Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0B032808.844ON1362136246290.0
ZYRO0G14256g8.844ON12592449981e-113
CAGL0B02365g8.844ON10502489721e-111
TDEL0B005408.844ON11154009501e-108
Kpol_1068.58.844ON10322459391e-107
KAFR0A028508.844ON10422299321e-106
Smik_13.178.844ON11313049181e-103
Kwal_27.102398.844ON9142299031e-103
Suva_13.268.844ON11222579151e-103
SAKL0D01364g8.844ON10822179041e-102
TPHA0I002708.844ON10392449001e-102
YML117W (NAB6)8.844ON11342579001e-101
Skud_13.248.844ON11282578961e-100
NDAI0E002708.844ON11982308841e-98
KLTH0C03784g8.844ON9972158687e-98
Ecym_46158.844ON10672328561e-95
NCAS0B002808.844ON10812298561e-95
KNAG0G034408.844ON10532298481e-94
ABL122C8.844ON10432328452e-94
KLLA0D01485g8.844ON11512288184e-90
CAGL0C01419g6.183ON6392064677e-48
AFL061C6.183ON5232054553e-47
NCAS0H010406.183ON6292064605e-47
TBLA0B052106.183ON7102064626e-47
KAFR0B066906.183ON5332064502e-46
NDAI0F022606.183ON6802064536e-46
SAKL0A05280g6.183ON5822004487e-46
Ecym_22336.183ON5762054487e-46
Kpol_1002.696.183ON5902064488e-46
Kwal_27.111586.183ON5672004433e-45
KLLA0E19031g6.183ON6522004455e-45
KNAG0M004306.183ON4432064282e-44
KLTH0H04906g6.183ON5692004335e-44
YPL184C (MRN1)6.183ON6122094348e-44
Smik_6.3906.183ON6252064348e-44
Suva_16.1236.183ON5962064339e-44
TPHA0J022106.183ON5932004311e-43
Skud_16.946.183ON6142064321e-43
ZYRO0G08140g6.183ON6322064312e-43
TDEL0G016206.183ON5842064283e-43
KLTH0D11088g8.670ON42267980.007
Suva_8.2928.670ON370204930.028
Smik_15.4268.670ON371203890.072
NCAS0B016008.670ON373203890.087
KAFR0D016608.797ON212180840.21
ACR135C8.670ON376190850.25
YOR242C (SSP2)8.670ON371214850.26
KLLA0F11275g8.670ON385222781.7
TPHA0D012108.670ON36468763.1
SAKL0F04774g7.145ON28438743.9
KLTH0E14036g8.797ON209183734.8
NCAS0I009903.379ON30055736.2
NCAS0B009508.797ON219162726.9
Suva_9.1407.250ON30283728.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0B03280
         (1362 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {...  1787   0.0  
ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa...   389   e-113
CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa] ...   379   e-111
TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8....   370   e-108
Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp,...   366   e-107
KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {...   363   e-106
Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W ...   358   e-103
Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117...   352   e-103
Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W ...   357   e-103
SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} simil...   352   e-102
TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON...   351   e-102
YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putati...   351   e-101
Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W ...   349   e-100
NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844     345   1e-98
KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} simila...   338   7e-98
Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {...   334   1e-95
NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844     334   1e-95
KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {...   331   1e-94
ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON} ...   330   2e-94
KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} simil...   319   4e-90
CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {...   184   7e-48
AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON} S...   179   3e-47
NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {O...   181   5e-47
TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa] ...   182   6e-47
KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON} Anc_6...   177   2e-46
NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183    179   6e-46
SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {...   177   7e-46
Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}...   177   7e-46
Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa] ...   177   8e-46
Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184...   175   3e-45
KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} simi...   176   5e-45
KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON...   169   2e-44
KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {...   171   5e-44
YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON} ...   171   8e-44
Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C ...   171   8e-44
Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {...   171   9e-44
TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6....   170   1e-43
Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {O...   171   1e-43
ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} simila...   170   2e-43
TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {O...   169   3e-43
KLTH0D11088g Chr4 complement(906439..907707) [1269 bp, 422 aa] {...    42   0.007
Suva_8.292 Chr8 complement(527751..528863) [1113 bp, 370 aa] {ON...    40   0.028
Smik_15.426 Chr15 complement(738453..739568) [1116 bp, 371 aa] {...    39   0.072
NCAS0B01600 Chr2 complement(261098..262219) [1122 bp, 373 aa] {O...    39   0.087
KAFR0D01660 Chr4 (330013..330651) [639 bp, 212 aa] {ON} Anc_8.79...    37   0.21 
ACR135C Chr3 complement(585997..587127) [1131 bp, 376 aa] {ON} S...    37   0.25 
YOR242C Chr15 complement(788742..789857) [1116 bp, 371 aa] {ON} ...    37   0.26 
KLLA0F11275g Chr6 (1038770..1039927) [1158 bp, 385 aa] {ON} weak...    35   1.7  
TPHA0D01210 Chr4 complement(253331..254425) [1095 bp, 364 aa] {O...    34   3.1  
SAKL0F04774g Chr6 (381688..382542) [855 bp, 284 aa] {ON} similar...    33   3.9  
KLTH0E14036g Chr5 complement(1240971..1241600) [630 bp, 209 aa] ...    33   4.8  
NCAS0I00990 Chr9 complement(178176..179043,179119..179153) [903 ...    33   6.2  
NCAS0B00950 Chr2 (150330..150989) [660 bp, 219 aa] {ON} Anc_8.797      32   6.9  
Suva_9.140 Chr9 complement(235080..235988) [909 bp, 302 aa] {ON}...    32   8.4  

>TBLA0B03280 Chr2 complement(764832..768920) [4089 bp, 1362 aa] {ON}
            Anc_8.844 YML117W
          Length = 1362

 Score = 1787 bits (4629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 949/1362 (69%), Positives = 949/1362 (69%)

Query: 1    MSKHXXXXXXXXXXXXXXXXXTPFSTNNMMNDQYLYQHQFYFXXXXXXXXXXXXXQTYFH 60
            MSKH                 TPFSTNNMMNDQYLYQHQFYF             QTYFH
Sbjct: 1    MSKHSRRWNGSNSRNNSRNRGTPFSTNNMMNDQYLYQHQFYFNNPNATTNSNSNNQTYFH 60

Query: 61   QNFTNNNAYFDNSNQEFRINNSNTNMIDHTSALNPTYYSPIPSAPPTPFDPSYGATLLPS 120
            QNFTNNNAYFDNSNQEFRINNSNTNMIDHTSALNPTYYSPIPSAPPTPFDPSYGATLLPS
Sbjct: 61   QNFTNNNAYFDNSNQEFRINNSNTNMIDHTSALNPTYYSPIPSAPPTPFDPSYGATLLPS 120

Query: 121  HLLMGSPFVSTPNIHSFPYSATSISSTPTRKSFSRKXXXXXXXXXXXXXXXXXXXXXXKY 180
            HLLMGSPFVSTPNIHSFPYSATSISSTPTRKSFSRK                      KY
Sbjct: 121  HLLMGSPFVSTPNIHSFPYSATSISSTPTRKSFSRKNSNSNSISNSNSSSMSNLNLNSKY 180

Query: 181  DNYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKLLKDDNSYRISQQTFKENPM 240
            DNY                                    KLLKDDNSYRISQQTFKENPM
Sbjct: 181  DNYPIPPVPILKNPPLNNQNIRNSRNNSNRIRNNHIINRKLLKDDNSYRISQQTFKENPM 240

Query: 241  IIEKPKYSSVIDINKLLEIPLVVSYKILPKGTDEFRTRSLLLENINQSIDTRTLVKNFIN 300
            IIEKPKYSSVIDINKLLEIPLVVSYKILPKGTDEFRTRSLLLENINQSIDTRTLVKNFIN
Sbjct: 241  IIEKPKYSSVIDINKLLEIPLVVSYKILPKGTDEFRTRSLLLENINQSIDTRTLVKNFIN 300

Query: 301  FGPIESVYLIKLNPGSKYNSILLSFVSREICLDFYNNVLQRLMEFXXXXXXXXXXXXFVI 360
            FGPIESVYLIKLNPGSKYNSILLSFVSREICLDFYNNVLQRLMEF            FVI
Sbjct: 301  FGPIESVYLIKLNPGSKYNSILLSFVSREICLDFYNNVLQRLMEFKTELSSKSLTLSFVI 360

Query: 361  LKYEFTDYNHPINEHASDNGDESSSSNKNLXXXXXXXXXXXXXXXXXXXXXXXXXRNDLN 420
            LKYEFTDYNHPINEHASDNGDESSSSNKNL                         RNDLN
Sbjct: 361  LKYEFTDYNHPINEHASDNGDESSSSNKNLKIDTIKEEEEDEEETDGEEIVIEDIRNDLN 420

Query: 421  KENFPLTFASALQSDLVKRGATRSLLLKFNGVVSKDQXXXXXXXXXXXXXXXXXXXXESI 480
            KENFPLTFASALQSDLVKRGATRSLLLKFNGVVSKDQ                    ESI
Sbjct: 421  KENFPLTFASALQSDLVKRGATRSLLLKFNGVVSKDQLINEKLNLFINNNLNNRYILESI 480

Query: 481  SLVXXXXXXXXXXXXXXXXXEDQIEDTPISKFGNNYCLLTFSNILMAIEAFDYFKAKLNE 540
            SLV                 EDQIEDTPISKFGNNYCLLTFSNILMAIEAFDYFKAKLNE
Sbjct: 481  SLVNIENNTKNNKNTIGDDNEDQIEDTPISKFGNNYCLLTFSNILMAIEAFDYFKAKLNE 540

Query: 541  LNIFDCFFVSKTNYHKNSENXXXXXXXXXXXXXXXXXVXXXXXXXXXXXXXVPITSLXXX 600
            LNIFDCFFVSKTNYHKNSEN                 V             VPITSL   
Sbjct: 541  LNIFDCFFVSKTNYHKNSENSKSTISHSTPSSKISSIVNLPNEINNNNKSNVPITSLNSD 600

Query: 601  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTIRNKSRKNSNVTVHELSMDQEIEI 660
                                               TIRNKSRKNSNVTVHELSMDQEIEI
Sbjct: 601  NDKSNVSISNDNISNDNTSNDNNNSNDNPINNNDITIRNKSRKNSNVTVHELSMDQEIEI 660

Query: 661  LNEKLKNIDLKDNELIISAKIYNQPIVEEFDQDXXXXXXXXXXXXXXXXXXQQPFEFXXX 720
            LNEKLKNIDLKDNELIISAKIYNQPIVEEFDQD                  QQPFEF   
Sbjct: 661  LNEKLKNIDLKDNELIISAKIYNQPIVEEFDQDLENISITNLSNSNYLLLNQQPFEFNMN 720

Query: 721  XXXXXXXXXXXXXXXXXXXXXXXXXLPPQSMPMPMFAGNFDMIDPMDPQRSRQPSVLFTA 780
                                     LPPQSMPMPMFAGNFDMIDPMDPQRSRQPSVLFTA
Sbjct: 721  MNMTMNMNMNMNMNVNMNMNMNMNMLPPQSMPMPMFAGNFDMIDPMDPQRSRQPSVLFTA 780

Query: 781  TXXXXXXXXXXXXXXGTHNNLTQTLENHFNTSTELSAVLGGGPGNRTVYIGNINPRSKPE 840
            T              GTHNNLTQTLENHFNTSTELSAVLGGGPGNRTVYIGNINPRSKPE
Sbjct: 781  TQQPQQPQQQQPQQQGTHNNLTQTLENHFNTSTELSAVLGGGPGNRTVYIGNINPRSKPE 840

Query: 841  DLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFFANAYIDPIVLHGNILKVGWGNHS 900
            DLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFFANAYIDPIVLHGNILKVGWGNHS
Sbjct: 841  DLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFFANAYIDPIVLHGNILKVGWGNHS 900

Query: 901  GPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINNPDYEKYHEIYKLPNELQLRKDFSQY 960
            GPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINNPDYEKYHEIYKLPNELQLRKDFSQY
Sbjct: 901  GPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINNPDYEKYHEIYKLPNELQLRKDFSQY 960

Query: 961  GEIEQINYLNDGHCCWINFMNINSAITLVEEVNEDDGIRFHNKFDGRYNGLIIGYGKDRC 1020
            GEIEQINYLNDGHCCWINFMNINSAITLVEEVNEDDGIRFHNKFDGRYNGLIIGYGKDRC
Sbjct: 961  GEIEQINYLNDGHCCWINFMNINSAITLVEEVNEDDGIRFHNKFDGRYNGLIIGYGKDRC 1020

