Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0B03290singletonON35035017080.0
TBLA0F03190singletonON32269702.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0B03290
         (350 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0B03290 Chr2 (770048..771100) [1053 bp, 350 aa] {ON}              662   0.0  
TBLA0F03190 Chr6 (773382..774350) [969 bp, 322 aa] {ON}                32   2.6  

>TBLA0B03290 Chr2 (770048..771100) [1053 bp, 350 aa] {ON} 
          Length = 350

 Score =  662 bits (1708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/350 (95%), Positives = 335/350 (95%)

Query: 1   MIIKGGHANIYLLVDFXXXXXXXXXXXXXXXVFKLIMVEPDLISSCVKESRFINSTDVVH 60
           MIIKGGHANIYLLVDF               VFKLIMVEPDLISSCVKESRFINSTDVVH
Sbjct: 1   MIIKGGHANIYLLVDFYKLKYIYIYLKSYIYVFKLIMVEPDLISSCVKESRFINSTDVVH 60

Query: 61  WSLKSDHGSFIVMEEKESNDVWNQIDQIIVDESIETKYIFFIEKPDNGSRIDKWFQPSAM 120
           WSLKSDHGSFIVMEEKESNDVWNQIDQIIVDESIETKYIFFIEKPDNGSRIDKWFQPSAM
Sbjct: 61  WSLKSDHGSFIVMEEKESNDVWNQIDQIIVDESIETKYIFFIEKPDNGSRIDKWFQPSAM 120

Query: 121 KFYIIFKTLLPHFNEPLKYSIENIGLFIFNKNIMVIITETFFQKNEVEFKKLFLNGMILQ 180
           KFYIIFKTLLPHFNEPLKYSIENIGLFIFNKNIMVIITETFFQKNEVEFKKLFLNGMILQ
Sbjct: 121 KFYIIFKTLLPHFNEPLKYSIENIGLFIFNKNIMVIITETFFQKNEVEFKKLFLNGMILQ 180

Query: 181 FNDDFLITSCFNIFMVVNKIAIKIFQDFKDSLELIKETTDFQSMDESSRQSSDNTKKENS 240
           FNDDFLITSCFNIFMVVNKIAIKIFQDFKDSLELIKETTDFQSMDESSRQSSDNTKKENS
Sbjct: 181 FNDDFLITSCFNIFMVVNKIAIKIFQDFKDSLELIKETTDFQSMDESSRQSSDNTKKENS 240

Query: 241 KSPESFINTYSLDNEEFLNHQGFNLPTIQLNNTFEIYLFFKKFMTIKENEIEIYFNIGFT 300
           KSPESFINTYSLDNEEFLNHQGFNLPTIQLNNTFEIYLFFKKFMTIKENEIEIYFNIGFT
Sbjct: 241 KSPESFINTYSLDNEEFLNHQGFNLPTIQLNNTFEIYLFFKKFMTIKENEIEIYFNIGFT 300

Query: 301 QFNNSSRPSIEKFNKMLEINQNLIKQCWSVLNQIFSQLLQEYYNDDSKTL 350
           QFNNSSRPSIEKFNKMLEINQNLIKQCWSVLNQIFSQLLQEYYNDDSKTL
Sbjct: 301 QFNNSSRPSIEKFNKMLEINQNLIKQCWSVLNQIFSQLLQEYYNDDSKTL 350

>TBLA0F03190 Chr6 (773382..774350) [969 bp, 322 aa] {ON} 
          Length = 322

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 37/69 (53%), Gaps = 5/69 (7%)

Query: 147 FIFNKNIMVIITETFFQKNEVE---FKKLFLNGMIL--QFNDDFLITSCFNIFMVVNKIA 201
            ++N++I   +TE  FQ++ +E   + +    G+IL   + DD LI +  N  + + K  
Sbjct: 146 LLWNRHIHHTLTELGFQRHAIEHCFYFRYSTTGLILIALYVDDLLIAAPDNDSLDIVKCT 205

Query: 202 IKIFQDFKD 210
           +KI+   KD
Sbjct: 206 LKIYYSMKD 214

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.138    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 40,085,062
Number of extensions: 1987185
Number of successful extensions: 9455
Number of sequences better than 10.0: 147
Number of HSP's gapped: 9869
Number of HSP's successfully gapped: 148
Length of query: 350
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 240
Effective length of database: 40,868,139
Effective search space: 9808353360
Effective search space used: 9808353360
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 66 (30.0 bits)