Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0B033008.846ON31931916440.0
Kpol_1068.48.846ON2913115312e-65
TDEL0B005208.846ON2683195065e-62
NDAI0K003308.846ON3133365053e-61
ZYRO0G14300g8.846ON2803184946e-60
TPHA0I002808.846ON3013184931e-59
KAFR0B039608.846ON2783114842e-58
YMR281W (GPI12)8.846ON3043284741e-56
CAGL0M03047g8.846ON3043124565e-54
Suva_13.4708.846ON3033184488e-53
Skud_13.4538.846ON3003274452e-52
Smik_13.4948.846ON3043334452e-52
KNAG0J002408.846ON2863204432e-52
NCAS0C003808.846ON2762634171e-48
KLTH0C03740g8.846ON2543063961e-45
Ecym_46178.846ON2493053899e-45
KLLA0D01430g8.846ON2633023891e-44
Kwal_27.102278.846ON2543093812e-43
ABL120W8.846ON2493063742e-42
SAKL0D01320g8.846ON2603003594e-40
Skud_36.1singletonON60155731.5
NCAS0D034906.159ON34532684.2
TBLA0B046706.159ON34432684.7
NDAI0F00110singletonON50870685.4
KLLA0B02849g4.274ON993102668.8
YMR273C (ZDS1)8.831ON91580668.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0B03300
         (319 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0B03300 Chr2 (771332..772291) [960 bp, 319 aa] {ON} Anc_8.84...   637   0.0  
Kpol_1068.4 s1068 complement(6124..6999) [876 bp, 291 aa] {ON} c...   209   2e-65
TDEL0B00520 Chr2 complement(94560..95366) [807 bp, 268 aa] {ON} ...   199   5e-62
NDAI0K00330 Chr11 (63765..64706) [942 bp, 313 aa] {ON} Anc_8.846...   199   3e-61
ZYRO0G14300g Chr7 (1145709..1146551) [843 bp, 280 aa] {ON} simil...   194   6e-60
TPHA0I00280 Chr9 (54103..55008) [906 bp, 301 aa] {ON} Anc_8.846 ...   194   1e-59
KAFR0B03960 Chr2 (829312..830148) [837 bp, 278 aa] {ON} Anc_8.84...   191   2e-58
YMR281W Chr13 (832339..833253) [915 bp, 304 aa] {ON}  GPI12ER me...   187   1e-56
CAGL0M03047g Chr13 (346435..347349) [915 bp, 304 aa] {ON} weakly...   180   5e-54
Suva_13.470 Chr13 (815029..815940) [912 bp, 303 aa] {ON} YMR281W...   177   8e-53
Skud_13.453 Chr13 (805536..806438) [903 bp, 300 aa] {ON} YMR281W...   176   2e-52
Smik_13.494 Chr13 (815351..816265) [915 bp, 304 aa] {ON} YMR281W...   176   2e-52
KNAG0J00240 Chr10 complement(32153..33013) [861 bp, 286 aa] {ON}...   175   2e-52
NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON} ...   165   1e-48
KLTH0C03740g Chr3 complement(323371..324135) [765 bp, 254 aa] {O...   157   1e-45
Ecym_4617 Chr4 (1209745..1210494) [750 bp, 249 aa] {ON} similar ...   154   9e-45
KLLA0D01430g Chr4 complement(122369..123160) [792 bp, 263 aa] {O...   154   1e-44
Kwal_27.10227 s27 complement(249716..250480) [765 bp, 254 aa] {O...   151   2e-43
ABL120W Chr2 (175065..175814) [750 bp, 249 aa] {ON} Syntenic hom...   148   2e-42
SAKL0D01320g Chr4 complement(99898..100680) [783 bp, 260 aa] {ON...   142   4e-40
Skud_36.1 Chr36 (1082..2887) [1806 bp, 601 aa] {ON} YPL060C-A (R...    33   1.5  
NCAS0D03490 Chr4 (650325..651362) [1038 bp, 345 aa] {ON} Anc_6.159     31   4.2  
TBLA0B04670 Chr2 (1088358..1089392) [1035 bp, 344 aa] {ON} Anc_6...    31   4.7  
NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON}                 31   5.4  
KLLA0B02849g Chr2 complement(257299..260280) [2982 bp, 993 aa] {...    30   8.8  
YMR273C Chr13 complement(811233..813980) [2748 bp, 915 aa] {ON} ...    30   8.9  

>TBLA0B03300 Chr2 (771332..772291) [960 bp, 319 aa] {ON} Anc_8.846
           YMR281W
          Length = 319

 Score =  637 bits (1644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/319 (100%), Positives = 319/319 (100%)

Query: 1   MNFSTNEIRTVKLILIFWLIYIFNSNSIKLLNDQSFNYFNKHIQLMSNKQHVKINSLSLI 60
           MNFSTNEIRTVKLILIFWLIYIFNSNSIKLLNDQSFNYFNKHIQLMSNKQHVKINSLSLI
Sbjct: 1   MNFSTNEIRTVKLILIFWLIYIFNSNSIKLLNDQSFNYFNKHIQLMSNKQHVKINSLSLI 60

Query: 61  IAHPDDEIMFFSPTLLQLNNYLEKDIMFNVVCLSQGLDSTGSFKDPQRVHELNDSLNLLF 120
           IAHPDDEIMFFSPTLLQLNNYLEKDIMFNVVCLSQGLDSTGSFKDPQRVHELNDSLNLLF
Sbjct: 61  IAHPDDEIMFFSPTLLQLNNYLEKDIMFNVVCLSQGLDSTGSFKDPQRVHELNDSLNLLF 120

Query: 121 NRGSNNEHNRNFKLIQLDYTDGMKEIWNMDLIVDDLLQNLNFTDNGINLLLTFDKSGVSN 180
           NRGSNNEHNRNFKLIQLDYTDGMKEIWNMDLIVDDLLQNLNFTDNGINLLLTFDKSGVSN
Sbjct: 121 NRGSNNEHNRNFKLIQLDYTDGMKEIWNMDLIVDDLLQNLNFTDNGINLLLTFDKSGVSN 180

Query: 181 HKNHLACNEAVTKLLKYSNPDSNLIGIFLNSHSKNFFLKYSFFVSKLFTIIKLKFFRSIS 240
           HKNHLACNEAVTKLLKYSNPDSNLIGIFLNSHSKNFFLKYSFFVSKLFTIIKLKFFRSIS
Sbjct: 181 HKNHLACNEAVTKLLKYSNPDSNLIGIFLNSHSKNFFLKYSFFVSKLFTIIKLKFFRSIS 240

Query: 241 LFYSFCFPNSDFLQSYQIISHYDLNTKTNLSFTFFNPFAKYMLSYSTMLNAHESQMVWFR 300
           LFYSFCFPNSDFLQSYQIISHYDLNTKTNLSFTFFNPFAKYMLSYSTMLNAHESQMVWFR
Sbjct: 241 LFYSFCFPNSDFLQSYQIISHYDLNTKTNLSFTFFNPFAKYMLSYSTMLNAHESQMVWFR 300

Query: 301 YLWWIFSRFAFINDLTIVN 319
           YLWWIFSRFAFINDLTIVN
Sbjct: 301 YLWWIFSRFAFINDLTIVN 319

>Kpol_1068.4 s1068 complement(6124..6999) [876 bp, 291 aa] {ON}
           complement(6124..6999) [876 nt, 292 aa]
          Length = 291

 Score =  209 bits (531), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 113/311 (36%), Positives = 178/311 (57%), Gaps = 37/311 (11%)