Query: 1021 GNVNKNLVATXXXXXXXXXXXPAYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPAV 1080
            GNVNKNLVAT           PAY                                KPAV
Sbjct: 1021 GNVNKNLVATKNSKFFKKVKKPAYQIKLKKIEEERRLQEENNLRNNNKLSNNSQIRKPAV 1080

Query: 1081 NLESLGITFESSEXXXXXXXXXXXXXXPEDTQKLTSPATSFDDDHKVDPASLEALGIITT 1140
            NLESLGITFESSE              PEDTQKLTSPATSFDDDHKVDPASLEALGIITT
Sbjct: 1081 NLESLGITFESSETDTTINTTNNDIDTPEDTQKLTSPATSFDDDHKVDPASLEALGIITT 1140

Query: 1141 SATVAVTKNIDPSQINTDTSNHEDDETSSTDNAIEQFXXXXXXXXXXXXXXXXXXXXXXI 1200
            SATVAVTKNIDPSQINTDTSNHEDDETSSTDNAIEQF                      I
Sbjct: 1141 SATVAVTKNIDPSQINTDTSNHEDDETSSTDNAIEQFSNENEDEELDSQSSDDLSDVELI 1200

Query: 1201 IGSGDNSDALTLEXXXXXXXXXXXXXXXXXXVHRSHNQKILQSNQVPVLNQYPPMASSXX 1260
            IGSGDNSDALTLE                  VHRSHNQKILQSNQVPVLNQYPPMASS  
Sbjct: 1201 IGSGDNSDALTLENIDNQKLKKNKNKHNKRKVHRSHNQKILQSNQVPVLNQYPPMASSTL 1260

Query: 1261 XXXXXXXXXXXXNDNPKFITSDTEDEILSQLPDEVLDEKNPFRGPXXXXXXXXXXXXIPG 1320
                        NDNPKFITSDTEDEILSQLPDEVLDEKNPFRGP            IPG
Sbjct: 1261 TRTYRKTKLKPKNDNPKFITSDTEDEILSQLPDEVLDEKNPFRGPRNKNKNRNTRKTIPG 1320

Query: 1321 SDVMSQYLTQLQHSTFMYAANILGVSAEDNNITYGDDGEPLN 1362
            SDVMSQYLTQLQHSTFMYAANILGVSAEDNNITYGDDGEPLN
Sbjct: 1321 SDVMSQYLTQLQHSTFMYAANILGVSAEDNNITYGDDGEPLN 1362

>ZYRO0G14256g Chr7 complement(1136628..1140407) [3780 bp, 1259 aa]
            {ON} similar to uniprot|Q03735 Saccharomyces cerevisiae
            YML117W NAB6 Putative RNA-binding protein based on
            computational analysis of large-scale protein-protein
            interaction data
          Length = 1259

 Score =  389 bits (998), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 170/244 (69%), Positives = 205/244 (84%)

Query: 801  LTQTLENHFNTSTELSAVLGGGPGNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDK 860
            +TQ+L+  F TS E++  +GGG GNRTVYIGNI+PRSKPED+CNVVRGGILQ I FL+DK
Sbjct: 644  ITQSLQKQFATSAEVANSMGGGIGNRTVYIGNIHPRSKPEDICNVVRGGILQSIRFLQDK 703

Query: 861  HICFVTFIEATNAAQFFANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVY 920
            HICFVTFIEA+ A QF+ NA+IDPIVLHGN+LKVGWG+HSGPLPKS+SLAVT+GA+RNVY
Sbjct: 704  HICFVTFIEASTAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSVSLAVTVGASRNVY 763

Query: 921  VSLPEFAFKDKFINNPDYEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFM 980
            VSLP+FAFKDK+IN+P Y++Y + YKLP E QLR DF+Q+G+IEQIN+L+DGHCCW+NFM
Sbjct: 764  VSLPDFAFKDKYINDPQYQRYSDEYKLPAEEQLRNDFNQFGDIEQINFLSDGHCCWVNFM 823

Query: 981  NINSAITLVEEVNEDDGIRFHNKFDGRYNGLIIGYGKDRCGNVNKNLVATXXXXXXXXXX 1040
            NI+SAI LVEE+  +DG  FH  FD RY GLIIGYGKDRCGNVNKNL++           
Sbjct: 824  NISSAIKLVEEIKYNDGEAFHKSFDNRYRGLIIGYGKDRCGNVNKNLISGKNSRFYKKVK 883

Query: 1041 XPAY 1044
             P+Y
Sbjct: 884  KPSY 887

 Score =  150 bits (379), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 99/298 (33%), Positives = 141/298 (47%), Gaps = 40/298 (13%)

Query: 254 NKLLEIPLVVSYKILPKGTDEFRTRSLLLENINQSIDTRTLVKNFINFGPIESVYLIKLN 313
           +K+ + P VV+Y++LPKG DE+RTRSLL EN+N S+D  + V  +  +GP+ES+Y+ K  
Sbjct: 208 DKMFKEPFVVTYRMLPKGDDEYRTRSLLFENVNGSVDLYSFVSKYSRYGPVESIYMFKDR 267

Query: 314 PGSKYNSILLSFVSREICLDFYNNVLQRLMEFXXXXXXXXXXXXFVILKYEFTDYNHPIN 373
                +S+LLSF+SR+ICLD YN+VLQRL EF            FV LKY        ++
Sbjct: 268 NDKTKHSVLLSFLSRKICLDSYNSVLQRLAEFKTGLKSKSLTVSFVSLKYR-----KHVD 322

Query: 374 EHASDNGDESSSSNKNLXXXXXXXXXXXXXXXXXXXXXXXXXRNDLNKENFPLTFASALQ 433
           E+  D  D SSS+  N                           +++  + + +T  ++LQ
Sbjct: 323 ENEVDQNDNSSSTPMN-------------ETDDTDASKTPVATSNVQDDAYNVTVVASLQ 369

Query: 434 SDLVKRGATRSLLLKFNGVVSKDQXXXXXXXXXXXXXXXXXXXXESISLVXXXXXXXXXX 493
            D+V RGATRS+ L+ +G   K +                    ESI L+          
Sbjct: 370 YDIVNRGATRSVALELDGEYDKTK-LLDQELDFLSPANNQRYVLESIYLINAKE------ 422

Query: 494 XXXXXXXEDQIEDTPISKFGNNYCLLTFSNILMAIEAFDYFKAKLNELNIFD-CFFVS 550
                         P   F  NY +LTF NI MA+E  DY +      + F  CFFVS
Sbjct: 423 --------------PFKHFPKNYAILTFLNISMAVEVLDYVRNNETARSKFQKCFFVS 466

 Score = 63.9 bits (154), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 34/42 (80%)

Query: 1318 IPGSDVMSQYLTQLQHSTFMYAANILGVSAEDNNITYGDDGE 1359
            IPGSDVM+QYL QLQHSTFMYAANILG +AE +   Y D+ E
Sbjct: 1217 IPGSDVMAQYLAQLQHSTFMYAANILGATAEGDVDYYEDNTE 1258

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/65 (41%), Positives = 35/65 (53%), Gaps = 22/65 (33%)

Query: 92  ALNPTYYSPIPS-----APPTP-----------------FDPSYGATLLPSHLLMGSPFV 129
           A +P  + P+ S     APP P                 FD +YG TLLPSHLL+GSPFV
Sbjct: 48  ANSPMAFPPVGSLQAQYAPPQPAYYAAAGPPLMNPPPTPFDTAYGITLLPSHLLIGSPFV 107

Query: 130 STPNI 134
           S+P++
Sbjct: 108 SSPDL 112

>CAGL0B02365g Chr2 complement(224663..227815) [3153 bp, 1050 aa] {ON}
            some similarities with uniprot|Q03735 Saccharomyces
            cerevisiae YML117w
          Length = 1050

 Score =  379 bits (972), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 168/248 (67%), Positives = 202/248 (81%)

Query: 797  THNNLTQTLENHFNTSTELSAVLGGGPGNRTVYIGNINPRSKPEDLCNVVRGGILQKIVF 856
            T+  +TQ++E+  NTS  ++A +GG   NRTVYIGNINPRSK ED+CNVVRGGILQ + F
Sbjct: 575  TNKVITQSIEDRLNTSARIAAAMGGDADNRTVYIGNINPRSKVEDICNVVRGGILQNVKF 634

Query: 857  LRDKHICFVTFIEATNAAQFFANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGAN 916
            + DK ICFVTFIEA+ AAQF AN++IDPIVLHGN L+VGWGN SGPLPKSI+LAVT+GAN
Sbjct: 635  IEDKRICFVTFIEASAAAQFCANSFIDPIVLHGNTLRVGWGNQSGPLPKSIALAVTVGAN 694

Query: 917  RNVYVSLPEFAFKDKFINNPDYEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCW 976
            RNVYVSLPE+AFKDKFIN+P Y++YHE YKLP++ QLRKDF+ YGEIEQINYL D HCCW
Sbjct: 695  RNVYVSLPEYAFKDKFINDPKYKEYHERYKLPSQEQLRKDFTTYGEIEQINYLKDSHCCW 754

Query: 977  INFMNINSAITLVEEVNEDDGIRFHNKFDGRYNGLIIGYGKDRCGNVNKNLVATXXXXXX 1036
            +NF+NI SAI LVE++N ++G  FH KF+ RY GLII YGKDRCGN+NKNL+A       
Sbjct: 755  VNFINIASAIRLVEDINHNNGEEFHKKFNNRYEGLIINYGKDRCGNINKNLIAGKGSKFY 814

Query: 1037 XXXXXPAY 1044
                 P+Y
Sbjct: 815  KKVKKPSY 822

 Score = 76.6 bits (187), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 70/127 (55%), Gaps = 9/127 (7%)

Query: 246 KYSSVIDINKLLEIPLVVSYKILPKGTDEFRTRSLLLENINQSIDTRTL-VKNFINFGPI 304
           K  + ID+ K L  P+ ++Y++LP G D ++TRSLL EN+ ++ +  ++ ++  IN+  +
Sbjct: 155 KKRTPIDVTKKLISPISINYRVLPSGDDTYKTRSLLFENVQKNDEMLSVFMRLIINYSQV 214

Query: 305 ESVYLIKL--NPGSKYNS------ILLSFVSREICLDFYNNVLQRLMEFXXXXXXXXXXX 356
           ESVY+ +    P     S      + LSF+SR+  LDFYNN LQRL +F           
Sbjct: 215 ESVYVFQQTDTPSKDKESDKDTCCLQLSFLSRQAALDFYNNFLQRLPDFKKKLSSPKLSV 274

Query: 357 XFVILKY 363
            FV   Y
Sbjct: 275 SFVSFSY 281

 Score = 61.6 bits (148), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 28/31 (90%)

Query: 1318 IPGSDVMSQYLTQLQHSTFMYAANILGVSAE 1348
            IPGSDVM+QYL QLQHSTFMYAANILG S E
Sbjct: 1012 IPGSDVMAQYLAQLQHSTFMYAANILGASVE 1042

 Score = 59.3 bits (142), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 30/36 (83%)

Query: 99  SPIPSAPPTPFDPSYGATLLPSHLLMGSPFVSTPNI 134
           SP  + PPTPFD +YGA+LLPSHLLMGSP +ST N+
Sbjct: 44  SPYQNVPPTPFDTAYGASLLPSHLLMGSPMISTTNL 79

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 30/50 (60%), Gaps = 5/50 (10%)

Query: 501 EDQIEDTPISKFGNNYCLLTFSNILMAIEAFDYFKAKLNELNIFDCFFVS 550
           ED  +D P      NY +LTF NI MAIE  DY KA L   ++ +CFFVS
Sbjct: 368 EDAADDFPA-----NYVILTFINIKMAIEVLDYLKANLMTYSVNECFFVS 412

>TDEL0B00540 Chr2 (100637..103984) [3348 bp, 1115 aa] {ON} Anc_8.844
            YML117W
          Length = 1115

 Score =  370 bits (950), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 192/400 (48%), Positives = 248/400 (62%), Gaps = 33/400 (8%)

Query: 639  NKSRKNSNVTVHE-----LSMDQEIEILNEKLKNIDLKDNELIISAKIYNQPIVEEFDQD 693
            N   KN++VT  E     +S+DQEI+ +  KL++++ K N L ++   Y  P  E     
Sbjct: 420  NYRSKNASVTSLESSGSIISLDQEIDEMTYKLQSVNSKKNILEVTTNNYKDPSFEGHTDH 479

Query: 694  XXXXXXXXXXXXXXXXXXQQPFEFXXXXXXXXXXXXXXXXXXXXXXXXXXXXLPPQSMPM 753
                                P E                             LP Q MP+
Sbjct: 480  LTNVTVSEAASLDSQLTMPSPQEVTVNEYV----------------------LPNQDMPL 517

