGFMERAWGIVDHPKKVEKEVPVDISSGTYPGSEVLIAIVTSFSYR--NDLE 334

Query: 411 KANKLIQEIIKRYPDLHLNISTWCRIIRWNIQMWDTTTDFNGEIPYDSFYTMLTYYSNYC 470
           KA +L+   + +YP + L    W ++  W   M+D   D  G +    +  ML++Y    
Sbjct: 335 KAVRLVDAFLNKYPQMDLRTEFWEKLFLWTRVMFDRKLDPLGSLQKACWLRMLSWYK--- 391

Query: 471 SRNSTFKSCHIPYNKMLLGDLYHLFNTKISLNKCLFIMDNCFKKSLFKTPSKVTTKDYQI 530
           SR  +     +PY+  L    Y +     +    + +  +    S     S     +  +
Sbjct: 392 SRGES-----VPYSSYLASCRYEILKQTSNYKDAMAMFPDYM--SAVYAKSAAAKHNLTV 444

Query: 531 LLKYQKMILKYLINDRKLTSNKPLDFIEKYSLDTNNKEQ 569
           + KYQK +++ L    K   +    FIE++  +  N+++
Sbjct: 445 VRKYQKFVIRELSARGK--RDACTQFIEQWRFNEENEKE 481

>KLLA0D01408g Chr4 (120712..122268) [1557 bp, 518 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 518

 Score = 98.2 bits (243), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 92/358 (25%), Positives = 162/358 (45%), Gaps = 38/358 (10%)

Query: 222 NPIQLYDLNKVITWFIKAGQLKKATTALMYILKRYNAEIFQIP-DSKTIINFLKLYCGGL 280
           N + LYDLN+ +  FI    L  A      ILK  N++  +IP D +TI  +L+LYCG L
Sbjct: 145 NAMVLYDLNQFVRMFINLNDLPLARNVFQLILK--NSKNGEIPKDVQTICMYLRLYCGAL 202

Query: 281 PTNWRIEPINHRFIKNQGKRSFKLGNNSSYYRLPSSYKAVYEKVPIQIVEHIKKNTNDMK 340
              W  +   + +    G  S   G+N+S  R+PS        VP Q    ++K   D +
Sbjct: 203 SELWTTQTSRNFYQDLIGSLS---GSNASSIRIPSHIAYPTIGVP-QFQLLLRKLVEDPE 258

Query: 341 LSGKLFHFIRTGEFDSTLIYSLTSLGRFDLAEQYFKDNWLSDSCDDVELT---------- 390
            S      +R  E DS +I +L         +QY    +  D  ++V +T          
Sbjct: 259 YSK-----LRNTEMDSLIIQALGHYKEVPFLKQYISIFYGID--ENVTITETHPGIKKLT 311

Query: 391 --SDIVIAIFSSYVYNNSNNIEKANKLIQEIIKRYPDLHLNISTWCRIIRWNIQMWDTTT 448
             S ++ ++ S+Y +NN  NI     +I   +++YP+++L+ S W   I W+++ W+   
Sbjct: 312 PDSQLLKSVISAYGHNN--NITSGMTVIGSFMEKYPEMNLDKSFWRTTIYWSLREWNKYK 369

Query: 449 DFNGEIPYDSFYTMLTYYSNYCSRNSTFKSCHIPYNKMLLGDLYHLFNTKISLNKCLFIM 508
           D  G  P  ++  ML +Y+             +P+++ ++        ++   N  +  +
Sbjct: 370 DSKGSQPKKAWNLMLNWYATIGK--------AVPFDQKIMLYRLSFLKSRKDHNAAIRDV 421

Query: 509 DNCFKKSLFKTPSKVTTKDYQILLKYQKMILKYLINDRKLTSNKPLDFIEKYSLDTNN 566
              FK+   KT       +  +L  YQ+ I+K L+N  +  + K +DFI ++ +D  N
Sbjct: 422 QQVFKRIFIKTEKNTFIVERLVLYAYQRFIIKNLVNQNE--NAKCVDFINEWRIDFEN 477

>KAFR0B03970 Chr2 complement(830202..831626) [1425 bp, 474 aa] {ON}
           Anc_8.847 YMR282C
          Length = 474