Query: 9   RTVKLILIFWLIYIFNSNSIKLLNDQSFNYFNKHIQLMSNKQHVKINSLSLIIAHPDDEI 68
           + +KL  + W  Y++ + +I+  N +         Q+         +S++L+IAHPDDE+
Sbjct: 9   KAIKLYFLLWCGYVWFAGAIRGENAR---------QVRGPGYFSGSSSVNLVIAHPDDEV 59

Query: 69  MFFSPTLLQLNNYLEKDIMFNVVCLSQGLDSTGSFKDPQRVHELNDSLNLLFNRGSNNEH 128
           MFFSPTL+QL+N+L  D+  NV+C S+G++  GS     R  EL  S+++L       EH
Sbjct: 60  MFFSPTLMQLDNWLPNDVAINVICFSKGVNVDGSIAGESRARELKKSVSMLI------EH 113

Query: 129 NRNFKLIQLDYTDGMKEIWNMDLIVDDLLQNLNFTDN--GINLLLTFDKSGVSNHKNHLA 186
           +R   + QLDY DG  +IW++D +V DL   +N + +    +LL+TFD+ GVS+H NH+A
Sbjct: 114 DRPVTVHQLDYKDGKDQIWDLDSMVWDLKTLINPSKDYKRKDLLITFDEHGVSDHPNHIA 173

Query: 187 CNEAVTKLLKYSNPDSNLIGIFLNSHSKNFFLKYSFFVSKLFTIIKLKFFRSISLFYSFC 246
           C+ AV +L++    +   +   L SHS N  LKYSFF  ++           +  FY++C
Sbjct: 174 CHNAVHRLIE---EEPLFMAYQLESHSTNVILKYSFFAREI-----------VKYFYNYC 219

Query: 247 FPNSDFLQSYQIISHYDLNTKTNLSFTFFNPFAKYMLSYSTMLNAHESQMVWFRYLWWIF 306
                  Q  +  +  + N      +  FN  ++Y+++Y+TMLNAHESQ+VWFRY WW F
Sbjct: 220 H------QRIKGQTSLNKNMDVPYEYVLFNTHSEYIMAYATMLNAHESQVVWFRYGWWFF 273

Query: 307 SRFAFINDLTI 317
           SR  + N+L +
Sbjct: 274 SRLTYANELKL 284

>TDEL0B00520 Chr2 complement(94560..95366) [807 bp, 268 aa] {ON}
           Anc_8.846 YMR281W
          Length = 268

 Score =  199 bits (506), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 124/319 (38%), Positives = 178/319 (55%), Gaps = 53/319 (16%)

Query: 1   MNFSTNEIRTVKLILIFWLIYIFNSNSIKLLNDQSFNYFNKHIQLMSNKQHVKINSLSLI 60
           MN S   ++  KL+    ++Y+  +  I   N+  +    +H   +   +     SL+L+
Sbjct: 1   MNVSGGAVKVFKLLFFLSILYVALTARINGRNEVQWQ---QHAAAIGTPE-----SLTLL 52

Query: 61  IAHPDDEIMFFSPTLLQLNNYLEKDIMFNVVCLSQG-LDSTGSFKDPQRVHELNDSLNLL 119
           IAHPDDE+MFFSP+LLQL+  L + + FN VCLS+G  D  G      R  EL  SLNLL
Sbjct: 53  IAHPDDEVMFFSPSLLQLDRLLPQSVRFNFVCLSKGDADHLGE----TRELELQRSLNLL 108

Query: 120 FNRGSNNEHNRNFKLIQLDYTDGMKEIWNMDLIVDDLLQNLNFTDNGINLLLTFDKSGVS 179
               SN++  R  +L Q DY DG  E W ++ +V  ++++  F  +G NLLLTFD  GVS
Sbjct: 109 ---TSNSQ--RKTQLYQFDYPDGFDEKWEIESVV-SIVESKVFIGSGFNLLLTFDAHGVS 162

Query: 180 NHKNHLACNEAVTKLLKYSNPDSNLIGIFLNSHSKNFFLKYSFFVSKLFTIIKLKFFRSI 239
           NH NH+AC+ AV +L++  +       ++LNSHS+N  LKYS F+ +L  ++        
Sbjct: 163 NHPNHVACHNAVARLIEKGHK-----ALYLNSHSRNLPLKYSGFIWELIRML-------- 209

Query: 240 SLFYSFCFPNSDFLQSYQIISHYDLNTKTNLSFTFFNPFAKYMLSYSTMLNAHESQMVWF 299
                     SD +   +         +T L  TF N F +Y+L+++ M NAHESQ+VWF
Sbjct: 210 ----------SDSVMKLE---------RTGL--TFMNSFPQYILAFAAMANAHESQLVWF 248

Query: 300 RYLWWIFSRFAFINDLTIV 318
           RY WW  SRF F+NDL IV
Sbjct: 249 RYGWWSLSRFVFVNDLEIV 267

>NDAI0K00330 Chr11 (63765..64706) [942 bp, 313 aa] {ON} Anc_8.846
           YMR281W
          Length = 313

 Score =  199 bits (505), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 128/336 (38%), Positives = 192/336 (57%), Gaps = 47/336 (13%)

Query: 1   MNFSTNEIRTVKLILIFWLIYIFNSNSIKLLNDQSFNYFNKHIQLMSNKQHVKINS---- 56
           + FS    ++ KL L+ W+ Y+ ++  I   N +SF+    +  L  +  H  I+     
Sbjct: 3   LRFSKFTYKSFKLFLLLWMFYMISTQKISSYNKKSFDNSVLNQILRQDHSHADISEPITQ 62

Query: 57  LSLIIAHPDDEIMFFSPTLLQLNNYLEKDIMFNVVCLSQGLDSTGSFKDPQRVHELNDSL 116
           LSL+IAHPDDE+MFF+PTLLQLN +L   I FN++C S G D+ G      R  EL+DS+
Sbjct: 63  LSLVIAHPDDELMFFAPTLLQLNRFLPTSIPFNIICFSDG-DAEG--LGYLRRKELHDSI 119

Query: 117 NLLFNRGSNNEHNRNFKLIQLDYTDGMKEIWN----MDLIVDDLLQNLNFTDNGINLLLT 172
           NLL +    + +NR   +  LD+ DGM ++W+    +  + ++LL N+  +    N+LLT
Sbjct: 120 NLLLS----SSNNRKINISILDFIDGMDQVWDGKQLLSSLQNELLVNVPPSIKN-NILLT 174

Query: 173 FDKSGVSNHKNHLACNEAVTKLLKY---SNPDSNLIGIFLNSHSK------NFFLKYSFF 223
           FD +G+SNH NH+ACN+AV  L+ Y    + + N+IG+ L+S S       N   KY+FF
Sbjct: 175 FDANGISNHPNHIACNKAVHDLISYDGGKDKEMNIIGLMLSSKSDEYNIVMNLLSKYTFF 234

Query: 224 VSKLFTIIKLKFFRSISLFYSFCFPNSDFLQSYQIISHYDLNTKTNLSFTFFNPFAKYML 283
           V  L     +K + +++       PNS                  +L  +F N +++Y+L
Sbjct: 235 VIDL-----VKVYWNLATGTFNTIPNS-----------------ASLELSFINTYSQYIL 272

Query: 284 SYSTMLNAHESQMVWFRYLWWIFSRFAFINDLTIVN 319
           SY++MLN H+SQMVWFRY WW FSRF F NDL +V+
Sbjct: 273 SYASMLNTHKSQMVWFRYGWWWFSRFVFSNDLLVVS 308

>ZYRO0G14300g Chr7 (1145709..1146551) [843 bp, 280 aa] {ON} similar
           to uniprot|P23797 Saccharomyces cerevisiae YMR281W GPI12
           ER membrane protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly the
           de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 280