Query: 754  PM---FAGNFDMIDPMDPQRSRQPSVLFTATXXXXXXXXXXXXXXGTHNN-LTQTLENHF 809
            P    +A +   +D + P  S  P      T              G     +TQ+L+  +
Sbjct: 518  PNDMNYAPSVQDVDAVPP--SMVPMSTMPNTPYGCYMPPPNVRQNGNMTKPITQSLQRQY 575

Query: 810  NTSTELSAVLGGGPGNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIE 869
             TS E+++ +GGG GNRTVYIGNI+PRS+ ED+CNVVRGGILQ + FL +K ICFVTF+E
Sbjct: 576  ATSAEVASSMGGGIGNRTVYIGNIHPRSRTEDICNVVRGGILQNVKFLAEKRICFVTFVE 635

Query: 870  ATNAAQFFANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFK 929
            A+ A QF+ NA+IDPIVLHGN+LKVGWG+HSGPLPKSI+LAVT+GA+RNVYVSLPEFAFK
Sbjct: 636  ASAAVQFYTNAFIDPIVLHGNMLKVGWGHHSGPLPKSIALAVTVGASRNVYVSLPEFAFK 695

Query: 930  DKFINNPDYEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLV 989
            DK+I +P YE+Y++ ++LP+E QLR DFS YG+IEQINYLNDGHCCW+NF NI++AI LV
Sbjct: 696  DKYIYDPQYEEYNKKFRLPDEEQLRDDFSHYGDIEQINYLNDGHCCWVNFTNISAAIKLV 755

Query: 990  EEVNEDDGIRFHNKFDGRYNGLIIGYGKDRCGNVNKNLVA 1029
            EEV  + G  F+    GRY+GL+IGYGKDRCGNVNKN +A
Sbjct: 756  EEVKYEGGGNFYKMLGGRYDGLVIGYGKDRCGNVNKNFIA 795

 Score =  161 bits (407), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 104/299 (34%), Positives = 141/299 (47%), Gaps = 63/299 (21%)

Query: 252 DINKLLEIPLVVSYKILPKGTDEFRTRSLLLENINQSIDTRTLVKNFINFGPIESVYLIK 311
           D +K  + P +++Y++LPKG DEFRTRSLL EN++ SID  + V NF N+GP+ESVYL K
Sbjct: 157 DASKRFKDPFILTYRVLPKGNDEFRTRSLLFENVDGSIDLHSFVTNFTNYGPVESVYLFK 216

Query: 312 LNPGSKYNSILLSFVSREICLDFYNNVLQRLMEFXXXXXXXXXXXXFVILKYEFTDYNHP 371
                 + SILLSF S+ ICLDFYN+VLQRL E+            FV L+Y+ +D    
Sbjct: 217 SE--GDHVSILLSFFSKAICLDFYNSVLQRLSEYKSDLDSKALTLSFVSLEYKVSD---- 270

Query: 372 INEHASDNGDESSSSNKNLXXXXXXXXXXXXXXXXXXXXXXXXXRNDLNKENFPLTFASA 431
            +E   D  D+S                                      + F +T A +
Sbjct: 271 TSEEDIDKEDDS------------------------------------KPDAFNITAAGS 294

Query: 432 LQSDLVKRGATRSLLLKFNGVVSKDQXXXXXXXXXXXXXXXXXXXXESISLVXXXXXXXX 491
           L+ D++ RGATRS+++ F    SKD+                    ESI LV        
Sbjct: 295 LRYDVINRGATRSIMITFKTPCSKDE-LIDKKLEFLKKENNTRYVLESIDLVTA------ 347

Query: 492 XXXXXXXXXEDQIEDTPISKFGNNYCLLTFSNILMAIEAFDYFKAKLNELNIFDCFFVS 550
                         D P   F  NY +LTF NI MA+E  DY +    +L+I  CFF+S
Sbjct: 348 --------------DEPSKHFPQNYAVLTFLNIFMAVEILDYIRLHSQKLDISKCFFIS 392

 Score = 68.6 bits (166), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 2/42 (4%)

Query: 95  PTYY--SPIPSAPPTPFDPSYGATLLPSHLLMGSPFVSTPNI 134
           P YY   P+ +APPTPFD +YG TLLPSHLLMGSPFVS+PN+
Sbjct: 45  PMYYPTGPVMNAPPTPFDTAYGVTLLPSHLLMGSPFVSSPNL 86

 Score = 58.9 bits (141), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 30/34 (88%)

Query: 1318 IPGSDVMSQYLTQLQHSTFMYAANILGVSAEDNN 1351
            IPGSDVM+QYL QLQHSTF+YAANILG S + +N
Sbjct: 1073 IPGSDVMAQYLAQLQHSTFIYAANILGASNDGDN 1106

>Kpol_1068.5 s1068 (7832..9475,9855..9863,10320..11765) [3099 bp, 1032
            aa] {ON} (7832..9475,9855..9863,10320..11765) [3099 nt,
            1033 aa]
          Length = 1032

 Score =  366 bits (939), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 162/245 (66%), Positives = 199/245 (81%), Gaps = 1/245 (0%)

Query: 801  LTQTLENHFNTSTELSAVLGGGPGNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDK 860
            L +  ++ F TS E++  +GGG GNRTVYIGNINPRSK ED+CNVVRGG LQ+I F ++K
Sbjct: 556  LLRASKHQFATSAEIANTMGGGAGNRTVYIGNINPRSKAEDICNVVRGGTLQQIKFFKEK 615

Query: 861  HICFVTFIEATNAAQFFANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVY 920
             ICFVTFIEA +AAQF+AN++IDPI+LH N L+VGWG+HSGPLPKSISLAVT+GA+RNVY
Sbjct: 616  GICFVTFIEAASAAQFYANSFIDPIILHNNTLRVGWGDHSGPLPKSISLAVTVGASRNVY 675

Query: 921  VSLPEFAFKDKFINNPDYEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFM 980
            VSLPE+AFKDKFIN+P+Y++YH  Y LP E +LRKDFS +GE+EQ+N+LNDGHCCWINFM
Sbjct: 676  VSLPEYAFKDKFINDPEYKEYHNKYVLPTEEELRKDFSYFGEMEQVNFLNDGHCCWINFM 735

Query: 981  NINSAITLVEEVNEDDGIR-FHNKFDGRYNGLIIGYGKDRCGNVNKNLVATXXXXXXXXX 1039
            NI SAI LVE VN  +G + FH ++  RY GLIIGYGKDRCGNVNK+L++          
Sbjct: 736  NIRSAIKLVESVNSSNGGKTFHERYANRYKGLIIGYGKDRCGNVNKSLISGKNSKFYRKV 795

Query: 1040 XXPAY 1044
              P+Y
Sbjct: 796  KKPSY 800

 Score =  123 bits (309), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 90/316 (28%), Positives = 127/316 (40%), Gaps = 94/316 (29%)

Query: 261 LVVSYKILPKGTDEFRTRSLLLENINQSIDTRTLVKNFINFGPIESVYLIKLN------- 313
             +SYK+LPKG DE++TRSLL EN+++S+D    +K F+NFGPIESVYLI  N       
Sbjct: 251 FTISYKVLPKGNDEYQTRSLLFENVDKSVDLHCFIKKFVNFGPIESVYLINSNGIYDNNK 310

Query: 314 -------------------PGSKYNSILLSFVSREICLDFYNNVLQRLMEFXXXXXXXXX 354
                                    SILLSF+SR ICLDFYN+VLQRL EF         
Sbjct: 311 NNDDYDDDNDNNNDNDDNANNHDTQSILLSFLSRPICLDFYNSVLQRLSEFKTQLNSNDL 370

Query: 355 XXXFVILKYEFTDYNHPINEHASDNGDESSSSNKNLXXXXXXXXXXXXXXXXXXXXXXXX 414
              FV+LKY+  D                                               
Sbjct: 371 TLSFVLLKYKNQD----------------------------------------------- 383

Query: 415 XRNDLNKENFPLTFASALQSDLVKRGATRSLLLKFNGVVSKDQXXXXXXXXXXXXXXXXX 474
            R D  + +F      +L+ D++KRGATRS+ ++FN  ++  +                 
Sbjct: 384 -RPDDEESDFSPALPLSLEYDIIKRGATRSIAVEFNQPITSKEGFMNSKLSFLLSPENKR 442

Query: 475 XXXESISLVXXXXXXXXXXXXXXXXXEDQIEDTPISKFGNNYCLLTFSNILMAIEAFDYF 534
              ES+ ++                      D  + K   N  +LTF NI M ++  D  
Sbjct: 443 YIIESVDIINAAE-----------------RDANLPK---NTVILTFLNISMTVDVMDRI 482

Query: 535 KAKLNELNIFDCFFVS 550
           + +  +  I  C FV+
Sbjct: 483 RLERKDSGISKCVFVT 498

 Score = 68.2 bits (165), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 40/53 (75%), Gaps = 3/53 (5%)

Query: 85  NMIDHTSALNPTYY---SPIPSAPPTPFDPSYGATLLPSHLLMGSPFVSTPNI 134
           NMI+   + +P  Y     IP+APPTPFD +YGA+LLPSHLLMGSPFVSTP +
Sbjct: 99  NMINSQLSNSPGVYYTNQHIPNAPPTPFDSAYGASLLPSHLLMGSPFVSTPTM 151

 Score = 60.8 bits (146), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/32 (81%), Positives = 30/32 (93%)

Query: 1318 IPGSDVMSQYLTQLQHSTFMYAANILGVSAED 1349
            +PGSDVMSQYL QLQHSTFMYAANILG S+++
Sbjct: 987  LPGSDVMSQYLAQLQHSTFMYAANILGASSDE 1018

>KAFR0A02850 Chr1 complement(590196..593324) [3129 bp, 1042 aa] {ON}
            Anc_8.844 YML117W
          Length = 1042

 Score =  363 bits (932), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 162/229 (70%), Positives = 195/229 (85%), Gaps = 1/229 (0%)

Query: 801  LTQTLENHFNTSTELSAVLGGGPGNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDK 860
            +T +LEN  +TS ++++ +G   GNRT+YIGNINPRSK ED+CNVVRGGILQ I F+  K
Sbjct: 584  ITDSLENQLSTSAKVASAMGSDAGNRTIYIGNINPRSKAEDICNVVRGGILQSIKFIESK 643

Query: 861  HICFVTFIEATNAAQFFANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVY 920
            HICFVTFIEA  A QF+ANA+IDPIVLHGN LK+GWGN+SGPLPKSI+LAVTIGA+RNVY
Sbjct: 644  HICFVTFIEAAAAVQFYANAFIDPIVLHGNTLKLGWGNYSGPLPKSIALAVTIGASRNVY 703

Query: 921  VSLPEFAFKDKFINNPDYEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFM 980
            VSLPEFAFKDK+IN+P++++YHE +KLP+  QLR DFS YG  EQINYL+D HCCW+NFM
Sbjct: 704  VSLPEFAFKDKYINDPEFKEYHEKFKLPDPEQLRIDFSSYGPTEQINYLSDSHCCWVNFM 763

Query: 981  NINSAITLVEEVNEDDGIRFHNKFDGRYNGLIIGYGKDRCGNVNKNLVA 1029
            NI+SAI LVEE   +D  RF+ KFD RYNGL+I YGKDRCGN+NKNL+A
Sbjct: 764  NISSAIKLVEEAT-NDFDRFNEKFDERYNGLVINYGKDRCGNINKNLIA 811

 Score =  106 bits (264), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 70/114 (61%)

Query: 253 INKLLEIPLVVSYKILPKGTDEFRTRSLLLENINQSIDTRTLVKNFINFGPIESVYLIKL 312
           + KL   P+ +SY ILPKG D +RTRSLL EN++ +I+  + + NF+    IES+YL+  
Sbjct: 173 LEKLFTEPINISYVILPKGDDAYRTRSLLFENVDNAINLHSFITNFVKNNSIESIYLVPN 232

Query: 313 NPGSKYNSILLSFVSREICLDFYNNVLQRLMEFXXXXXXXXXXXXFVILKYEFT 366
              S    I+LSF+SR ICLDFYNNVLQRL EF            FV LKY  T
Sbjct: 233 KNDSNTCDIILSFLSRHICLDFYNNVLQRLKEFKKHLNSESLNLNFVSLKYNKT 286

 Score = 74.3 bits (181), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 38/41 (92%), Gaps = 2/41 (4%)

Query: 96  TYY--SPIPSAPPTPFDPSYGATLLPSHLLMGSPFVSTPNI 134
           TYY  SP+P+APPTPFD +YGATLLPSHLLMGSPF+S+PN+
Sbjct: 63  TYYKGSPLPNAPPTPFDTAYGATLLPSHLLMGSPFISSPNV 103

 Score = 63.2 bits (152), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 33/42 (78%), Gaps = 3/42 (7%)