 Score = 86.7 bits (213), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 105/443 (23%), Positives = 179/443 (40%), Gaps = 90/443 (20%)

Query: 138 LDAKALNKLVNKH----LNDMNLSIVINLLVKYNHFQPKDSDRLSFKSHSELIFKVYQIY 193
           LDA+    + + H    LN     I I L  KYN  + K+          E+IF++++ Y
Sbjct: 71  LDAEIQEIITSMHATIDLNRFARLINIALSEKYNIQRIKER-------RPEIIFQLFETY 123

Query: 194 IERIEHPILNSNNNSHIQSIAEHSSTPLNPIQLYDLNKVITWFIKAGQLKKATTALMYIL 253
           ++ I                   S   L  +Q+ D+NK I +F++  QLKKA   + Y++
Sbjct: 124 VKLIS------------------SHEELTILQVEDMNKFINYFVEFKQLKKAQLVMKYLI 165

Query: 254 KRYNAEIFQIPDSKTIINFLKLYCGGLPTNWRIEPINHRFIKNQGKRSFKLGNNSSYYRL 313
            + +  + +  D  T  N+LKL CG     W     N++         F   N +     
Sbjct: 166 LK-SPRVLEKYDVSTTRNYLKLNCGACHELW---YTNYKI--------FDFNNTT----- 208

Query: 314 PSSYKAVYEKVPIQIVEHIKKNTNDMKLSGKLFHFIRTGEFDSTLIYSLTSLGRFDLAEQ 373
                          ++ + K + D K+          G +D  +I+SL   GR    E 
Sbjct: 209 ---------------LDKLVKYSLDNKI----------GYWDVEIIHSLGYSGRIRSLED 243

Query: 374 YFKDNWLSDSCDDVEL-------TSDIVIAIFSSYVYNNSNNIEKANKLIQEIIKRYPDL 426
           Y    W    CD  ++        S+++ AI + + Y +   + +A K++ E +  YPDL
Sbjct: 244 YILKKWGISLCDRAQVNTTNEAPESEVLEAIINGFFYRDKR-MFRAIKILNEFVNVYPDL 302

Query: 427 HLNISTWCRIIRWNIQMWDTTTDFNGEIPYDSFYTMLTYYSNYCSRNSTFKSCHIPYNKM 486
           +L I+ W   +   I+ WD   D  G +  + + TM  +Y+ +  R        IP+N  
Sbjct: 303 NLKITFWKTFMNNCIKEWDEKVDQKGVVIVEYWETMKRWYTVHNRR--------IPFNIN 354

Query: 487 LLGDLYHLFNTKISLNKCLFIMDNCFKKSLFKTPSKVTTKDYQILLKYQKMILKYLINDR 546
            L  +   F    +L     I  NCF    F   +++   +  ++ +YQ  IL  LI  +
Sbjct: 355 FLKVMRTCFKKNNNLVLATDIFQNCFHNFYF-CATRMNDSELNVIKEYQNFILSRLIEKK 413

Query: 547 KLTSNKPLDFIEKYSLDTNNKEQ 569
             ++   L FI  +     NK Q
Sbjct: 414 GFSN--ALTFINDHCFSLENKRQ 434

>CAGL0M03069g Chr13 complement(347584..349230) [1647 bp, 548 aa]
           {ON} weakly similar to uniprot|P22136 Saccharomyces
           cerevisiae YMR282c AEP2 required for the expression of
           subunit-9 of atp synthase
          Length = 548

 Score = 79.3 bits (194), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 99/374 (26%), Positives = 170/374 (45%), Gaps = 47/374 (12%)

Query: 216 HSSTPLNPIQLYDLNKVITWFIKAGQLKKATTALMYILKRY--NAEIFQIP--DSKTIIN 271
           H+   ++ +   D+NK I  FI+  QLK+A TAL ++L  Y    E    P  D +TI +
Sbjct: 157 HNGGSVDALNKDDMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGEDLLGPYGDKQTIAH 216

Query: 272 FLKLYCGGLPTNWRIEPINHRFIKNQGKRSF-KLGNNSSYYRLPSSYKAVYEKVPIQIVE 330
           FL L  G L   W+I+  N     N  K++F K+  N S+  + S+Y  +      +IV 
Sbjct: 217 FLMLRSGALQDLWKIDVSN----GNNKKQAFYKI--NGSHRNVKSTYNVLDSVKLFEIVR 270