 Score =  194 bits (494), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 118/318 (37%), Positives = 184/318 (57%), Gaps = 49/318 (15%)

Query: 8   IRTVKLILIFWLIYIFNSNSIKLLNDQSFNYFNKHIQLMSNKQHVKINSLSLIIAHPDDE 67
           I+  K+  + W+++I  S  IK  N    + FN +++ +      +I+SLSL++AHPDDE
Sbjct: 5   IKFPKVYFLLWVLFIAFSVRIKSRNG---SVFNDNLKFLD-----EIDSLSLVVAHPDDE 56

Query: 68  IMFFSPTLLQLNNYLEKDIMFNVVCLSQG-LDSTGSFKDPQRVHELNDSLNLLFNRGSNN 126
           +MFF+PT+L+L++ L  ++ FNVVCLS+G  D  G      RV EL +S+NLL       
Sbjct: 57  VMFFAPTILELDSRLPPNVEFNVVCLSKGGADELGD----TRVQELKESVNLLLANS--- 109

Query: 127 EHNRNFKLIQLDYTDGMKEIWNMD----LIVDDLLQNLNFTDNGINLLLTFDKSGVSNHK 182
              R ++L Q DY DG +E W+ +     I D +LQ    +     +LLTFD  GVS H 
Sbjct: 110 --KRQYQLQQHDYPDGHEETWDQESVQSTIKDSVLQGRRSS-----VLLTFDDKGVSKHV 162

Query: 183 NHLACNEAVTKLLKYSNPDSNL-IGIFLNSHSKNFFLKYSFFVSKLFTIIKLKFFRSISL 241
           NH+AC+EAV+ L++    +SN+   ++L+S+  N  LKYS F  +++ + +  F   +  
Sbjct: 163 NHIACHEAVSNLVQ---DESNVKAALYLDSYGDNIVLKYSAFFWEIWKLTRDWFLHRV-- 217

Query: 242 FYSFCFPNSDFLQSYQIISHYDLNTKTNLSFTFFNPFAKYMLSYSTMLNAHESQMVWFRY 301
                 P S + ++           K     T  + ++ Y+LS+++ML++H+SQMVWFRY
Sbjct: 218 -----LPTSSYNEN-----------KPATEITLMSDYSSYILSFASMLHSHKSQMVWFRY 261

Query: 302 LWWIFSRFAFINDLTIVN 319
            WW FSRF F+NDL +VN
Sbjct: 262 GWWTFSRFVFVNDLKVVN 279

>TPHA0I00280 Chr9 (54103..55008) [906 bp, 301 aa] {ON} Anc_8.846
           YMR281W
          Length = 301

 Score =  194 bits (493), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 127/318 (39%), Positives = 181/318 (56%), Gaps = 36/318 (11%)

Query: 12  KLILIFWLIYIFNSNSIKLLNDQSFNYFNKHIQLMSNKQHVKINSLSLIIAHPDDEIMFF 71
           K   I  ++YI+ +  I+ LN +SF Y N  +QL  ++Q +K  S++LIIAHPDDE+MFF
Sbjct: 9   KCYCILSILYIWLTPHIEDLNLKSF-YSN--VQLNISQQSLK--SVNLIIAHPDDEVMFF 63

Query: 72  SPTLLQLNNYLEKDIMFNVVCLSQGLDSTGSFKDPQRVHELNDSLNLLFNRGSNNEHNRN 131
           +PTLLQL++ L   + FNV+CLS+G+D  G      R +E+ DSL +L         NR 
Sbjct: 64  TPTLLQLDDILPTHVPFNVICLSKGVDVDGRAVGDLRSNEIMDSLTMLLGHRRAGL-NRE 122

Query: 132 FKLIQLDYTDGMKEIWNMDLIVDDLLQNLNFTDNGINL---LLTFDKSGVSNHKNHLACN 188
            KL Q +Y DGM + W++  +V D+   ++   N   L   LLTFD  GVS H NH+AC 
Sbjct: 123 VKLHQFEYEDGMDKQWDISKVVTDIQNTISMESNVDGLKHWLLTFDAQGVSEHPNHIACY 182

Query: 189 EAVTKL-LKYSNPDSNLIGIFLNSHSKNFFLKYSFFVSKLFTII------KLKFFRSISL 241
           +A+  L  K SNP   L+ + LNS+  N  LKYS F+  +F ++      K + F     
Sbjct: 183 DAMMTLKQKSSNPGDYLL-MTLNSYGSNIILKYSSFLPVVFKLLINIINDKFRIFE---- 237

Query: 242 FYSFCFPNSDFLQSYQIISHYDLNTKTNLSFTFFNPFAKYMLSYSTMLNAHESQMVWFRY 301
                      L+    +S +    K +    F N F  Y+++ S+MLN+H SQMVWFRY
Sbjct: 238 -----------LKQVPFLSMH----KEHDQIQFINTFPHYIMALSSMLNSHTSQMVWFRY 282

Query: 302 LWWIFSRFAFINDLTIVN 319
            WW FSRF F+NDL I++
Sbjct: 283 GWWSFSRFVFVNDLHIID 300

>KAFR0B03960 Chr2 (829312..830148) [837 bp, 278 aa] {ON} Anc_8.846
           YMR281W
          Length = 278

 Score =  191 bits (484), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 123/311 (39%), Positives = 177/311 (56%), Gaps = 47/311 (15%)

Query: 9   RTVKLILIFWLIYIFNSNSIKLLNDQSFNYFNKH-IQLMSNKQHVKINSLSLIIAHPDDE 67
           +  KL LIFW +YI  S  I+L NDQ  N F    I+  SN       SL+L++AHPDDE
Sbjct: 10  KITKLTLIFWCLYIVLSPKIQLSNDQILNTFIPSLIKDRSNDP-----SLTLVVAHPDDE 64

Query: 68  IMFFSPTLLQLNNYLEKDIMFNVVCLSQG-LDSTGSFKDPQRVHELNDSLNLLFNRGSNN 126
           +MFFSPTLLQL+++L  +  FN++  S G  +  GS     R +EL  S+++L  R    
Sbjct: 65  VMFFSPTLLQLDSHLPPNCKFNIISYSDGDAEGLGSL----RSNELAHSIDMLIPR---- 116

Query: 127 EHNRNFKLIQLDYTDGMKEIWNMDLIVDDLLQNLNFTDNGINLLLTFDKSGVSNHKNHLA 186
              RN ++   ++TDGM E+W+  L++  L   L  +D+  N+LLTFD+ GVSNH NH A
Sbjct: 117 ---RNKEIFIFNHTDGMNEVWDNKLMLHQLESIL--SDSQTNILLTFDQFGVSNHINHKA 171

Query: 187 CNEAVTKLLKYSNPDSNLIGIFLNSHSKNFFLKYSFFVSKLFTIIKLKFFRSISLFYSFC 246
           C++ VT  ++ S+  +N   + L+S+S N   KY+ F  +L  + K  +    +L     
Sbjct: 172 CHQVVTSYIQ-SHAKNNF-ALLLDSYSSNLLKKYTGFAWQLVFLAKNYWIHGKTL----- 224

Query: 247 FPNSDFLQSYQIISHYDLNTKTNLSFTFFNPFAKYMLSYSTMLNAHESQMVWFRYLWWIF 306
            PN D L                     FNP++ Y+ +Y+TML AH+SQMVWFRY WW F
Sbjct: 225 -PNLDHL-------------------ALFNPYSDYITAYATMLKAHKSQMVWFRYGWWFF 264