Query: 1318 IPGSDVMSQYLTQLQHSTFMYAANILGVSAEDNNITYGDDGE 1359
            IPGSDVM+QYL QLQHSTFMYAANILG S E+    Y D+ E
Sbjct: 997  IPGSDVMAQYLAQLQHSTFMYAANILGASGEEE---YYDEAE 1035

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 60/154 (38%), Gaps = 39/154 (25%)

Query: 416 RNDLNKENFPLTFAS-------------ALQSDLVKRGATRSLLLKFNG------VVSKD 456
           +  LN E+  L F S             +L+ ++V R ATRSL ++         ++ K+
Sbjct: 266 KKHLNSESLNLNFVSLKYNKTTRDNQGPSLEFNIVTRDATRSLAIELCSNENDSLILEKE 325

Query: 457 QXXXXXXXXXXXXXXXXXXXXESISLVXXXXXXXXXXXXXXXXXEDQIEDTPISKFGNNY 516
           Q                    ESI LV                      D    +FG NY
Sbjct: 326 QLFEKILNEILRTDENKRYVLESIDLVST--------------------DKSNKEFGKNY 365

Query: 517 CLLTFSNILMAIEAFDYFKAKLNELNIFDCFFVS 550
            +L+F NI MAIE  DY +   ++LNI  C FV+
Sbjct: 366 AILSFLNITMAIEIMDYIQVISSKLNIGKCSFVT 399

>Smik_13.17 Chr13 (30501..33896) [3396 bp, 1131 aa] {ON} YML117W
            (REAL)
          Length = 1131

 Score =  358 bits (918), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 173/304 (56%), Positives = 215/304 (70%), Gaps = 20/304 (6%)

Query: 799  NNLTQTLENHFNTSTELSAVLGGGPGNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLR 858
            N +TQ+LE +FN S ++++ +G   GNRT+YIGNINPRS+ ED+CNVVRGGILQ I ++ 
Sbjct: 624  NPITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYMP 683

Query: 859  DKHICFVTFIEATNAAQFFANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRN 918
            +K ICFVTFIEA +A QF+AN++IDPIVLHGN+L+VGWG++SGPLPKSISLAVTIGA+RN
Sbjct: 684  EKRICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRN 743

Query: 919  VYVSLPEFAFKDKFINNPDYEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWIN 978
            VYVSLPEFAFK+KFI++P Y+K HE   LP+  QLR+DFS YG+IEQINYL+D HCCWIN
Sbjct: 744  VYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWIN 803

Query: 979  FMNINSAITLVEEVNE------DDGIRFH-----NKFDGRYNGLIIGYGKDRCGNVNKNL 1027
            FMNI+SAI+LVEE+N+      +DG   H      KF GRY GL+I YGKDRCGN+NKNL
Sbjct: 804  FMNISSAISLVEEMNKESTAHNEDGEMTHKTATEKKFGGRYEGLLINYGKDRCGNINKNL 863

Query: 1028 VATXXXXXXXXXXXPAYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPAVNLESLGI 1087
            VA            P+Y                                  A+NLESLGI
Sbjct: 864  VAGKNSRFYKKVKRPSYNIRLSKLEERRRQNENDKKERAFDK---------ALNLESLGI 914

Query: 1088 TFES 1091
            + +S
Sbjct: 915  SLDS 918

 Score =  123 bits (309), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 93/302 (30%), Positives = 131/302 (43%), Gaps = 63/302 (20%)

Query: 256 LLEIPLVVSYKILPKGTDEFRTRSLLLENINQSIDTRTLVKNFINFGPIESVYLI----- 310
           LL+ P  ++YKILP G D +RTRSLL+EN+++S D  ++VKNF+    +ES Y+I     
Sbjct: 191 LLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSIVKNFVKSNTLESTYIIGNEKS 250

Query: 311 -KLNPGSKYN-SILLSFVSREICLDFYNNVLQRLMEFXXXXXXXXXXXXFVILKYEFTDY 368
             L      N SIL+SF++R  CL+FYNN+LQRL EF            FV L Y+F   
Sbjct: 251 DDLKDEQTSNLSILISFLTRSDCLNFYNNILQRLSEFKTFLKSESLNLKFVCLNYDFKCL 310

Query: 369 NHPINEHASDNGDESSSSNKNLXXXXXXXXXXXXXXXXXXXXXXXXXRNDLNKENFPLTF 428
           +  I + A     E                                    ++  N     
Sbjct: 311 STFIEDDALTENVE-----------------------------------QIDITNDSSMI 335

Query: 429 ASALQSDLVKRGATRSLLLKFNGVVSKDQXXXXXXXXXXXXXXXXXXXXESISLVXXXXX 488
           +++L  DL  + ATRS++++F   + K                      ESI +V     
Sbjct: 336 SASLHHDLENKDATRSIIVEFKSPL-KSTELFNKKLQFLDRSNNKRYILESIDIVNT--- 391

Query: 489 XXXXXXXXXXXXEDQIEDTPISKFGNNYCLLTFSNILMAIEAFDYFKAKLNELNIFDCFF 548
                            D P ++F  NY +LTF NI MAIE  DY K    +L I  CF+
Sbjct: 392 -----------------DVPSNQFPENYAVLTFLNIFMAIEVLDYLKKYSKKLGISKCFY 434

Query: 549 VS 550
           VS
Sbjct: 435 VS 436

 Score = 75.5 bits (184), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 39/64 (60%), Positives = 48/64 (75%), Gaps = 4/64 (6%)

Query: 94  NPTYYS--PIPSAPPTPFDPSYGATLLPSHLLMGSPFVSTPNIHSFPYSATSISSTPTRK 151
           +P YYS  P+P+ PPTPFD +YGA+LLPSHLLMGSPFVS+PN+    YS    SS   RK
Sbjct: 51  HPAYYSNSPLPNIPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQG-GYSPAR-SSNFKRK 108

Query: 152 SFSR 155
           ++SR
Sbjct: 109 AYSR 112

 Score = 66.6 bits (161), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 32/36 (88%)

Query: 1318 IPGSDVMSQYLTQLQHSTFMYAANILGVSAEDNNIT 1353
            IPGSDVM+QYL Q+QHSTFMYAANILG SAEDN  T
Sbjct: 1094 IPGSDVMAQYLAQVQHSTFMYAANILGASAEDNTHT 1129

>Kwal_27.10239 s27 (255440..258184) [2745 bp, 914 aa] {ON} YML117W -
            Hypothetical ORF [contig 38] PARTIAL
          Length = 914

 Score =  352 bits (903), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 153/229 (66%), Positives = 190/229 (82%)

Query: 801  LTQTLENHFNTSTELSAVLGGGPGNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDK 860
            L QTL+  +  + +++  +GGG GNRTVYIGNI+PRSK ED+CNVVRGGILQ + ++  K
Sbjct: 413  LGQTLQQQYTATAQVATAMGGGAGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAK 472

Query: 861  HICFVTFIEATNAAQFFANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVY 920
            HICFVTFIEA +A QFFAN+ I+PIVLHG++LKVGWG+HSG LP+SISLAVTIGA+RNVY
Sbjct: 473  HICFVTFIEAASAVQFFANSSIEPIVLHGSLLKVGWGHHSGNLPQSISLAVTIGASRNVY 532

Query: 921  VSLPEFAFKDKFINNPDYEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFM 980
            VSLPE+AFKDKFI +P+Y+ + E +KLP++ QL  DFS +G+IE IN+L DGHCCWINFM
Sbjct: 533  VSLPEYAFKDKFIKDPEYQAFREKFKLPSKQQLYDDFSTFGDIELINFLEDGHCCWINFM 592

Query: 981  NINSAITLVEEVNEDDGIRFHNKFDGRYNGLIIGYGKDRCGNVNKNLVA 1029
            NI++AI LVE+ N  +   FH KF+ RY GL IGYGKDRCGNVNKNLV+
Sbjct: 593  NISNAIKLVEDANNSNNESFHEKFENRYRGLFIGYGKDRCGNVNKNLVS 641

 Score = 74.3 bits (181), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 56/92 (60%), Gaps = 8/92 (8%)

Query: 258 EIPLVVSYKILPKGT----DEFRTRSLLLENINQSIDTRTLVKNFINFGPIESVYLIKLN 313
           +IP  +++ ILP+      D+FRTRSL   N+N  +     +  F  F  IESVY++   
Sbjct: 60  QIPYKLTFNILPRNGNGDGDKFRTRSLYFSNLNPDVRLHEFLATFHKFDRIESVYVVD-- 117

Query: 314 PGSKYNSILLSFVSREICLDFYNNVLQRLMEF 345
              +  S+L+SF+++E CLDFYN +LQ+L EF
Sbjct: 118 --REQQSVLVSFLTKETCLDFYNGILQKLSEF 147

 Score = 56.2 bits (134), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 24/28 (85%), Positives = 27/28 (96%)

Query: 1318 IPGSDVMSQYLTQLQHSTFMYAANILGV 1345
            IPGS+VM+QYL QLQHSTFMYAA+ILGV
Sbjct: 878  IPGSNVMAQYLAQLQHSTFMYAADILGV 905

 Score = 35.0 bits (79), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 5/49 (10%)

Query: 506 DTPISKFGNNYCLLTFSNILMAIEAFDYFKAKLNELNIFDCFFVSKTNY 554
           D P   FG+NY ++ F +I MA+E  +Y K +  E      F ++K +Y
Sbjct: 226 DKPSKYFGSNYAIVHFISIAMAVETMEYLKVQTPE-----SFGLTKVSY 269

>Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W
            (REAL)
          Length = 1122

 Score =  357 bits (915), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 164/257 (63%), Positives = 202/257 (78%), Gaps = 11/257 (4%)

Query: 799  NNLTQTLENHFNTSTELSAVLGGGPGNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLR 858
            N +TQ+LE +FN S ++++ +G   GNRT+YIGNINPRS+ ED+CNVVRGGILQ I ++ 
Sbjct: 617  NPITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSRAEDICNVVRGGILQNIKYIA 676

Query: 859  DKHICFVTFIEATNAAQFFANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRN 918
            +K ICFVTFIEA +A QF+AN++IDPIVLHGN+L+VGWG++SGPLPKSISLAVTIGA+RN
Sbjct: 677  EKRICFVTFIEAASAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRN 736

Query: 919  VYVSLPEFAFKDKFINNPDYEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWIN 978
            VYVSLPEFAFK+KFI++P Y++ HE   LP+  QLR+DFS YG+IEQINYL+D HCCWIN
Sbjct: 737  VYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWIN 796

Query: 979  FMNINSAITLVEEVNE-----DDGIRF------HNKFDGRYNGLIIGYGKDRCGNVNKNL 1027
            FMNI+SAI+LVEE+NE     DD            KFDGRY GL+I YGKDRCGN+NKNL
Sbjct: 797  FMNISSAISLVEEMNEEPTGHDDSGELIPKTATEEKFDGRYKGLLINYGKDRCGNINKNL 856

Query: 1028 VATXXXXXXXXXXXPAY 1044
            VA            P+Y
Sbjct: 857  VAGKNSRFYKKVKRPSY 873

 Score =  130 bits (327), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 93/313 (29%), Positives = 136/313 (43%), Gaps = 71/313 (22%)

Query: 251 IDINKLLEIPLVVSYKILPKGTDEFRTRSLLLENINQSIDTRTLVKNFINFGPIESVYLI 310
           ID   LL+ P  ++YKILP G D +RTRSLL+EN++ S D  +LVKNF+    +ES Y++
Sbjct: 189 IDPETLLQKPFRINYKILPAGDDAYRTRSLLIENVDDSADLHSLVKNFVKSNALESAYIV 248

Query: 311 KLNPGSKYN-----------SILLSFVSREICLDFYNNVLQRLMEFXXXXXXXXXXXXFV 359
               GSK             SIL+SF++R  CL+FYNN+LQRL EF            FV
Sbjct: 249 ----GSKETDNLEKEETKNLSILISFLTRGDCLNFYNNILQRLSEFKTFLKSKSLNLKFV 304

Query: 360 ILKYEFTDYNHPINEHASDNGDESSSSNKNLXXXXXXXXXXXXXXXXXXXXXXXXXRNDL 419
            L Y+      P+ +      +E +++                                 
Sbjct: 305 CLNYDSKSLPTPVEDEELSRSEEQAAT--------------------------------- 331

Query: 420 NKENFPLTFASALQSDLVKRGATRSLLLKFNGVVSKDQXXXXXXXXXXXXXXXXXXXXES 479
             ++     +++L  D+  + ATRS++++F   + K +                    ES
Sbjct: 332 --DDASTMISASLHHDVENKDATRSIIIEFKSPLEKAE-LFKEKLQFLDRSKNKRYILES 388