Query: 331 HIKKNTNDMKLSGKLFHFIRTGEFDSTL----IYSLTSLGRFDLAEQYFKDNWLSDSCD- 385
           +I +  +    S  ++       FD  +    I  L  +G+  L E      W  DS   
Sbjct: 271 YILRYNDKDNHSQPVY-------FDEGILKNVILCLGYVGQTTLIEDIINKIWELDSVSV 323

Query: 386 ----DVELTSDIVIAIFSSYVYNNSNNIEKANKLIQEIIKRYPDLHLNISTWCRIIRWNI 441
               ++ +TSD++ AI S+Y      +I+    +  +   + P++ +    W  + +WNI
Sbjct: 324 PPKYNITVTSDLLTAIVSAYS-KCGKSIQPGLVIADKFFGKIPNIIVKDDFWINLQKWNI 382

Query: 442 QM---WDTTTDFNGEIPYDSFYTMLTYYSNYCSRNSTFKSCHIPYNKMLLGDLYHLFNTK 498
            +   W +T D +      ++  M ++      RNST     I  N   L  +Y + ++ 
Sbjct: 383 ILPNKWRSTIDLSKR----TWELMKSW------RNSTNNGGFITANVEFLNLVYKVLSSD 432

Query: 499 -ISLNKCLFIMDNCFKKSLFKTPSK--VTTKDYQILLKYQKMILKYLINDRKLTSNKPLD 555
            I L    +I D  F+ SL    SK  +T  + ++L K+Q   +K ++     +  K L 
Sbjct: 433 YIKLKDLEWIYD-IFQHSLVTLYSKNSLTVDEIKLLKKFQIFTIKKMVYFGHYS--KCLQ 489

Query: 556 FIEKYSLDTNNKEQ 569
           FI+++S D  NK+Q
Sbjct: 490 FIKEWSYDAANKQQ 503

>NCAS0C00370 Chr3 (54433..55920) [1488 bp, 495 aa] {ON} Anc_8.847
           YMR282C
          Length = 495

 Score = 73.6 bits (179), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 62/232 (26%), Positives = 110/232 (47%), Gaps = 35/232 (15%)

Query: 217 SSTPLNPIQLYDLNKVITWFIKAGQLKKATTALMYILKRYNA--EIFQIPDSKTIINFLK 274
               LN +Q+YDLNK+I +FIK  QLK+    L +I+ +Y     +    D  ++ N LK
Sbjct: 138 GEGSLNALQIYDLNKLIKYFIKRDQLKQGQIVLDFIIMKYGGIENMIAHRDLISLNNHLK 197

Query: 275 LYCGGLPTNWRIEPINHRFIKN-QGKRSFKLGNNSSYYRLPSSYKAVYEKVPIQIVEHIK 333
           L  G L  +W+ E  N R++++ QG+ ++K  +  S  ++                    
Sbjct: 198 LKNGSLVKDWKFEGKNLRYLQSRQGRLNYKFLDGWSLLKIADLV---------------- 241

Query: 334 KNTND-MKLSGKLFHFIRTGEFDSTLIYSLTSLGRFDLAEQYFKDNWLSDSCDDVELT-- 390
              ND MK    L          +++IYSL  L + +L + +    W+ ++     L   
Sbjct: 242 --LNDPMKCQNVL---------TNSIIYSLGHLRQVELLDHFIDQMWMQETRPRNGLLYP 290

Query: 391 -SDIVIAIFSSYVYNNSNNIEKANKLIQEIIKRYPDLHLNISTWCRIIRWNI 441
            ++ +IAI +SY Y N  N++K+  ++  I+++Y  L  +   W R+ +W I
Sbjct: 291 DTNNIIAIITSYCY-NYGNMDKSFDVLDRILEKYSGLKFDKFFWRRLFQWCI 341

>NDAI0K00340 Chr11 complement(64928..66802) [1875 bp, 624 aa] {ON}
           Anc_8.847 YMR282C
          Length = 624