Query: 307 SRFAFINDLTI 317
           SRF ++NDL +
Sbjct: 265 SRFVYVNDLKL 275

>YMR281W Chr13 (832339..833253) [915 bp, 304 aa] {ON}  GPI12ER
           membrane protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly, the
           de-N-acetylation of the
           N-acetylglucosaminylphosphatidylinositol intermediate;
           functional homolog of human PIG-Lp
          Length = 304

 Score =  187 bits (474), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 119/328 (36%), Positives = 179/328 (54%), Gaps = 46/328 (14%)

Query: 1   MNFSTNEIRTVKLILIFWLIYIFNSNSIKLLNDQSFNYFNKHIQLMSNKQHVKINSLSLI 60
           +NFS    +  KL ++  ++YI+ +  I   N+ S  +   H          +IN   L+
Sbjct: 9   VNFSKLLYKITKLAIVLTILYIYFTPKIVSRNNASLQHIFPH-----KYGDYEIN---LV 60

Query: 61  IAHPDDEIMFFSPTLLQLNNYLEKDIMFNVVCLSQG-LDSTGSFKDPQRVHELNDSLNLL 119
           IAHPDDE+MFFSP + QLN+Y  + + FN++CLS+G  +  G      RV ELN+S  LL
Sbjct: 61  IAHPDDEVMFFSPIISQLNSYFPRTVPFNIICLSKGNAEGLGE----TRVRELNESAALL 116

Query: 120 FNRGSNNEHNRNFKLIQ-LDYTDGMKEIWNMDLIVDDLLQNLNFTDNGIN-LLLTFDKSG 177
                   HN     +Q +D+ DGM EIW++D I   L Q ++  ++ +N +++TFD  G
Sbjct: 117 L-------HNERAVSVQVMDFQDGMDEIWDIDSITSSLSQKIDIKNHNLNQIIVTFDSYG 169

Query: 178 VSNHKNHLACNEAVTKLLK-YSNPDS-------NLIGIFLNSHSKNFFLKYSFFVSKLFT 229
           VSNH NH +C  AV KL+  Y+ P +       ++  ++L S+  N  LKY+ F+ ++  
Sbjct: 170 VSNHINHKSCYAAVKKLVDDYAQPKTKRNEQPPHVTALYLRSYKNNIVLKYNSFIWEILK 229

Query: 230 IIKLKFFRSISLFYSFCFPNSDFLQSYQIISHYDLNTKTNLSFTFFNPFAKYMLSYSTML 289
           I+           Y    P   F +  Q +       K  LS    N  A+Y+L+++TML
Sbjct: 230 IL-----------YDLISP---FRRIIQALPPNTAAEKDKLSL--MNTHAQYVLAFATML 273

Query: 290 NAHESQMVWFRYLWWIFSRFAFINDLTI 317
           NAHESQ+VWFRY WWIFSRF F+N+  +
Sbjct: 274 NAHESQVVWFRYGWWIFSRFVFVNEFDV 301

>CAGL0M03047g Chr13 (346435..347349) [915 bp, 304 aa] {ON} weakly
           similar to uniprot|P23797 Saccharomyces cerevisiae
           YMR281w GPI12 N-acetylglucosaminyl phosphatidylinositol
           deacetylase
          Length = 304

 Score =  180 bits (456), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 117/312 (37%), Positives = 172/312 (55%), Gaps = 39/312 (12%)

Query: 9   RTVKLILIFWLIYIFNSNSIKLLNDQSFNYFNKHIQLMSNKQHVKINSLSLIIAHPDDEI 68
           +  KL +IF ++YI+ +  ++ LN ++        +L+    H     L+L+IAHPDDEI
Sbjct: 24  KLTKLTIIFQVLYIYFTPKVEDLNKENLT------KLLPT--HDNFGVLNLVIAHPDDEI 75

Query: 69  MFFSPTLLQLNNYLEKDIMFNVVCLSQG-LDSTGSFKDPQRVHELNDSLNLLFNRGSNNE 127
           MFFSPT+LQL +++++    NVVCLS G  D  G      R  EL D++  L    + N 
Sbjct: 76  MFFSPTILQLIDHVQE---LNVVCLSNGDADGLGEL----RAKELKDAIGYL----TVNR 124

Query: 128 HNRNFKLIQLDYTDGMKEIWNMDLIVDDLLQNLNFTDNGI---NLLLTFDKSGVSNHKNH 184
           + RN  L  LDYTDG  E+W+   +  DL + +  ++ G+   +++LTFD+ G+S H+NH
Sbjct: 125 NLRNVSLNILDYTDGQNEVWSG--VATDLKKYILTSEPGVKQKDIILTFDREGISGHRNH 182

Query: 185 LACNEAVTKLLKYSNPDSNLIGIFLNSHSKNFFLKYSFFVSKLFTIIKLKFFRSISLFYS 244
           +ACNE V   LK    +S +     +  +     KYS  V KL  II  K   S   F S
Sbjct: 183 IACNEGVISYLKTIKSNSFVFLELKSLSTWQIISKYSGVVPKLLEIIYNKIRASNKTFVS 242

Query: 245 FCFPNSDFLQSYQIISHYDLNTKTNLSFTFFNPFAKYMLSYSTMLNAHESQMVWFRYLWW 304
           +  PN D             +  T+ +  F + F +Y LS++ M  AH+SQMVWFRYLWW
Sbjct: 243 Y-LPNRD-------------SIATDSNVCFISTFDQYALSFAAMCYAHKSQMVWFRYLWW 288

Query: 305 IFSRFAFINDLT 316
            FSR+ F+NDL+
Sbjct: 289 SFSRYVFVNDLS 300

>Suva_13.470 Chr13 (815029..815940) [912 bp, 303 aa] {ON} YMR281W
           (REAL)
          Length = 303

 Score =  177 bits (448), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 109/318 (34%), Positives = 177/318 (55%), Gaps = 41/318 (12%)

Query: 9   RTVKLILIFWLIYIFNSNSIKLLNDQSFNYFNKHIQLMSNKQHVKINSLSLIIAHPDDEI 68
           +  KL ++  ++YI+ +  I   N  S  +   H       ++ +IN   L+IAHPDDE+
Sbjct: 15  KITKLAIVLTVLYIYFTPKILSRNTDSLQHVFPH-----RDRNSQIN---LVIAHPDDEV 66

Query: 69  MFFSPTLLQLNNYLEKDIMFNVVCLSQGLDSTGSFKDPQRVHELNDSLNLLFNRGSNNEH 128
           MFFSP + QL+ Y    + FN++CLS+G D+ G  +   R  ELNDS  LL        +
Sbjct: 67  MFFSPVISQLHAYFPDTVPFNILCLSKG-DAEGLGE--TRAKELNDSAVLLL------RN 117

Query: 129 NRNFKLIQLDYTDGMKEIWNMDLIVDDLLQNLNFTDNGIN-LLLTFDKSGVSNHKNHLAC 187
            R   +  +D+ DGM E+W++D I   L Q ++  +  ++ +++TFD  GVSNH NH +C
Sbjct: 118 ERPVSVQVMDFEDGMDEVWDIDSITSTLSQTIDVNNEKVSQIIVTFDSYGVSNHINHKSC 177

Query: 188 NEAVTKLL--------KYSNPDSNLIGIFLNSHSKNFFLKYSFFVSKLFTIIKLKFFRSI 239
           + AV K +        K    ++++  ++L S+  N FLKY+ F+   + I+K+  +R++
Sbjct: 178 HIAVEKFIDDYVGSKTKEKAENAHITALYLRSYKNNIFLKYNSFI---WEILKM-LYRTV 233