Query: 480 ISLVXXXXXXXXXXXXXXXXXEDQIEDTPISKFGNNYCLLTFSNILMAIEAFDYFKAKLN 539
           I +V                      D P ++F  NY +LTF NI MAIE  DY K    
Sbjct: 389 IDIVDT--------------------DVPSNQFPENYVVLTFLNIFMAIEVLDYLKKYSK 428

Query: 540 ELNIFDCFFVSKT 552
           +L I  CF+VS T
Sbjct: 429 KLGISKCFYVSLT 441

 Score = 73.6 bits (179), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 38/64 (59%), Positives = 48/64 (75%), Gaps = 4/64 (6%)

Query: 94  NPTYY--SPIPSAPPTPFDPSYGATLLPSHLLMGSPFVSTPNIHSFPYSATSISSTPTRK 151
           +P YY  SP+P+ PPTPFD +YGA+LLPSHLLMGSPFVS+PN+    Y+    SS   RK
Sbjct: 51  HPAYYTNSPLPNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQG-GYNLGR-SSKFNRK 108

Query: 152 SFSR 155
           ++SR
Sbjct: 109 AYSR 112

 Score = 67.4 bits (163), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/64 (57%), Positives = 40/64 (62%), Gaps = 8/64 (12%)

Query: 1294 EVLDEKNPFRGPXXXXXXXXXXXXIPGSDVMSQYLTQLQHSTFMYAANILGVSAEDNNIT 1353
            EV D K   RG             IPGSDVM+QYL Q+QHSTFMYAANILG SAEDN   
Sbjct: 1067 EVTDNKTKKRG------SFPRHRTIPGSDVMAQYLAQVQHSTFMYAANILGASAEDN--A 1118

Query: 1354 YGDD 1357
            Y D+
Sbjct: 1119 YSDE 1122

>SAKL0D01364g Chr4 (105477..108725) [3249 bp, 1082 aa] {ON} similar to
            uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
            Putative RNA-binding protein based on computational
            analysis of large-scale protein-protein interaction data
          Length = 1082

 Score =  352 bits (904), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 154/217 (70%), Positives = 185/217 (85%)

Query: 813  TELSAVLGGGPGNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATN 872
             ++++ +GGG GNRTVY+GNINPRSKPED+CNVVRGGILQ I F   KH+CFVTFIEA  
Sbjct: 559  AQVASNMGGGLGNRTVYLGNINPRSKPEDICNVVRGGILQHIKFFEHKHVCFVTFIEAAA 618

Query: 873  AAQFFANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKF 932
            A QFFANA I+PIVLHGN+LKVGWG+H G L +SI+LAVTIGA+RNVYVSLPE+AFKDKF
Sbjct: 619  AVQFFANASIEPIVLHGNVLKVGWGHHPGDLAQSIALAVTIGASRNVYVSLPEYAFKDKF 678

Query: 933  INNPDYEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEV 992
            I +P+++++ E Y+LP++ QLR+DFS +GEIEQINYL+DGHCCW+NFMNI SAI LVE+ 
Sbjct: 679  IKDPEFQEFREKYELPSKEQLRQDFSNFGEIEQINYLDDGHCCWVNFMNITSAIKLVEDA 738

Query: 993  NEDDGIRFHNKFDGRYNGLIIGYGKDRCGNVNKNLVA 1029
            N  D  +FH  +  RY GLIIGYGKDRCGNVNKNLVA
Sbjct: 739  NGADNKKFHGSYQDRYKGLIIGYGKDRCGNVNKNLVA 775

 Score = 93.2 bits (230), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 67/126 (53%), Gaps = 21/126 (16%)

Query: 260 PLVVSYKILPKGTDEFRTRSLLLENINQSIDTRTLVKNFINFGPIESVYLI--------- 310
           P V+++KILPKG DE+ TRSLLL N+N SI     +  F+ FGPIESVY++         
Sbjct: 182 PYVINFKILPKGDDEYMTRSLLLSNVNASIKLHDFITKFVKFGPIESVYVVPEEEEEEEE 241

Query: 311 ------------KLNPGSKYNSILLSFVSREICLDFYNNVLQRLMEFXXXXXXXXXXXXF 358
                       +     K  SILLSF+++  CLDFYNNVLQ+L +F            F
Sbjct: 242 EEEEEEEEEEEEEEKGEEKKQSILLSFLTKNTCLDFYNNVLQKLSDFKIDLNSKSLTLNF 301

Query: 359 VILKYE 364
           V L  E
Sbjct: 302 VSLTSE 307

 Score = 69.3 bits (168), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 32/38 (84%), Positives = 34/38 (89%), Gaps = 2/38 (5%)

Query: 97  YY--SPIPSAPPTPFDPSYGATLLPSHLLMGSPFVSTP 132
           YY  SP+PSAP TPFD SYGATLLPSHLLMGSPF+STP
Sbjct: 57  YYAGSPMPSAPQTPFDTSYGATLLPSHLLMGSPFISTP 94

 Score = 60.1 bits (144), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/33 (81%), Positives = 29/33 (87%)

Query: 1318 IPGSDVMSQYLTQLQHSTFMYAANILGVSAEDN 1350
            IPGS VM+QYL QLQHSTFMYAANILGV+  DN
Sbjct: 1034 IPGSQVMAQYLAQLQHSTFMYAANILGVTNGDN 1066

>TPHA0I00270 Chr9 complement(50298..53417) [3120 bp, 1039 aa] {ON}
            Anc_8.844 YML117W
          Length = 1039

 Score =  351 bits (900), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 153/244 (62%), Positives = 195/244 (79%)

Query: 801  LTQTLENHFNTSTELSAVLGGGPGNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDK 860
            L QTL++ F TS E+++ +GGG GNRT++IGNINPRSK ED+CNV RGGI+Q++ ++R+K
Sbjct: 595  LPQTLQSQFATSAEMASKMGGGVGNRTIFIGNINPRSKTEDICNVTRGGIIQQVKYIREK 654

Query: 861  HICFVTFIEATNAAQFFANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVY 920
            +ICFV FI+   AAQF+AN++IDPI+LH N LK+GWG+H GPLPK+I LAVT GA+RNVY
Sbjct: 655  NICFVIFIDPQAAAQFYANSFIDPIILHNNTLKIGWGDHPGPLPKAIELAVTAGASRNVY 714

Query: 921  VSLPEFAFKDKFINNPDYEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFM 980
            VSLPEFAFKDK+IN+P+Y++YH  Y LP+E QLR+DFS++GE+EQIN+L D HCCWINF 
Sbjct: 715  VSLPEFAFKDKYINDPNYKEYHNKYILPSEQQLREDFSKFGEMEQINFLKDKHCCWINFT 774

Query: 981  NINSAITLVEEVNEDDGIRFHNKFDGRYNGLIIGYGKDRCGNVNKNLVATXXXXXXXXXX 1040
            NI SAI LVE V  +D   FH ++  RY GLIIGYGKDRCGNVNK+LV+           
Sbjct: 775  NIRSAIKLVELVKNEDNNNFHERYKNRYKGLIIGYGKDRCGNVNKSLVSNKNSRYFRKVK 834

Query: 1041 XPAY 1044
             P+Y
Sbjct: 835  KPSY 838

 Score =  115 bits (287), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 93/294 (31%), Positives = 126/294 (42%), Gaps = 62/294 (21%)

Query: 259 IPLVVSYKILPKGTDEFRTRSLLLENINQSIDTRTLVKNFINFGPIESVYLIKL--NPGS 316
           I   +SY+ILPKG D + TRSLL ENIN+SID  T ++ F+N+G IESVY++       +
Sbjct: 208 IAYKISYQILPKGDDTYHTRSLLFENINESIDLHTFIEKFVNYGLIESVYVVPSYETHQN 267

Query: 317 KYNSILLSFVSREICLDFYNNVLQRLMEFXXXXXXXXXXXXFVILKYEFTDYNHPINEHA 376
              SILLSF SR ICLDFYN+VLQ+L E+            FV L Y   + N       
Sbjct: 268 SVKSILLSFTSRSICLDFYNSVLQKLSEYKTQLNSENLKLSFVSLCYLQNNIN------- 320

Query: 377 SDNGDESSSSNKNLXXXXXXXXXXXXXXXXXXXXXXXXXRNDLNKENFPLTFASALQSDL 436
             NG  S  S K                               N+ +F LT  S +Q  +
Sbjct: 321 KGNGKISVESQK-------------------------------NETDFELT--SLIQYQV 347

Query: 437 VKRGATRSLLLKFNGVVSKDQXXXXXXXXXXXXXXXXXXXXESISLVXXXXXXXXXXXXX 496
              GATRSL ++F+  V K                      ES+ +V             
Sbjct: 348 ANFGATRSLCIEFDKRVDKIDDFIETYLPFLSSNANKRYIIESLYIVNNNGKD------- 400

Query: 497 XXXXEDQIEDTPISKFGNNYCLLTFSNILMAIEAFDYFKAKLNELNIFDCFFVS 550
                        ++F  +Y +L+F NI M IE   Y ++K     I +C +VS
Sbjct: 401 -------------NEFPAHYVILSFLNISMVIEVLHYIRSKNLSKTIKNCLYVS 441

 Score = 57.8 bits (138), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (87%)

Query: 1318 IPGSDVMSQYLTQLQHSTFMYAANILGVSAED 1349
            IPGSDVMSQYL Q+QHSTFMYAAN+L  S E+
Sbjct: 994  IPGSDVMSQYLAQVQHSTFMYAANVLNASIEE 1025

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/52 (55%), Positives = 37/52 (71%), Gaps = 6/52 (11%)

Query: 106 PTPFDPSYGATLLPSHLLMGSPFVSTPNIHSFPYSATSISSTPTRK-SFSRK 156
           PTPFD +YG TLLPSH+LM SPFVSTPN      S  S  ++P+R  S++R+
Sbjct: 109 PTPFDYAYGTTLLPSHILMNSPFVSTPN-----KSYLSFQASPSRGISYNRR 155

>YML117W Chr13 (34243..37647) [3405 bp, 1134 aa] {ON}  NAB6Putative
            RNA-binding protein that associates with mRNAs encoding
            cell wall proteins in high-throughput studies; deletion
            mutants display increased sensitivity to some cell wall
            disrupting agents; expression negatively regulated by
            cAMP
          Length = 1134

 Score =  351 bits (900), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 160/257 (62%), Positives = 201/257 (78%), Gaps = 11/257 (4%)

Query: 799  NNLTQTLENHFNTSTELSAVLGGGPGNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLR 858
            N +TQ+LE +FN S ++++ +G   GNRT+YIGNINPRSK ED+CNVVRGGILQ I ++ 
Sbjct: 626  NPITQSLEQNFNVSAKVASSMGSDIGNRTIYIGNINPRSKAEDICNVVRGGILQSIKYIP 685

Query: 859  DKHICFVTFIEATNAAQFFANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRN 918
            +K ICFVTFIEA +A QF+AN++IDPIVLHGN+L+VGWG++SGPLPK ISLAVTIGA+RN
Sbjct: 686  EKKICFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKLISLAVTIGASRN 745

Query: 919  VYVSLPEFAFKDKFINNPDYEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWIN 978
            VYVSLPEFAFK+KFI++P Y+K HE   LP+  QLR+DFS YG+IEQINYL+D HCCWIN
Sbjct: 746  VYVSLPEFAFKEKFIHDPQYKKLHETLSLPDAEQLREDFSTYGDIEQINYLSDSHCCWIN 805

Query: 979  FMNINSAITLVEEVNEDDGIR-----------FHNKFDGRYNGLIIGYGKDRCGNVNKNL 1027
            FMNI+SAI+LVEE+N++  ++              KF GRY GL+I YGKDRCGN+NKNL
Sbjct: 806  FMNISSAISLVEEMNKESTVQNESGEVTLKRATEEKFGGRYKGLLINYGKDRCGNINKNL 865

Query: 1028 VATXXXXXXXXXXXPAY 1044
            +A            P+Y
Sbjct: 866  IAGKNSRFYKKVKRPSY 882

 Score =  124 bits (312), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 92/303 (30%), Positives = 133/303 (43%), Gaps = 65/303 (21%)

Query: 256 LLEIPLVVSYKILPKGTDEFRTRSLLLENINQSIDTRTLVKNFINFGPIESVYLIKLNPG 315
           LL+ P  ++YK+LP G D +RTRSLL+EN++ SID  ++VKNF+    +ES YLI+    
Sbjct: 192 LLQRPFCINYKVLPTGDDAYRTRSLLIENVDHSIDLHSIVKNFVKSNTLESAYLIEGGKS 251