 Score = 73.6 bits (179), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 67/246 (27%), Positives = 121/246 (49%), Gaps = 32/246 (13%)

Query: 218 STPLNPIQLYDLNKVITWFIKAGQLKKATTALMYILKRYNA--EIFQIPDSKTIINFLKL 275
           +  LNP+ +YDLN+ I +F++ GQLKKA   L YI+ R+    ++ +  D  T+ N LKL
Sbjct: 211 TNQLNPLMVYDLNQFIKYFLREGQLKKAQLVLDYIIDRFGGIEQLIKSKDLTTLDNHLKL 270

Query: 276 YCGGLPTNWRIEPINHRFIKNQGKRSFKLGNNSSYYRLPSSYKAVYEKVPIQIVEHIKKN 335
             G +  NW+  P+         +    L + S  ++   +YK +     ++I+      
Sbjct: 271 KNGAIYKNWK--PLTDSESNTFLQYRLSLEDKSHNFKGFKNYKFLDGWSLLKII------ 322

Query: 336 TNDMKLSGKLFHFIRTGEFDSTLIYSLTSLGRFDLAEQYFKDNWLSDSCDDVE------- 388
             DM L+ K  H +     + +++YSL +L + +  E + K  W     D VE       
Sbjct: 323 --DMVLTDKT-HCLNI--LNESILYSLGTLRQIEFMEHFIKQIWDVHPDDAVEERNHQLD 377

Query: 389 ---LTSDI--VIAIFSSYVYNNSNNIEKANKLIQEIIKRYPD---LHLNIST-WCRIIRW 439
              L  D   +IAI +SY      ++++A  L+ ++I++YP+     LN +  W ++++W
Sbjct: 378 KYNLPPDTNELIAILTSYC-QTYKSMDRAFLLLDKLIQKYPEPMKSRLNDNKFWIKMLQW 436

Query: 440 NIQMWD 445
            I++ D
Sbjct: 437 GIKIAD 442

>KNAG0J00230 Chr10 (30660..32084) [1425 bp, 474 aa] {ON} Anc_8.847
           YMR282C
          Length = 474

 Score = 57.0 bits (136), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 80/367 (21%), Positives = 151/367 (41%), Gaps = 76/367 (20%)

Query: 218 STPLNPIQLYDLNKVITWFIKAGQLKKATTALMYILKR-YNAEIFQIPDSKTIINFLKLY 276
           S  L  IQL+D N +  +FI   QLKKA   + ++L++    ++F I       N+ KL 
Sbjct: 130 SNKLTQIQLHDFNLMCDYFIACNQLKKAQLIMDFLLQQDVKFDVFMIK------NYTKLR 183

Query: 277 CGGLPTNWRIEPINHRFIKNQGKRSFKLGNNSSYYRLPSSYKAVYEKVPIQIVEHIKKNT 336
           CG                 + GK++    NN +Y       K   +    Q++  ++   
Sbjct: 184 CGS----------------SFGKQTL---NNKAY-------KVFDQNTVFQLIGKVE--- 214

Query: 337 NDMKLSGKLFHFIRTGEFDSTLIYSLTSLGRFDLAEQYFKDNWL----SDSCDDVEL--- 389
                + + F F     +++ ++ SL       L E Y  D W       S +++++   
Sbjct: 215 -----ADRKFAF-----WNNEIVSSLGYTNNITLMEIYIWDLWRISIHDHSTENIKIDHL 264

Query: 390 --------TSDIVIAIFSSYVYNNSNNIEKANKLIQEIIKRYPDLHLNISTWCRIIRWNI 441
                   +S ++  I SSY  ++   +++A  +++   K YP L LN+  W  ++   I
Sbjct: 265 QQGDAMYPSSKVLATIVSSYARHD-QTMKRAVDIVERFAKSYPKLLLNVHFWSTLLNCAI 323

Query: 442 QMWDTTTDFNGEIPYDSFYTMLTYYSNYCSRNSTFKSCHIPYNKMLLGDLYHLFNTKISL 501
           +         G      F         + ++ S      +P+   LL  +        +L
Sbjct: 324 KC-------GGSKDPSQFLACWNLMKKWHTQRSKL----MPFQSALLVTILRYMRQTSNL 372