Query: 240 SLFYSFCFPNSDFLQSYQIISHYDLNTKTNLSFTFFNPFAKYMLSYSTMLNAHESQMVWF 299
           S           F +S Q ++     T+ N      N  ++Y+L+++ MLNAH+SQ+VWF
Sbjct: 234 S----------PFGRSIQPLAAPSTTTEKN-GLLLMNTHSQYILAFAAMLNAHKSQVVWF 282

Query: 300 RYLWWIFSRFAFINDLTI 317
           RY WWI SRF F+N+  I
Sbjct: 283 RYGWWILSRFVFVNEFDI 300

>Skud_13.453 Chr13 (805536..806438) [903 bp, 300 aa] {ON} YMR281W
           (REAL)
          Length = 300

 Score =  176 bits (445), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 109/327 (33%), Positives = 180/327 (55%), Gaps = 46/327 (14%)

Query: 1   MNFSTNEIRTVKLILIFWLIYIFNSNSIKLLNDQSFNYFNKHIQLMSNKQHVKINSLSLI 60
           +NFS    +  KL ++  ++YIF +  I   ND+   +   H     N+     + ++L+
Sbjct: 7   VNFSKLVYKITKLAIVLTILYIFFTPKIISRNDELLQHVFPH----KNRD----SQINLV 58

Query: 61  IAHPDDEIMFFSPTLLQLNNYLEKDIMFNVVCLSQG-LDSTGSFKDPQRVHELNDSLNLL 119
           IAHPDDE+MFFSP + QL++Y    + FN++CLS+G  D  G      RV ELN S  LL
Sbjct: 59  IAHPDDEVMFFSPVISQLHSYFPITVPFNIICLSKGNADGLGE----SRVKELNGSAALL 114

Query: 120 FNRGSNNEHNRNFKLIQLDYTDGMKEIWNMDLIVDDLLQNLNFTDNGIN-LLLTFDKSGV 178
                  ++ R   +  +D+ DGM E+W+++ IV  + Q ++ ++  +N +++TFD  GV
Sbjct: 115 L------QNERPVSVQVMDFEDGMDEVWDINSIVSTISQTIDLSNEQLNQIIVTFDSYGV 168

Query: 179 SNHKNHLACNEAVTKLL-KYSNPDS-------NLIGIFLNSHSKNFFLKYSFFVSKLFTI 230
           S+H NH +C+ AV +L+ +Y+   +       ++  ++L S+  N  LKY+ F+ ++  I
Sbjct: 169 SDHINHKSCHTAVKRLIDRYAESKAETNEETPHITALYLKSYKNNIVLKYNSFIWEILKI 228

Query: 231 IKLKFFRSISLFYSFCFPNSDFLQSYQIISHYDLNTKTNLSFTFFNPFAKYMLSYSTMLN 290
           +           YS   P   F ++ Q  +     +K        N  A+Y+L+Y+ MLN
Sbjct: 229 L-----------YSVIVP---FPKTIQPPTTTTQRSK----LLLMNTHAQYVLAYAAMLN 270

Query: 291 AHESQMVWFRYLWWIFSRFAFINDLTI 317
           AH+SQ+VWFRY WWI SRF F+N+  +
Sbjct: 271 AHKSQVVWFRYGWWILSRFVFVNEFDV 297

>Smik_13.494 Chr13 (815351..816265) [915 bp, 304 aa] {ON} YMR281W
           (REAL)
          Length = 304

 Score =  176 bits (445), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 116/333 (34%), Positives = 177/333 (53%), Gaps = 56/333 (16%)

Query: 1   MNFSTNEIRTVKLILIFWLIYIFNSNSIKLLNDQSFNYFNKHIQLMSNKQHVKINSLS-- 58
           +NFS    +  KL ++  ++YI+ +  I   N++S              QHV  N  S  
Sbjct: 9   VNFSKLLYKITKLSIVLTILYIYFTPKIISRNNESL-------------QHVFPNKYSDY 55

Query: 59  ---LIIAHPDDEIMFFSPTLLQLNNYLEKDIMFNVVCLSQG-LDSTGSFKDPQRVHELND 114
              LIIAHPDDE+MFFSP + QL++Y    + FN++CLS+G  +  G      RV ELND
Sbjct: 56  QINLIIAHPDDEVMFFSPMISQLHSYFPNTVPFNIICLSKGNAEGLGQ----TRVRELND 111

Query: 115 SLNLLFNRGSNNEHNRNFKLIQ-LDYTDGMKEIWNMDLIVDDLLQNLNFTDNGIN-LLLT 172
           S  LL        HN     +Q +D+ DGM E+W++D I   L Q +   +N +N +++T
Sbjct: 112 SAALLL-------HNERAVSVQVMDFQDGMNEVWDIDSITSTLSQTIGINNNELNQIIVT 164

Query: 173 FDKSGVSNHKNHLACNEAVTKLLK-YSNPDSN-------LIGIFLNSHSKNFFLKYSFFV 224
           FD  GVS H NH +C+ AV KL+  Y+  +         +  ++L S+  N  LKY+ F+
Sbjct: 165 FDSYGVSGHINHKSCHTAVRKLIADYTRSNVRKEVKTPLITALYLRSYKNNIVLKYNSFI 224

Query: 225 SKLFTIIKLKFFRSISLFYSFCFPNSDFLQSYQIISHYDLNTKTNLSFTFFNPFAKYMLS 284
            ++           + + Y    P   F ++ Q +   D+  + N S    N  A+Y+L+
Sbjct: 225 WEI-----------LRMLYGLISP---FRKTTQALPS-DVVAEKN-SLLLMNTHAQYILA 268

Query: 285 YSTMLNAHESQMVWFRYLWWIFSRFAFINDLTI 317
           ++ MLNAH+SQ+VWFRY WWI SRF F+N+  +
Sbjct: 269 FAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDV 301

>KNAG0J00240 Chr10 complement(32153..33013) [861 bp, 286 aa] {ON}
           Anc_8.846 YMR281W
          Length = 286

 Score =  175 bits (443), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 116/320 (36%), Positives = 174/320 (54%), Gaps = 41/320 (12%)

Query: 2   NFSTNEIRTVKLILIFWLIYIFNSNSIKLLNDQSFNYFNKHIQLMSNKQHVKINSLSLII 61
           NFS    +  KL L+  ++YI+ S S       SFNY N    L +  +H  INS++L+I
Sbjct: 5   NFSRFIYKVTKLSLLLGILYIYASTS----KIGSFNYTN----LETLGEH-DINSVNLVI 55

Query: 62  AHPDDEIMFFSPTLLQLNNYL-EKDIMFNVVCLS-QGLDSTGSFKDPQRVHELNDSLNLL 119
           AHPDDE+MFF+P+L+ LN  + +   +FN++C S  G D  G+ ++     EL+DS+ +L
Sbjct: 56  AHPDDEVMFFAPSLINLNEQIRDPSTVFNIICFSNGGADGLGNVRE----QELSDSIAML 111

Query: 120 FNRGSNNEHNRNFKLIQLDYTDGMKEIWNMDLIVDDLLQNLNFTDNGINLLLTFDKSGVS 179
                     RN  ++ LD+ DGMKE W++  ++  L +N+     G N+LLTFD  GVS
Sbjct: 112 L-------PTRNTSIVVLDFKDGMKEKWDVKEMIAKL-RNI-VPKLGHNVLLTFDGKGVS 162

Query: 180 NHKNHLACNEAVTKLLKYSNPDSNLIGIFLNSHSKNFFLKYSFFVSKLFTIIKLKFFRSI 239
            H NH+AC  A             L  + L S+SKN   KYS ++ +L           I
Sbjct: 163 GHLNHIACYRAALGYYNEFKSKQKLTVLSLQSYSKNIVKKYSSYIWEL-----------I 211