Query: 316 -------SKYNSILLSFVSREICLDFYNNVLQRLMEFXXXXXXXXXXXXFVILKYEFTDY 368
                  +K  SIL+SF+++  CL+FYNN+LQRL EF            FV L Y+    
Sbjct: 252 DDSKDVETKNLSILISFLTKGDCLNFYNNILQRLSEFKTFLKSEALNLKFVCLNYDPKCL 311

Query: 369 NHPINEHA-SDNGDESSSSNKNLXXXXXXXXXXXXXXXXXXXXXXXXXRNDLNKENFPLT 427
              I   A ++N +E+  +N +                                      
Sbjct: 312 PTFIESEALTENAEEADITNGS------------------------------------TM 335

Query: 428 FASALQSDLVKRGATRSLLLKFNGVVSKDQXXXXXXXXXXXXXXXXXXXXESISLVXXXX 487
            +++L  ++  + ATRS++++F   V K                      ESI LV    
Sbjct: 336 ISASLHHNIANKDATRSIIIEFKSPVEKSD-LFKKKLQFLDRSKNKRYILESIDLVNT-- 392

Query: 488 XXXXXXXXXXXXXEDQIEDTPISKFGNNYCLLTFSNILMAIEAFDYFKAKLNELNIFDCF 547
                             D P ++F  NY +LTF NI MAIE  DY K     L I  CF
Sbjct: 393 ------------------DVPSNQFPENYAVLTFLNISMAIEVLDYLKKYSKNLGISKCF 434

Query: 548 FVS 550
           +VS
Sbjct: 435 YVS 437

 Score = 77.0 bits (188), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/63 (61%), Positives = 47/63 (74%), Gaps = 4/63 (6%)

Query: 95  PTYY--SPIPSAPPTPFDPSYGATLLPSHLLMGSPFVSTPNIHSFPYSATSISSTPTRKS 152
           P YY  SP+P+ PPTPFD +YGA+L PSHLLMGSPFVS+PN+ S   SA   SS   RK+
Sbjct: 52  PAYYTNSPLPNIPPTPFDTAYGASLFPSHLLMGSPFVSSPNMQSGYNSAR--SSNLKRKA 109

Query: 153 FSR 155
           +SR
Sbjct: 110 YSR 112

 Score = 66.2 bits (160), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 29/33 (87%), Positives = 31/33 (93%)

Query: 1318 IPGSDVMSQYLTQLQHSTFMYAANILGVSAEDN 1350
            IPGSDVM+QYL Q+QHSTFMYAANILG SAEDN
Sbjct: 1097 IPGSDVMAQYLAQVQHSTFMYAANILGASAEDN 1129

>Skud_13.24 Chr13 (33966..37352) [3387 bp, 1128 aa] {ON} YML117W
            (REAL)
          Length = 1128

 Score =  349 bits (896), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 162/257 (63%), Positives = 201/257 (78%), Gaps = 11/257 (4%)

Query: 799  NNLTQTLENHFNTSTELSAVLGGGPGNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLR 858
            N +TQ+LE +FN S ++++ +G   GNRT+YIGNINPRS+ ED+CNVVRGGILQ I ++ 
Sbjct: 623  NAITQSLEQNFNVSAKVASSMGSDVGNRTIYIGNINPRSRAEDICNVVRGGILQSIKYIP 682

Query: 859  DKHICFVTFIEATNAAQFFANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRN 918
            +K I FVTFIEA +A QF+AN++IDPIVLHGN+L+VGWG++SGPLPKSISLAVTIGA+RN
Sbjct: 683  EKRISFVTFIEAPSAVQFYANSFIDPIVLHGNMLRVGWGHYSGPLPKSISLAVTIGASRN 742

Query: 919  VYVSLPEFAFKDKFINNPDYEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWIN 978
            VYVSLPEFAFK+KFI++P Y++ HE   LP+  QLR+DFS YG+IEQINYL+D HCCWIN
Sbjct: 743  VYVSLPEFAFKEKFIHDPQYKQLHETLALPDAEQLREDFSTYGDIEQINYLSDSHCCWIN 802

Query: 979  FMNINSAITLVEEVNED-----DGIRF------HNKFDGRYNGLIIGYGKDRCGNVNKNL 1027
            FMNI+SAI LVEE+N++     DG           KFDGRY GL+I YGKDRCGN+NKNL
Sbjct: 803  FMNISSAIGLVEEMNKESMAHHDGGEVIVKTAGEEKFDGRYKGLLINYGKDRCGNINKNL 862

Query: 1028 VATXXXXXXXXXXXPAY 1044
            VA            P+Y
Sbjct: 863  VAGKNSRFYKKVKRPSY 879

 Score =  131 bits (329), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 93/304 (30%), Positives = 132/304 (43%), Gaps = 63/304 (20%)

Query: 256 LLEIPLVVSYKILPKGTDEFRTRSLLLENINQSIDTRTLVKNFINFGPIESVYLI----- 310
           LL+ P  ++YKILP G D +RTRSLL+EN+++S D  +LVKNF+ F  +ES Y +     
Sbjct: 191 LLQRPFRINYKILPTGDDAYRTRSLLIENVDRSTDLHSLVKNFVKFNTLESAYFVDNDKN 250

Query: 311 -KLNPGSKYN-SILLSFVSREICLDFYNNVLQRLMEFXXXXXXXXXXXXFVILKYEFTDY 368
             L  G   N S+L+SF++R  CL+FYNN+LQRL EF            FV L YE    
Sbjct: 251 DDLEDGETENLSVLISFLTRSDCLNFYNNILQRLSEFKIFLKSKSLNLKFVCLNYESECL 310

Query: 369 NHPINEHASDNGDESSSSNKNLXXXXXXXXXXXXXXXXXXXXXXXXXRNDLNKENFPLTF 428
           +  +        DE                                    ++  N  +  
Sbjct: 311 STFVEGEKPKEVDE-----------------------------------QVHAANDSMMI 335

Query: 429 ASALQSDLVKRGATRSLLLKFNGVVSKDQXXXXXXXXXXXXXXXXXXXXESISLVXXXXX 488
           +++L  D+  + ATRS++++F   + K +                    ESI LV     
Sbjct: 336 SASLHHDVENKDATRSIIIEFKSALEKTE-LFRKRLQFLDESKNKRYILESIDLVNT--- 391

Query: 489 XXXXXXXXXXXXEDQIEDTPISKFGNNYCLLTFSNILMAIEAFDYFKAKLNELNIFDCFF 548
                            D P ++F  NY +LTF NI MA+E  DY K     L I  CF+
Sbjct: 392 -----------------DVPSNQFPENYAVLTFLNIFMAVEVLDYLKKFSKSLEISKCFY 434

Query: 549 VSKT 552
           VS T
Sbjct: 435 VSLT 438

 Score = 78.2 bits (191), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/69 (57%), Positives = 51/69 (73%), Gaps = 4/69 (5%)

Query: 89  HTSALNPTYY--SPIPSAPPTPFDPSYGATLLPSHLLMGSPFVSTPNIHSFPYSATSISS 146
           + S+ +P YY  SP+P+ PPTPFD +YGA+LLPSHLLMGSPFVS+PN+    YS    SS
Sbjct: 46  YGSSQHPAYYTNSPLPNVPPTPFDTAYGASLLPSHLLMGSPFVSSPNMQG-GYSPAR-SS 103

Query: 147 TPTRKSFSR 155
              RK++SR
Sbjct: 104 NLKRKAYSR 112

 Score = 66.2 bits (160), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 29/33 (87%), Positives = 31/33 (93%)

Query: 1318 IPGSDVMSQYLTQLQHSTFMYAANILGVSAEDN 1350
            IPGSDVM+QYL Q+QHSTFMYAANILG SAEDN
Sbjct: 1091 IPGSDVMAQYLAQVQHSTFMYAANILGASAEDN 1123

>NDAI0E00270 Chr5 (33295..36891) [3597 bp, 1198 aa] {ON} Anc_8.844
          Length = 1198

 Score =  345 bits (884), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 153/230 (66%), Positives = 193/230 (83%), Gaps = 1/230 (0%)

Query: 801  LTQTLENHFNTSTELSAVLGGGPGNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDK 860
            + +TLE+ FNTS ++++ +G   GNRT+YIGN+NPRSK ED+CNVVRGGILQ I  +  K
Sbjct: 703  IVRTLEDKFNTSAQVASSMGVEMGNRTIYIGNLNPRSKAEDVCNVVRGGILQSIKLIASK 762

Query: 861  HICFVTFIEATNAAQFFANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVY 920
             ICFVTFIEA+ A QF+AN++IDP++LHGN LK+GWGN+  PL KSI+LAVTIGA+RNVY
Sbjct: 763  RICFVTFIEASAAVQFYANSFIDPLILHGNTLKIGWGNYYEPLSKSIALAVTIGASRNVY 822

Query: 921  VSLPEFAFKDKFINNPDYEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFM 980
            VSLPEFAFKDKF+N+P+Y+++HE YKLP+E QLR DF++YG IEQINYL+D HCCW+NFM
Sbjct: 823  VSLPEFAFKDKFLNDPEYKEFHEKYKLPSEQQLRFDFNKYGPIEQINYLSDSHCCWVNFM 882

Query: 981  NINSAITLVEEVNED-DGIRFHNKFDGRYNGLIIGYGKDRCGNVNKNLVA 1029
            NI SAI LVE+VN +     F  KF+ RY+GLII YGKDRCGNVN+NL++
Sbjct: 883  NITSAIKLVEDVNNNPKDNTFSKKFNHRYDGLIINYGKDRCGNVNRNLIS 932

 Score =  122 bits (307), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 95/315 (30%), Positives = 132/315 (41%), Gaps = 59/315 (18%)

Query: 251 IDINKLLEIPLVVSYKILPKGTDEFRTRSLLLENINQSIDTRTLVKNFINFGPIESVYLI 310
           +D N+L + P V+SYK+LP G D +RTRSLL  N+  SID  + + +F+ +  IES+YLI
Sbjct: 175 VDPNELFQKPFVISYKLLPTGDDAYRTRSLLFSNVASSIDLHSFIYDFVQYSSIESIYLI 234

Query: 311 KLNPGSK---------YNSILLSFVSREICLDFYNNVLQRLMEFXXXXXXXXXXXXFVIL 361
                 K           SILLSF+SREICL FYNNVLQRL EF            FVIL
Sbjct: 235 SNTDDEKDQDNENDKNKRSILLSFLSREICLSFYNNVLQRLNEFKTNLQSKSLTLNFVIL 294

Query: 362 KYEFTDYNHPINEHASDNGDESSSSNKNLXXXXXXXXXXXXXXXXXXXXXXXXXRNDLNK 421
            Y             +D+G  ++ SN  L                          ND+N 
Sbjct: 295 NY----------LEKTDDGSTANISNNQL-------------------NQIQENENDVNT 325

Query: 422 ENF----PLTFASALQSDLVKRGATRSLLLKFNGVVSKDQXXXXXXXXXXXXXXXXXXXX 477
             F     +   +AL+ DL+   ATR ++++      K+                     
Sbjct: 326 NEFDYRNSMNTVNALKFDLINPDATRFIMIELKTKCDKETLLNKHLSFLIDNKKNIRYIL 385

Query: 478 ESISLVXXXXXXXXXXXXXXXXXEDQIEDTPISK-----------------FGNNYCLLT 520
           ESI L                  +++ E++P  K                 F N+Y +L+
Sbjct: 386 ESIDLFNIIENENSSENKSIIEAKNENENSPQGKEKDTMVQKRKRNRSKRTFPNHYAVLS 445

Query: 521 FSNILMAIEAFDYFK 535
           F NI MA+E  DY K
Sbjct: 446 FINIYMAMELRDYLK 460

 Score = 79.3 bits (194), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 43/71 (60%), Positives = 49/71 (69%), Gaps = 12/71 (16%)

Query: 96  TYY--SPIPSAPPTPFDPSYGATLLPSHLLMGSPFVSTPN---------IHSFPYSATSI 144
            YY  SP+P+APPTPFD +YGATLLPSHLLMGSP+VSTPN            F YS  S 
Sbjct: 72  AYYIPSPLPNAPPTPFDTAYGATLLPSHLLMGSPYVSTPNGIVPSSQQQSQMFLYSQ-SP 130

Query: 145 SSTPTRKSFSR 155
           + TP RKSFS+
Sbjct: 131 AGTPNRKSFSQ 141

 Score = 70.9 bits (172), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 37/40 (92%), Gaps = 2/40 (5%)

Query: 1318 IPGSDVMSQYLTQLQHSTFMYAANILGVSAEDNNITYGDD 1357
            IPG+DVM+QYLTQLQHSTFMYAANILGVSAEDN  TY D+
Sbjct: 1157 IPGADVMAQYLTQLQHSTFMYAANILGVSAEDN--TYYDE 1194