Query: 502 NKCLFIMDNCFKKSLFKTPSKVTTKDYQILLKYQKMILKYLINDRKLTSNKPLDFIEKYS 561
           +  + I+   +   L+     +   +  +L+KYQK IL+ L++ RK   N    FI+++S
Sbjct: 373 HGTVDIL-QYWLGPLYLKRGNIPEFERDVLIKYQKQILRKLVDKRKY--NWCTAFIDQWS 429

Query: 562 LDTNNKE 568
           +D +NKE
Sbjct: 430 IDASNKE 436

>ABL119C Chr2 complement(175840..177453) [1614 bp, 537 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR282C
           (AEP2)
          Length = 537

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 70/354 (19%), Positives = 154/354 (43%), Gaps = 41/354 (11%)

Query: 222 NPIQLYDLNKVITWFIKAGQLKKATTALMYILKRYNAEIFQIP-DSKTIINFLKLYCGGL 280
           +P +L+D N    WF+   +L+ A T    ++     E+ ++P D++TII  L+L+ G  
Sbjct: 183 SPGRLHDANSFARWFMAESKLRLARTVFAELVGN-PTELAKLPRDTETIITLLQLHLGAK 241

Query: 281 PTNWRIEPINHRFIKNQGKRSFKLGNNSSYYRLPSSYKAVYEKVPIQIVEHIKKNTNDMK 340
              WR +P N      +G + F      ++  + ++Y ++ E+  ++++  ++ +     
Sbjct: 242 HIFWR-DPGNS---VGRGGQLF----TPAHMAVVTAYNSLGEETLLRLLRLLQSDPQ--- 290

Query: 341 LSGKLFHFIRTGEFDSTLIYSLTSLGRFDLAE----QYFKDNWLSDSCDDVELTSD--IV 394
                +  + + + D  +I +L    R DL      +Y+             L  D  +V
Sbjct: 291 -----WKSVCSPDLDRNIILALAFHNRLDLVHAQAARYYAPAAPGHGLPSTPLLPDGALV 345

Query: 395 IAIFSSYVYNNSNNIEKANKLIQEIIKRYPDLHLNISTWCRIIRWNIQMWDTTTDFNGEI 454
            A+ +++ +   + + +   +  + + R+  L      W  I  W  +   T +   G  
Sbjct: 346 GAVVTAFAFK--HQLAQGLAIAYQFLDRFTHLPNEHELWKIIFTWLARRHPTGS--QGAA 401

Query: 455 PYDSFYT-MLTYYSNYCSRNSTFKSCHIPYNKMLLGDLYHLFNTKISLNKCLFIMDNCFK 513
            YD  ++ M T Y+ +            PY+  +    Y +     SL +   ++ N + 
Sbjct: 402 LYDEAWSKMRTRYAEHGQPT--------PYDYSIARASYRIVRRDSSLRRVRALL-NDYM 452

Query: 514 KSLFKTPSKVTTKDYQILLKYQKMILKYLINDRKLTSNKPLDFIEKYSLDTNNK 567
             L++ P+ V  +D  +LLK Q  I+  L+  R+  ++   DF+++++LD+  +
Sbjct: 453 SPLYQQPA-VAPRDRLLLLKCQAHIVGRLVRARR--NSAAADFVDQWALDSEAR 503

>TPHA0G00800 Chr7 complement(148640..150274) [1635 bp, 544 aa] {ON}
           Anc_2.300 YNL029C
          Length = 544

 Score = 34.7 bits (78), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 23/47 (48%)

Query: 280 LPTNWRIEPINHRFIKNQGKRSFKLGNNSSYYRLPSSYKAVYEKVPI 326
            P N R  P    F++NQG R    GN  SY+++   Y   + + P+
Sbjct: 154 FPENIRNSPAFENFLQNQGDRGILYGNQESYHKMCRFYSGFFYRHPL 200

>NCAS0A15300 Chr1 (3006855..3011051) [4197 bp, 1398 aa] {ON} 
          Length = 1398

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 51/122 (41%), Gaps = 17/122 (13%)