Query: 240 SLFYSFCFPNSDFLQSYQIISHYDLNTKTNLSFTFFNPFAKYMLSYSTMLNAHESQMVWF 299
            L YS   P+    +   ++     N    +  T F+ + +Y+LS + MLNAH++Q+VWF
Sbjct: 212 KLLYSSWVPS----RLGNVLPKRGSNVARKI--TIFSTYPQYVLSLAAMLNAHKTQVVWF 265

Query: 300 RYLWWIFSRFAFINDLTIVN 319
           RY WW FSR  F+NDL +++
Sbjct: 266 RYGWWFFSRLVFVNDLDVIS 285

>NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON}
           Anc_8.846 YMR281W
          Length = 276

 Score =  165 bits (417), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 104/263 (39%), Positives = 147/263 (55%), Gaps = 41/263 (15%)

Query: 56  SLSLIIAHPDDEIMFFSPTLLQLNNYLEKDIMFNVVCLSQGLDSTGSFKDPQRVHELNDS 115
           +L+L+IAHPDDE+MFF+PTLLQL+N +   I  NV+C S G D+ G     +R HEL  S
Sbjct: 54  TLNLVIAHPDDEVMFFAPTLLQLDNLMPLSIPINVICFSNG-DAQG--LGEKRQHELQSS 110

Query: 116 LNLLFNRGSNNEHNRNFKLIQLDYTDGMKEIWNMDLIVDDLLQNLNFTDNGINLLLTFDK 175
           ++ L       ++ R   +  L + DG  +IW++D +   L QN +         LTFD 
Sbjct: 111 IHALI------QNQRQTNVTVLHFQDGNDQIWDIDQMTQYLPQNDH------QAFLTFDS 158

Query: 176 SGVSNHKNHLACNEAVTKLLKYSNPDSNLIGIFLNSHSKNFFLKYSFFVSKLFTIIKLKF 235
            GVS HKNH+AC+ AV  L    N ++N+  + L+S   +   KY+FF+  L        
Sbjct: 159 HGVSGHKNHIACHNAVWNL---KNTNNNVTILTLDSIHHSLLAKYTFFIIDL-------- 207

Query: 236 FRSISLFYSFCFPNSDFLQSYQIISHYDLNTKTNLSFTFFNPFAKYMLSYSTMLNAHESQ 295
              + L+++         Q  Q  SH  +        TFFN +++Y+L+YSTMLNAH+SQ
Sbjct: 208 ---VKLYWNLWKDQ----QQPQWESHDKI--------TFFNAYSQYILAYSTMLNAHKSQ 252

Query: 296 MVWFRYLWWIFSRFAFINDLTIV 318
           +VWFRY WW FSRF F N L I 
Sbjct: 253 VVWFRYGWWAFSRFVFSNHLKIT 275

>KLTH0C03740g Chr3 complement(323371..324135) [765 bp, 254 aa] {ON}
           weakly similar to uniprot|P23797 Saccharomyces
           cerevisiae YMR281W GPI12 ER membrane protein involved in
           the second step of glycosylphosphatidylinositol (GPI)
           anchor assembly the de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 254

 Score =  157 bits (396), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 103/306 (33%), Positives = 156/306 (50%), Gaps = 63/306 (20%)

Query: 11  VKLILIFWLIYIFNSNSIKLLNDQSFNYFNKHIQLMSNKQHVKINSLSLIIAHPDDEIMF 70
            KL+ +  ++Y  +S  IK  N+Q+F        L S      IN   L+IAHPDDE+MF
Sbjct: 8   CKLLAVLCILYFASSARIKASNEQAFT------TLFSVLNPTSIN---LVIAHPDDEVMF 58

Query: 71  FSPTLLQLNNYLEKDIMFNVVCLSQ-GLDSTGSFKDPQRVHELNDSLNLLFNRGSNNEHN 129
           F+PTLLQL++Y + DI  +V  L+  G D  G  ++     EL DS++LLF R       
Sbjct: 59  FAPTLLQLDHYFDTDIPVSVFSLTDGGADGLGKLRE----EELRDSVHLLFRR------- 107

Query: 130 RNFKLIQLDYTDGMKEIWNMDLIVDDLLQNLNFTDNGINLLLTFDKSGVSNHKNHLACNE 189
           R  ++  L++ DGMK  W++    + L + +        L LTFD  GVS+H NH++C E
Sbjct: 108 RKAEVTVLNFEDGMKVEWDLQKTSEALRKQVV---GDQPLFLTFDDHGVSSHINHISCYE 164

Query: 190 AVTKLLKYSNPDSNLIGIFLNSHSKNFFLKYSFFVSKLFTIIKLKFFRSISLFYSFCFPN 249
            V + L+ ++P+S    +   +  ++ F KY+ FV  L T+++                 
Sbjct: 165 TV-RNLRAAHPESRSFSL---TSKRSIFQKYTAFVPSLITVLR----------------- 203

Query: 250 SDFLQSYQIISHYDLNTKTNLSFTFFNPFAKYMLSYSTMLNAHESQMVWFRYLWWIFSRF 309
                S Q +              F + F +Y+L+ S M+NAH SQMVWFRY WW FS +
Sbjct: 204 ----GSRQAV--------------FMSTFKQYLLALSVMMNAHTSQMVWFRYGWWFFSCY 245

Query: 310 AFINDL 315
            F N++
Sbjct: 246 VFANEV 251

>Ecym_4617 Chr4 (1209745..1210494) [750 bp, 249 aa] {ON} similar to
           Ashbya gossypii ABL120W
          Length = 249

 Score =  154 bits (389), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 100/305 (32%), Positives = 153/305 (50%), Gaps = 64/305 (20%)

Query: 10  TVKLILIFWLIYIFNSNSIKLLNDQSFNYFNKHIQLMSNKQHVKINSLSLIIAHPDDEIM 69
            +KL L+   +Y  +   ++  N + + Y            H    S++LIIAHPDDE+M
Sbjct: 8   VIKLYLVLLAVYCGSYKHLETHNSKVYEYLVG--------SHGNYTSVTLIIAHPDDEVM 59

Query: 70  FFSPTLLQLNNYLEKDIMFNVVCLSQGLDSTGSFKDPQRVHELNDSLNLLFNRGSNNEHN 129
           FF+PTLLQL+  + + + F VVCL+ G D+ G  +  +R  EL+ +L LL          
Sbjct: 60  FFAPTLLQLDARMAQSVPFRVVCLTDG-DADGLGEVRRR--ELHKALRLLVL-------E 109

Query: 130 RNFKLIQLDYTDGMKEIWNMDLIVDDLLQNLNFTDNGINLLLTFDKSGVSNHKNHLACNE 189
           R+ ++    + DGM E W M+++ ++L Q +  TD    L+LTFD+ GVS H+NH+AC  
Sbjct: 110 RDVEIQMGGFKDGMDEEWKMEVVREELAQVV--TDRR-PLVLTFDERGVSGHRNHIACAH 166

Query: 190 AVTKLLKYSNPDSNLIGIFLNSHSKNFFLKYSFFVSKLFTIIKLKFFRSISLFYSFCFPN 249
           A  KL  ++        + L+S   N   KYSFF   LF ++             F +P 
Sbjct: 167 AAAKLGHHT--------LHLDS-GHNLIRKYSFFFVDLFRLL-------------FGYP- 203