>KLTH0C03784g Chr3 (328834..331827) [2994 bp, 997 aa] {ON} similar to
            uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
            Putative RNA-binding protein based on computational
            analysis of large-scale protein-protein interaction data
          Length = 997

 Score =  338 bits (868), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 149/215 (69%), Positives = 182/215 (84%)

Query: 815  LSAVLGGGPGNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAA 874
            ++  +GGG GNRTVYIGNI+PRSK ED+CNVVRGGILQ + ++  KHICFVTFIEA +A 
Sbjct: 504  VATAMGGGLGNRTVYIGNISPRSKTEDICNVVRGGILQSVKYIEAKHICFVTFIEAASAV 563

Query: 875  QFFANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKFIN 934
            QFFAN+ I+PIVLHGN+LKVGWG+HSG LP+SISLAVTIGA+RNVYVSLPE AFKDKFI 
Sbjct: 564  QFFANSTIEPIVLHGNVLKVGWGHHSGNLPQSISLAVTIGASRNVYVSLPEHAFKDKFIK 623

Query: 935  NPDYEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVNE 994
            +P+Y+++ E ++LP++ QL +DFS +G+IE +N+L DGHCCWINFMNI++AI LVE+ N 
Sbjct: 624  DPEYQEFKEKFQLPSKEQLYEDFSVFGDIELVNFLEDGHCCWINFMNISNAIKLVEDANN 683

Query: 995  DDGIRFHNKFDGRYNGLIIGYGKDRCGNVNKNLVA 1029
             +   FH KF  RY GL IGYGKDRCGNVNKNLVA
Sbjct: 684  PNNDSFHEKFGNRYKGLFIGYGKDRCGNVNKNLVA 718

 Score = 74.7 bits (182), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 56/104 (53%), Gaps = 8/104 (7%)

Query: 263 VSYKILPK----GTDEFRTRSLLLENINQSIDTRTLVKNFINFGPIESVYLIKLNPGSKY 318
           V + ILP+    G DE+ TRSLL  N+N        +  F  F  +ESVYL+     S+ 
Sbjct: 138 VVFHILPRSADGGGDEYMTRSLLFSNLNPDTHLHDFLTKFEKFDRVESVYLVD----SQQ 193

Query: 319 NSILLSFVSREICLDFYNNVLQRLMEFXXXXXXXXXXXXFVILK 362
            S+L+SF+++E CLDFYN VLQ+L EF            F  L+
Sbjct: 194 QSVLVSFLTKETCLDFYNGVLQKLSEFKKELKSKELTLNFASLR 237

 Score = 61.6 bits (148), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 53/116 (45%), Gaps = 18/116 (15%)

Query: 1249 LNQYPPMASSXXXXXXXXXXXXXXNDNPKFITSDTE----DEILSQLPDEVLDEKNPFRG 1304
            L+  PP+A S                  +F T++      ++I SQ      D K P   
Sbjct: 890  LDAVPPLAPSTLSRQYTATSKHNSRRGSRFGTTEKSSPRYNDIRSQ------DSKKPLH- 942

Query: 1305 PXXXXXXXXXXXXIPGSDVMSQYLTQLQHSTFMYAANILGVSAEDNNITYGDDGEP 1360
                         IPGSDVM+QYL QLQHSTFMYAANILGV  +D    + D+  P
Sbjct: 943  -----PRRRKSKAIPGSDVMAQYLAQLQHSTFMYAANILGV--DDGETVFYDENGP 991

 Score = 58.5 bits (140), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/54 (51%), Positives = 37/54 (68%), Gaps = 1/54 (1%)

Query: 101 IPSAPPTPFDPSYGATLLPSHLLMGSPFVSTPNIHSF-PYSATSISSTPTRKSF 153
           +P AP TPFD SYG +LLPSHLLM SPF++TP + S  P+ A    S+  + S+
Sbjct: 45  VPPAPQTPFDTSYGVSLLPSHLLMSSPFLATPGMGSASPHRAGGSRSSHAQSSY 98

>Ecym_4615 Chr4 complement(1199802..1203005) [3204 bp, 1067 aa] {ON}
            similar to Ashbya gossypii ABL122C
          Length = 1067

 Score =  334 bits (856), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 153/232 (65%), Positives = 188/232 (81%), Gaps = 7/232 (3%)

Query: 801  LTQTLENHFNTSTELSAVLGGGPGNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDK 860
            + Q L+  + T T       GG  NRTVYIGNI+PRSKPED+CNVVRGGILQ I ++  K
Sbjct: 548  INQALQRQYLTGTGQV----GGSNNRTVYIGNIHPRSKPEDICNVVRGGILQNIKWIHSK 603

Query: 861  HICFVTFIEATNAAQFFANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVY 920
             ICFVTFIEA  A QF+ANA ++PIVLHGNIL+VGWG  SG LPK+I+LAVTIGA+RNVY
Sbjct: 604  RICFVTFIEAAAAIQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVY 663

Query: 921  VSLPEFAFKDKFINNPDYEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFM 980
            VSLPE++FK+K+INNP++++YH  YKLP+E QLR+DF++YG++EQINYL+DGHCCW+NFM
Sbjct: 664  VSLPEYSFKEKYINNPEFKEYHGKYKLPSEEQLRQDFTKYGQVEQINYLDDGHCCWVNFM 723

Query: 981  NINSAITLVEEVN---EDDGIRFHNKFDGRYNGLIIGYGKDRCGNVNKNLVA 1029
            NI  AI LVE+ N   + +  +FH +FDGRY  LIIGYGKDRCGNVNKNL A
Sbjct: 724  NIAHAIRLVEDCNSLSQRNLEKFHAQFDGRYKNLIIGYGKDRCGNVNKNLTA 775

 Score = 92.8 bits (229), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 48/103 (46%), Positives = 62/103 (60%), Gaps = 7/103 (6%)

Query: 260 PLVVSYKILPKGTDEFRTRSLLLENI--NQSIDTRTLVKNFINFGPIESVYLIKLNPGSK 317
           P  V++KILPKG DE+ TRSLL  N+   ++ D    + NFI FGPIES+YL+       
Sbjct: 158 PYQVNFKILPKGKDEYMTRSLLFSNLERQENFDIHNFLTNFIKFGPIESIYLL-----DD 212

Query: 318 YNSILLSFVSREICLDFYNNVLQRLMEFXXXXXXXXXXXXFVI 360
            +SILLSF+++  CLDFYNN+LQR  EF            FV 
Sbjct: 213 SHSILLSFLTKATCLDFYNNLLQRFSEFKSKLHSTKLSVSFVC 255

 Score = 61.6 bits (148), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 29/32 (90%)

Query: 101 IPSAPPTPFDPSYGATLLPSHLLMGSPFVSTP 132
           +P  P TPFDP+YGA+LLPSH+LMGSPFVSTP
Sbjct: 79  MPPVPQTPFDPTYGASLLPSHMLMGSPFVSTP 110

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/39 (53%), Positives = 27/39 (69%)

Query: 1318 IPGSDVMSQYLTQLQHSTFMYAANILGVSAEDNNITYGD 1356
            I G DVMSQYL QL HSTF+Y+ NILG +   + + + D
Sbjct: 1023 IAGQDVMSQYLEQLHHSTFLYSTNILGATTVHDPLGFYD 1061

>NCAS0B00280 Chr2 (30005..33250) [3246 bp, 1081 aa] {ON} Anc_8.844
          Length = 1081

 Score =  334 bits (856), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 145/229 (63%), Positives = 188/229 (82%)

Query: 801  LTQTLENHFNTSTELSAVLGGGPGNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDK 860
            +++TLE H  T++++   LG   GNRT+YIGNIN RSK ED+CNVVRGGILQ + ++  K
Sbjct: 596  ISKTLEQHATTTSQVVNSLGADAGNRTIYIGNINSRSKVEDICNVVRGGILQNVKYIEHK 655

Query: 861  HICFVTFIEATNAAQFFANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVY 920
            HICF+TFIEA+ A  F+AN++IDPIVLH + LK+GWGN+  PLPK+++LAVT+GA+RNVY
Sbjct: 656  HICFITFIEASAAIHFYANSFIDPIVLHNHTLKIGWGNYVEPLPKAVALAVTVGASRNVY 715

Query: 921  VSLPEFAFKDKFINNPDYEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFM 980
            VSLPEFAFKDKFIN+P+Y++YH+ YKLP   QLR DFS+YG IEQINYL D HCCW+NF+
Sbjct: 716  VSLPEFAFKDKFINDPEYQEYHQKYKLPQADQLRIDFSKYGGIEQINYLKDSHCCWVNFL 775

Query: 981  NINSAITLVEEVNEDDGIRFHNKFDGRYNGLIIGYGKDRCGNVNKNLVA 1029
            NI++AI LVE+ +     +F  KF+ RY+GLII YGKDRCGNVNK+L++
Sbjct: 776  NISAAIRLVEDAHNPVESKFSEKFNNRYDGLIINYGKDRCGNVNKSLMS 824

 Score =  109 bits (272), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 58/119 (48%), Positives = 72/119 (60%), Gaps = 6/119 (5%)

Query: 252 DINKLLEIPLVVSYKILPKGTDEFRTRSLLLENINQSIDTRTLVKNFINFGPIESVYLI- 310
           D   L   P  +SYKILP G D +RTRSLL EN+  SI+  T +  F+ F PIESVYLI 
Sbjct: 168 DPKTLFLQPFRMSYKILPSGDDAYRTRSLLFENVVNSIELHTFMTEFVRFSPIESVYLIN 227

Query: 311 -----KLNPGSKYNSILLSFVSREICLDFYNNVLQRLMEFXXXXXXXXXXXXFVILKYE 364
                K +  ++  SILLSF++RE+CL FYNNVLQRL EF            FV +KY+
Sbjct: 228 HHDSDKPDDDTECRSILLSFLTREVCLTFYNNVLQRLKEFKAKLKSENLRLSFVSIKYQ 286

 Score = 71.2 bits (173), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 44/68 (64%), Gaps = 14/68 (20%)

Query: 97  YY--SPIPSAPPTPFDPSYGATLLPSHLLMGSPFVSTPN-------IHSFPYSATSISST 147
           YY  SP+P+ PPTPFD +YGATLLPSHLLMGSPFV+TP        I   PY       T
Sbjct: 69  YYQTSPLPNVPPTPFDTAYGATLLPSHLLMGSPFVATPTTGHSQSAIFQQPYMM-----T 123

Query: 148 PTRKSFSR 155
           P R SFS+
Sbjct: 124 PNRASFSQ 131

 Score = 65.5 bits (158), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 29/32 (90%), Positives = 30/32 (93%)

Query: 1318 IPGSDVMSQYLTQLQHSTFMYAANILGVSAED 1349
            IPGSDVM+QYL QLQHSTFMYAANILG SAED
Sbjct: 1041 IPGSDVMAQYLAQLQHSTFMYAANILGASAED 1072

 Score = 40.8 bits (94), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 23/39 (58%)

Query: 511 KFGNNYCLLTFSNILMAIEAFDYFKAKLNELNIFDCFFV 549
           +F  +Y +LTF NILMA+E  DY K       I DC FV
Sbjct: 366 EFPKHYAILTFINILMAMEICDYLKIHGPRYGIQDCMFV 404

>KNAG0G03440 Chr7 complement(736829..739990) [3162 bp, 1053 aa] {ON}
            Anc_8.844 YML117W
          Length = 1053

 Score =  331 bits (848), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 148/229 (64%), Positives = 183/229 (79%), Gaps = 1/229 (0%)

Query: 801  LTQTLENHFNTSTELSAVLGGGPGNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDK 860
            +T +LE+   TST+++  +G    NRT+YIGNINPRS+ ED+CNVVRGGILQ I F+  K
Sbjct: 578  ITDSLESQMKTSTQVATAMGSDFNNRTIYIGNINPRSRAEDICNVVRGGILQNIKFIEAK 637

Query: 861  HICFVTFIEATNAAQFFANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVY 920
            HICF+TFIEA+ A QF+ANA+IDPIVLHGN LK+GWG ++GPLPK I+LAVTIGA+RNVY
Sbjct: 638  HICFITFIEASAAVQFYANAFIDPIVLHGNTLKLGWGTYTGPLPKPIALAVTIGASRNVY 697

Query: 921  VSLPEFAFKDKFINNPDYEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFM 980
            +SLPE AFKDK+I +P ++ YHE +KLP +  LRKDF  YG IEQIN LND HCCW+NFM
Sbjct: 698  ISLPEIAFKDKYIKDPKFKIYHESFKLPAKEVLRKDFLHYGSIEQINMLNDSHCCWVNFM 757

Query: 981  NINSAITLVEEVNEDDGIRFHNKFDGRYNGLIIGYGKDRCGNVNKNLVA 1029
            NI+SAI LVE+ +      F+  FD RY GL+I YGKDRCGN+N+NLVA
Sbjct: 758  NISSAIRLVEDASTKQD-HFNQLFDHRYEGLVINYGKDRCGNINRNLVA 805