Query: 308 SSYYRLPSSYKAV--YEKVPIQIVEHIKKNTNDMKLSGKLFHFIRTGEFDSTLI--YSLT 363
           S YY     Y+A   Y K  I +V H  ++     L  +L H  R  EF  TL   Y+  
Sbjct: 395 SQYYIFSKEYEAALPYIKKGISLVSHKIRD-----LGCQLIHTKR--EFSLTLATCYTYV 447

Query: 364 SLGRFDLAEQYFKDNWLSDSCDDVELTSDIVIAIFSSYVYNNSNNIEKANKLIQEIIKRY 423
              +F  A     D  L +S D+          +    +Y    N + ANKL++E+I  Y
Sbjct: 448 DAPQFHNAAMTLFDRILQESPDNTR------AKMGKGIIYIERENWQDANKLLKEVINEY 501

Query: 424 PD 425
           PD
Sbjct: 502 PD 503

>NCAS0G03720 Chr7 complement(686579..688162) [1584 bp, 527 aa] {ON}
           Anc_2.300
          Length = 527

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 21/39 (53%)

Query: 288 PINHRFIKNQGKRSFKLGNNSSYYRLPSSYKAVYEKVPI 326
           P   +FI +QG R    GN  SY+R+   Y  ++ K P+
Sbjct: 167 PEFQQFIHDQGDRGILYGNMESYHRMCRFYSGIFYKHPL 205

>YDR499W Chr4 (1447830..1450073) [2244 bp, 747 aa] {ON}
           LCD1Essential protein required for the DNA integrity
           checkpoint pathways; interacts physically with Mec1p;
           putative homolog of S. pombe Rad26 and human ATRIP
          Length = 747

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 45/87 (51%), Gaps = 6/87 (6%)

Query: 127 KFVDELIQWHYLDAKALNKLVNKHLNDMNLSI--VINLLVKYNHFQPKDSDRLSFKSHSE 184
           +F+D L++    D   L K ++ H N+  L++  ++ L+ +   F+P  +  L+ K    
Sbjct: 269 RFIDTLLE----DIAVLIKEISVHPNESKLAVPFLVALMYQIVQFRPSATHNLALKDCFL 324

Query: 185 LIFKVYQIYIERIEHPILNSNNNSHIQ 211
            I  + +IY   ++ PI  SN N H++
Sbjct: 325 FICDLIRIYHHVLKVPIHESNMNLHVE 351

>TBLA0B01940 Chr2 (445353..448736) [3384 bp, 1127 aa] {ON} Anc_1.519
           YKL205W
          Length = 1127

 Score = 32.0 bits (71), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 17/73 (23%), Positives = 35/73 (47%), Gaps = 1/73 (1%)

Query: 488 LGDLYHLFNTKISLNKCLFIMDNCFKKSLFKTPSKVTTKDYQILLKYQKMILKYLINDRK 547
           L + +    + + +  C+ I+D C + S  +     TT D QI+ +   ++L ++ ND  
Sbjct: 325 LNETFSKLASSVGIEFCI-IIDQCNENSSLEGQQIATTADQQIIEQVAPLVLNFMNNDYD 383

Query: 548 LTSNKPLDFIEKY 560
             + +   FI +Y
Sbjct: 384 SVTEQTFSFINQY 396

>NCAS0I01280 Chr9 complement(230866..232716) [1851 bp, 616 aa] {ON}
           Anc_3.329 YPR048W
          Length = 616

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 6/66 (9%)

Query: 5   SYKQCIRSPYYNCNKNNYLKSISNPNDSFLVTNIPW--TVNYTPSSLILSKCYSTNISAN 62
           +Y Q ++  Y  CN+    +SI    D FL   +PW   ++Y P  LI  + YS +   N
Sbjct: 360 AYDQDMQELYDYCNRPR--RSILEVMDDFLSVRLPWKYMLDYLP--LIKPRYYSISSGPN 415

Query: 63  IPNFDI 68
            PN ++
Sbjct: 416 DPNIEL 421

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 70,100,702
Number of extensions: 3356602
Number of successful extensions: 12369
Number of sequences better than 10.0: 61
Number of HSP's gapped: 12668
Number of HSP's successfully gapped: 64
Length of query: 613
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 497
Effective length of database: 40,180,143
Effective search space: 19969531071
Effective search space used: 19969531071
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)