Query: 250 SDFLQSYQIISHYDLNTKTNLSFTFFNPFAKYMLSYSTMLNAHESQMVWFRYLWWIFSRF 309
                               +   F + F++Y+ S  TML AH+SQMVWFR+ WW  SR+
Sbjct: 204 --------------------MPTVFLSTFSQYLHSLVTMLVAHKSQMVWFRWGWWTASRY 243

Query: 310 AFIND 314
            + N+
Sbjct: 244 VYANE 248

>KLLA0D01430g Chr4 complement(122369..123160) [792 bp, 263 aa] {ON}
           similar to uniprot|Q75DZ3 Ashbya gossypii ABL120W
           ABL120Wp and weakly similar to YMR281W uniprot|P23797
           Saccharomyces cerevisiae YMR281W GPI12 ER membrane
           protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly the
           de- N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 263

 Score =  154 bits (389), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 107/302 (35%), Positives = 153/302 (50%), Gaps = 58/302 (19%)

Query: 15  LIFWLIYIFNSNSIKLLNDQSFNYFNKHIQLMSNKQHVKINSLSLIIAHPDDEIMFFSPT 74
           L+F +IY   + +IK  N   F+      +L+S     K+ S++L++AHPDDE+MFFSPT
Sbjct: 15  LVFLVIYGCLTKTIKEHNRWYFH------ELVSESMVSKLTSVTLVVAHPDDEVMFFSPT 68

Query: 75  LLQLNNYLEKDIMFNVVCLSQG-LDSTGSFKDPQRVHELNDSLNLLFNRGSNNEHNRNFK 133
           L Q N  L   I  NVVC++ G  D  G      R  EL DSL ++F       H R F 
Sbjct: 69  LTQFNELLPISIPINVVCMTAGDADGLGHI----RKQELVDSLRIMF-------HGRQFG 117

Query: 134 LIQLDYTDGMKEIWNMDLIVDDLLQNLNFTDNGINLLLTFDKSGVSNHKNHLACNEAVTK 193
              LD+ DGM  +W+  L+   L  ++  ++    L+LTFD+ GVS H NH++C   V K
Sbjct: 118 CDVLDFEDGMDAVWDQVLLEKQLRSSIPDSN---PLVLTFDQFGVSGHINHISCGRLVEK 174

Query: 194 LLKYSNPDSNLIGIFLNSHSKNFFLKYSFFVSKLFTIIKLKFFRSISLFYSFCFPNSDFL 253
            L YS+       + L S  +  ++KYS F++ +F +        IS  Y       D+ 
Sbjct: 175 -LPYSH------KLHLRS-DQPIYVKYSAFIAGIFQL-------GISTVY------PDYG 213

Query: 254 QSYQIISHYDLNTKTNLSFTFFNPFAKYMLSYSTMLNAHESQMVWFRYLWWIFSRFAFIN 313
           +                   F +   +Y+L+ S M  AH SQMVWFR  WW+FSRF FIN
Sbjct: 214 KPR----------------CFISTLPQYLLAASAMSLAHTSQMVWFRVGWWLFSRFCFIN 257

Query: 314 DL 315
           +L
Sbjct: 258 EL 259

>Kwal_27.10227 s27 complement(249716..250480) [765 bp, 254 aa] {ON}
           YMR281W (GPI12) -
           N-acetylglucosaminylphosphatidylinositol de-N-acetylase
           [contig 39] FULL
          Length = 254

 Score =  151 bits (381), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 105/309 (33%), Positives = 150/309 (48%), Gaps = 64/309 (20%)

Query: 9   RTV-KLILIFWLIYIFNSNSIKLLNDQSFNYFNKHIQLMSNKQHVKINSLSLIIAHPDDE 67
           RTV K+  I WL+YI  S  I+  N ++         L        IN   L+IAHPDDE
Sbjct: 5   RTVFKVSGILWLVYILGSVQIERSNRRALG------SLFRGSAPTSIN---LVIAHPDDE 55

Query: 68  IMFFSPTLLQLNNYLEKDIMFNVVCLSQG-LDSTGSFKDPQRVHELNDSLNLLFNRGSNN 126
           +MFF+PTLLQ++ +L   I  NV+ L+ G  D  G      R  EL D + LL  +    
Sbjct: 56  VMFFAPTLLQIDEWLPGSIEVNVISLTDGGADGLGDL----RTKELQDCVRLLLRK---- 107

Query: 127 EHNRNFKLIQLDYTDGMKEIWNMDLIVDDLLQNLNFTDNGINLLLTFDKSGVSNHKNHLA 186
              R   +  LD+ DGM   W+++  V  L + +   D    L LTFD++G+S H NH++
Sbjct: 108 ---RKASVEVLDFLDGMDVEWDLERAVKALQERI--LDES-PLFLTFDENGISGHVNHIS 161

Query: 187 CNEAVTKLLKYSNPDSNLIGIFLNSHSKNFFLKYSFFVSKLFTIIKLKFFRSISLFYSFC 246
           C +AV K+ K+ +  S     F     +  F KYS F+               +LF+SF 
Sbjct: 162 CYKAVQKVRKHYSKSS----CFKLVSKRYLFEKYSGFIP--------------ALFHSFI 203

Query: 247 FPNSDFLQSYQIISHYDLNTKTNLSFTFFNPFAKYMLSYSTMLNAHESQMVWFRYLWWIF 306
             +                       T  N F +Y+L+ S+M+NAH SQMVWFRY WW+F
Sbjct: 204 SSSPS---------------------TLINSFRQYLLALSSMMNAHVSQMVWFRYGWWLF 242

Query: 307 SRFAFINDL 315
           S + + N+L
Sbjct: 243 SYYVYANEL 251

>ABL120W Chr2 (175065..175814) [750 bp, 249 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR281W (GPI12)
          Length = 249

 Score =  148 bits (374), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 99/306 (32%), Positives = 146/306 (47%), Gaps = 66/306 (21%)

Query: 10  TVKLILIFWLIYIFNSNSIKLLNDQSFNYFNKHIQLMSNKQHVKINSLSLIIAHPDDEIM 69
            VKL L+   +Y ++   ++  N Q F        +  + QH    SL+L+IAHPDDE+M
Sbjct: 8   VVKLYLLLLAVYCWSRRRLERHNTQVFERL-----VGGDSQH---TSLTLVIAHPDDEVM 59

Query: 70  FFSPTLLQLNNYLEKDIMFNVVCLSQ-GLDSTGSFKDPQRVHELNDSLNLLFNRGSNNEH 128
           FF+PTLLQL+  L   + F VVCL+  G +  G      R  EL  +L LL       EH
Sbjct: 60  FFAPTLLQLDARLPAWMPFRVVCLTDGGAEGLGQL----RRAELQKALRLLV-----LEH 110

Query: 129 NRNFKLIQLDYTDGMKEIWNMDLIVDDLLQNLNFTDNGINLLLTFDKSGVSNHKNHLACN 188
           +   ++   D+TDGMKE W++  +   L +      +   L+LTFD+ GVS H+NH+ C 
Sbjct: 111 DVTLEVA--DFTDGMKEDWDLAEVRTRLGE---LVTDAKPLVLTFDERGVSGHRNHIGCA 165

Query: 189 EAVTKLLKYSNPDSNLIGIFLNSHSKNFFLKYSFFVSKLFTIIKLKFFRSISLFYSFCFP 248
            A  +L   +        +FL S  +N   KYSFFV  +F ++             F  P
Sbjct: 166 LAAARLGHKT--------LFLRS-ERNLLRKYSFFVLDVFRVV-------------FGTP 203

Query: 249 NSDFLQSYQIISHYDLNTKTNLSFTFFNPFAKYMLSYSTMLNAHESQMVWFRYLWWIFSR 308
                                    F +  A+Y+ +   M+ AH SQMVWFR+ WW+ SR
Sbjct: 204 PPT---------------------VFVSTLAQYLHALVAMVVAHRSQMVWFRWGWWMASR 242

Query: 309 FAFIND 314
           + + N+
Sbjct: 243 YVYANE 248

>SAKL0D01320g Chr4 complement(99898..100680) [783 bp, 260 aa] {ON}
           similar to uniprot|P23797 Saccharomyces cerevisiae
           YMR281W GPI12 ER membrane protein involved in the second
           step of glycosylphosphatidylinositol (GPI) anchor
           assembly the de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 260

 Score =  142 bits (359), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 100/300 (33%), Positives = 139/300 (46%), Gaps = 63/300 (21%)

Query: 19  LIYIFNSNSIKLLNDQSF-NYFNKHIQLMSNKQHVKINSLSLIIAHPDDEIMFFSPTLLQ 77
           ++YI  S  I   N Q F N F                S++LI+AHPDDE MFFSPTLLQ
Sbjct: 19  VLYICVSQRIAAHNRQVFRNVFPSRTP----------TSVNLIVAHPDDETMFFSPTLLQ 68

Query: 78  LNNYLEKDIMFNVVCLSQG-LDSTGSFKDPQRVHELNDSLNLLFNRGSNNEHNRNFKLIQ 136
           L+      +   V+CL+ G  D  G+ ++     EL  S+ LL          RN  +I 
Sbjct: 69  LHVNYPPSVPLRVICLTNGDADGLGAVRE----QELRLSMQLLLP-------ARNTSVIV 117

Query: 137 LDYTDGMKEIWNMDLIVDDLLQNLNFTDNGINLLLTFDKSGVSNHKNHLACNEAVTKLL- 195
             + DGM   W+   +V  +  N + +D    LLLTFD+ GVS H NH++CN AV+ L+ 
Sbjct: 118 EGFEDGMGVEWDTRQVVATI--NRHVSDAS-PLLLTFDEHGVSGHVNHVSCNTAVSALVE 174

Query: 196 KYSNPDSNLIGIFLNSHSKNFFLKYSFFVSKLFTIIKLKFFRSISLFYSFCFPNSDFLQS 255
           +    +     ++LNS  + F  KY  F   L  II  +                     
Sbjct: 175 QREQREQRFTALYLNS-KRYFPPKYGSFAVDLARIITGR--------------------- 212

Query: 256 YQIISHYDLNTKTNLSFTFFNPFAKYMLSYSTMLNAHESQMVWFRYLWWIFSRFAFINDL 315
                             F + F +Y+LS + M NAH SQMVWFR+ WW+ SRF F+N+L
Sbjct: 213 --------------QPPVFMSTFPQYLLSLAAMCNAHVSQMVWFRWGWWLASRFVFVNEL 258

>Skud_36.1 Chr36 (1082..2887) [1806 bp, 601 aa] {ON} YPL060C-A
           (REPEAT)
          Length = 601

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 33/55 (60%), Gaps = 4/55 (7%)

Query: 62  AHPDDEIMFFSPTLLQLNNYLEKDIMFNVVC-LSQGLDSTGSFKDPQRVHELNDS 115
           A  DD+I      L++L+  +EK    N++  L + L+S  S+KD +R+HE NDS
Sbjct: 285 AKQDDDISNLD-QLMELDEKIEK--TSNIILRLQKSLESIDSYKDVKRLHERNDS 336

>NCAS0D03490 Chr4 (650325..651362) [1038 bp, 345 aa] {ON}
          Anc_6.159
          Length = 345

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 10/32 (31%), Positives = 21/32 (65%)

Query: 23 FNSNSIKLLNDQSFNYFNKHIQLMSNKQHVKI 54
          FNS    L++D  ++++ +H+   S+ QH+K+
Sbjct: 7  FNSGHEDLIHDVVYDFYGRHVATCSSDQHIKV 38

>TBLA0B04670 Chr2 (1088358..1089392) [1035 bp, 344 aa] {ON}
          Anc_6.159 YGL100W
          Length = 344

 Score = 30.8 bits (68), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 20/32 (62%)

Query: 23 FNSNSIKLLNDQSFNYFNKHIQLMSNKQHVKI 54
          FNS    L+ D S++++ +H+   S  QHVK+
Sbjct: 4  FNSGHEDLVLDVSYDFYGRHLATCSADQHVKV 35

>NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON} 
          Length = 508

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 37/70 (52%), Gaps = 1/70 (1%)

Query: 73  PTLLQLNNYLEKDIMFNVVCLSQGLDSTGSFKDPQRVHELNDSLNLLFNRGSNNEHNRNF 132
           P L ++++ L +D++ + + L QGL +     DP  V  ++++ N L + G++  H+   
Sbjct: 244 PGLDKISDELREDVLLSAIAL-QGLPTYNMSLDPVEVASMHETENKLPSIGASTRHSSES 302

Query: 133 KLIQLDYTDG 142
            L  +  T G
Sbjct: 303 ILPNMSITKG 312

>KLLA0B02849g Chr2 complement(257299..260280) [2982 bp, 993 aa] {ON}
           similar to uniprot|Q07468 Saccharomyces cerevisiae
           YDL077C VAM6 Protein involved in vacuolar morphogenesis
          Length = 993

 Score = 30.0 bits (66), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 46/102 (45%), Gaps = 9/102 (8%)

Query: 207 IFLNSHSKNFFLKYSFFVSKLFTIIKLKFFRSISLFYSFCFP-NSDFL-QSYQIISHYDL 264
           I LN+++ N + K S+ + ++F    L+F     L  SFCFP N + + + + I + +  
Sbjct: 441 IGLNANTTNIYEKMSYQIFRIF----LQFLAPPVLIISFCFPDNCEIIRRKFAIKNQFFR 496

Query: 265 NTKTNLSFTFFNPFAKYMLSYSTMLNAHESQMVWFRYLWWIF 306
            T T LS        K  L Y T    H   +   +  +W +
Sbjct: 497 ETSTELSAALIR---KGFLPYLTETRRHVKNISKEKDTYWSY 535

>YMR273C Chr13 complement(811233..813980) [2748 bp, 915 aa] {ON}
           ZDS1Protein with a role in regulating Swe1p-dependent
           polarized growth; involved in maintaining Cdc55p in the
           cytoplasm where it promotes mitotic entry; involved in
           mitotic exit through Cdc14p regulation; interacts with
           silencing proteins at the telomere; has a role in Bcy1p
           localization; implicated in mRNA nuclear export
          Length = 915

 Score = 30.0 bits (66), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 35/80 (43%), Gaps = 8/80 (10%)

Query: 152 IVDDLLQNLNFTDNGINLLLTFDKSGVSNHKNHLACNEAVTKLLKYSNPDSNLIGI--FL 209
           +V D LQN+  +DNG       D  G SN  N +  N    +   Y N ++N I +   L
Sbjct: 169 LVQDTLQNIQLSDNG------EDNDGNSNENNDIEDNGEDKESQSYENKENNTINLNRGL 222

Query: 210 NSHSKNFFLKYSFFVSKLFT 229
           + H     ++    + + +T
Sbjct: 223 SRHGNASLIRRPSTLRRSYT 242

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.139    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,310,247
Number of extensions: 1976718
Number of successful extensions: 8747
Number of sequences better than 10.0: 106
Number of HSP's gapped: 9006
Number of HSP's successfully gapped: 112
Length of query: 319
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 209
Effective length of database: 40,868,139
Effective search space: 8541441051
Effective search space used: 8541441051
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 66 (30.0 bits)