 Score =  107 bits (268), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 75/130 (57%), Gaps = 1/130 (0%)

Query: 253 INKLLEIPLVVSYKILPKGTDEFRTRSLLLENINQSIDTRTLVKNFINFGPIESVYLIKL 312
           IN L +IP  +SYKILPKG D +RTRSLLL NI+  +D  T V  F+    +ESVY+ K 
Sbjct: 152 INGLFQIPFEISYKILPKGDDLYRTRSLLLGNIDDMVDLHTFVSKFVQNNSVESVYITKE 211

Query: 313 NPGSKYNSILLSFVSREICLDFYNNVLQRLMEFXXXXXXXXXXXXFVILKYEFTDYNHPI 372
               +    LLSF+S +ICL+FYNNVLQRL EF            FV ++   T     I
Sbjct: 212 GQQPEKYGFLLSFLSVQICLNFYNNVLQRLKEFKEQLKASSLELSFVSMRQRPTKVEGKI 271

Query: 373 -NEHASDNGD 381
               A+D+GD
Sbjct: 272 YRRFAADDGD 281

 Score = 64.7 bits (156), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/48 (64%), Positives = 36/48 (75%)

Query: 99  SPIPSAPPTPFDPSYGATLLPSHLLMGSPFVSTPNIHSFPYSATSISS 146
           SP+ +  PTPFD +YGATLLPSHLLMGSPFVSTPN+    Y+A    S
Sbjct: 84  SPMTNGMPTPFDTAYGATLLPSHLLMGSPFVSTPNLPQTNYTAQRKGS 131

 Score = 59.3 bits (142), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 26/31 (83%), Positives = 28/31 (90%)

Query: 1318 IPGSDVMSQYLTQLQHSTFMYAANILGVSAE 1348
            IPGSDVM+QYL QLQHSTFMYAAN+LG S E
Sbjct: 1015 IPGSDVMAQYLAQLQHSTFMYAANVLGASNE 1045

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 27/42 (64%)

Query: 512 FGNNYCLLTFSNILMAIEAFDYFKAKLNELNIFDCFFVSKTN 553
           FG NY ++TF +I MA+E  DY K  + +L++   F+V  T+
Sbjct: 348 FGKNYAIITFLSIPMAMEIMDYLKLNIKQLHLTKFFYVQVTH 389

>ABL122C Chr2 complement(167005..170136) [3132 bp, 1043 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YML117W
          Length = 1043

 Score =  330 bits (845), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 152/232 (65%), Positives = 183/232 (78%), Gaps = 7/232 (3%)

Query: 801  LTQTLENHFNTSTELSAVLGGGPGNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDK 860
            + QTL+  +       A    G  NRTVYIGNI+PRSKPED+CNVVRGGILQ I ++  K
Sbjct: 535  IGQTLQRQYLAG----ASQANGINNRTVYIGNIHPRSKPEDICNVVRGGILQTIKWISSK 590

Query: 861  HICFVTFIEATNAAQFFANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVY 920
             ICFVTFIE   A QF+ANA ++PIVLHGNIL+VGWG  SG LPK+I+LAVTIGA+RNVY
Sbjct: 591  RICFVTFIETAAAVQFYANASLEPIVLHGNILRVGWGQPSGELPKNIALAVTIGASRNVY 650

Query: 921  VSLPEFAFKDKFINNPDYEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFM 980
            VSLPE++FK+K+INNP+++ YH  YKLP E QLR+DF++YG++EQINYL DGHCCW+NFM
Sbjct: 651  VSLPEYSFKEKYINNPEFKLYHGKYKLPTEEQLRQDFTKYGQVEQINYLEDGHCCWVNFM 710

Query: 981  NINSAITLVEEVN---EDDGIRFHNKFDGRYNGLIIGYGKDRCGNVNKNLVA 1029
            NI  AI LVE+ N   E +  +FH +FDGRY  LIIGYGKDRCGNVNKNL A
Sbjct: 711  NIAHAIRLVEDSNSPIEKNLEKFHAQFDGRYKNLIIGYGKDRCGNVNKNLAA 762

 Score = 92.0 bits (227), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 78/142 (54%), Gaps = 10/142 (7%)

Query: 222 LKDDNSYRISQQTFKENPMIIE-KPKYSSVIDINKLLEIPLVVSYKILPKGTDEFRTRSL 280
           L    S R S   + + PM+    P+    + +N     P  +++KILPKG DE+ TRSL
Sbjct: 106 LHHAQSARSSFLYYPQPPMLKPIPPRRKKSVTLNH--SEPYHINFKILPKGKDEYMTRSL 163

Query: 281 LLENIN--QSIDTRTLVKNFINFGPIESVYLIKLNPGSKYNSILLSFVSREICLDFYNNV 338
           LL N+   + +D    + +F+ FGP+ES+YL+  N     +SILLSF+++  CLDFYNN+
Sbjct: 164 LLTNLEMLRDLDIHNFLNSFVKFGPVESIYLMDDN-----HSILLSFLTKATCLDFYNNL 218

Query: 339 LQRLMEFXXXXXXXXXXXXFVI 360
           LQR  EF            FV 
Sbjct: 219 LQRFSEFKTKLHSPKLSVSFVC 240

 Score = 59.3 bits (142), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 29/32 (90%)

Query: 101 IPSAPPTPFDPSYGATLLPSHLLMGSPFVSTP 132
           +P  P TPFDP+YGA+LLPSH+LMGSPF+STP
Sbjct: 56  MPPVPQTPFDPTYGASLLPSHMLMGSPFLSTP 87

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 23/29 (79%)

Query: 1318 IPGSDVMSQYLTQLQHSTFMYAANILGVS 1346
            I G DVMSQYL QL HSTF+YA NILG +
Sbjct: 997  IAGQDVMSQYLEQLHHSTFLYATNILGAT 1025

>KLLA0D01485g Chr4 (129351..132806) [3456 bp, 1151 aa] {ON} similar to
            uniprot|Q03735 Saccharomyces cerevisiae YML117W NAB6
            Putative RNA-binding protein based on computational
            analysis of large-scale protein-protein interaction data
          Length = 1151

 Score =  319 bits (818), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 143/228 (62%), Positives = 181/228 (79%), Gaps = 3/228 (1%)

Query: 801  LTQTLENHFNTSTELSAVLGGGPGNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDK 860
            +TQT++N ++ S +    +  G  +RTVYIGNINPRSK ED+CNVVRGGILQ I ++  K
Sbjct: 624  ITQTIQNQYSKSIQ---AVNAGMEHRTVYIGNINPRSKAEDICNVVRGGILQHIKWVSHK 680

Query: 861  HICFVTFIEATNAAQFFANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVY 920
             ICFVTFIE   A QF+AN  ++PI+LHGN+LKVGWG + GPLPK+I+LAVT+GA+RNVY
Sbjct: 681  RICFVTFIETAAAVQFYANTTLEPIILHGNVLKVGWGQNPGPLPKNIALAVTVGASRNVY 740

Query: 921  VSLPEFAFKDKFINNPDYEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFM 980
            VSLP+ AFKDKFIN+P +++Y   YK+PN  QL+ DF  YG +EQ+N+ +DGHCCWINFM
Sbjct: 741  VSLPDKAFKDKFINDPQFKEYQNRYKIPNIAQLKSDFGAYGTMEQVNFHSDGHCCWINFM 800

Query: 981  NINSAITLVEEVNEDDGIRFHNKFDGRYNGLIIGYGKDRCGNVNKNLV 1028
            NI+SAI LVEE ++     FH K +GRY GLIIGYGKDRCGN+N+NLV
Sbjct: 801  NISSAIKLVEEYSDTKDNLFHKKTEGRYVGLIIGYGKDRCGNINRNLV 848

 Score = 63.9 bits (154), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/157 (28%), Positives = 61/157 (38%), Gaps = 52/157 (33%)

Query: 258 EIPLVVSYKILPKGTDEFRTRSLLLENINQSIDTRTLVKNFINFGPIESVYLIK------ 311
           E+ +   Y ILPKG D +R+RSLL  N+N  +D    ++      PIES+YLIK      
Sbjct: 212 ELKIQFQYSILPKGNDTYRSRSLLFTNVNSELDIVEFLQKVAKNYPIESIYLIKDEDTGD 271

Query: 312 ---------------------------------------------LNPGS-KYNSILLSF 325
                                                        ++P S    S LLSF
Sbjct: 272 DIENLNTSNNDDDPNQNYNADNNNNSKREDDKDKESAPALTKQIAISPSSCSQQSYLLSF 331

Query: 326 VSREICLDFYNNVLQRLMEFXXXXXXXXXXXXFVILK 362
            ++E CLDFYNN+LQR  E             FV ++
Sbjct: 332 FTKESCLDFYNNLLQRYAEIKNAVKSDQLAMNFVKIQ 368

 Score = 55.5 bits (132), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/46 (56%), Positives = 30/46 (65%)

Query: 103 SAPPTPFDPSYGATLLPSHLLMGSPFVSTPNIHSFPYSATSISSTP 148
           S P TPFDP YG TLLPSHLL+GSPFV+TP       + T  +  P
Sbjct: 67  SIPQTPFDPVYGITLLPSHLLVGSPFVNTPQTGGPMSAGTGANGVP 112

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/31 (64%), Positives = 26/31 (83%)

Query: 1318 IPGSDVMSQYLTQLQHSTFMYAANILGVSAE 1348
            I GSDVM++YL QL H+TF+YAANILG + +
Sbjct: 1112 IAGSDVMTRYLEQLHHNTFVYAANILGATQD 1142

>CAGL0C01419g Chr3 complement(153063..154982) [1920 bp, 639 aa] {ON}
            similar to uniprot|Q08925 Saccharomyces cerevisiae
            YPL184c
          Length = 639

 Score =  184 bits (467), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 129/206 (62%), Gaps = 24/206 (11%)

Query: 821  GGP---GNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFF 877
            GGP   GNRTVY+GN+    K E++CN VRGG+LQ I  L D+H+CFVTFI+ T AAQF+
Sbjct: 450  GGPNNLGNRTVYLGNLPKGVKIEEICNAVRGGLLQSIKLLDDRHVCFVTFIDPTAAAQFY 509

Query: 878  ANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINNPD 937
            A + +    +     KVGWG HSGPLP +++LAV+ GA+RNVY+   +F          D
Sbjct: 510  AMSSLYGFTIQRQRCKVGWGKHSGPLPNALALAVSNGASRNVYLGNIDF--------EAD 561

Query: 938  YEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVNEDDG 997
             +K   I+   NE  LR  F +YGE+EQIN+L +  CC+INF NIN+AI  ++++     
Sbjct: 562  SKKEQPIF---NETALRAIFQEYGEVEQINFLVEKKCCFINFTNINNAIFAMDKI----- 613

Query: 998  IRFHNKFDGRYNGLIIGYGKDRCGNV 1023
                 K +  +  L I +GKDRCGNV
Sbjct: 614  -----KSNPHFKSLKINFGKDRCGNV 634

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 61/200 (30%), Positives = 99/200 (49%), Gaps = 20/200 (10%)

Query: 826  RTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFFANAYIDPI 885
            RTVY+GNI P    ++L + VR G++++   L +K   F++F+E ++A  F ++A +  +
Sbjct: 224  RTVYLGNIPPSLTIKELLDHVRSGVVEEAKILPEKMCAFISFVEESSALLFHSDAILKRL 283

Query: 886  VLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINNPDYEKYHEIY 945
             +    +KVGWG  +   P   S  +  GA RNVY+             N D        
Sbjct: 284  NIDNRDIKVGWGKPTVLDPSIASRIINDGATRNVYIGQ----------GNNDRSSKENKE 333

Query: 946  KLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVNEDDGIRFHNKFD 1005
             L  E +LR+D  +YGEI+ I  + +    +++F +I +AI +V  + +       N F 
Sbjct: 334  PLTEE-KLREDLKEYGEIDSIKIIPEKDIAFVHFSSIATAIKVVSTLAQK------NPF- 385

Query: 1006 GRYNGLIIGYGKDRCGNVNK 1025
              Y    I YGKDRC  + K
Sbjct: 386  --YQEKKIFYGKDRCAFITK 403

>AFL061C Chr6 complement(317447..319018) [1572 bp, 523 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YPL184C
          Length = 523

 Score =  179 bits (455), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 89/205 (43%), Positives = 128/205 (62%), Gaps = 21/205 (10%)

Query: 824  GNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFFANAYID 883
            GNRT+Y+GN+    K E++CN VRGG+LQ I  L D+H+CFVTFI+ T AAQF+A + + 
Sbjct: 340  GNRTIYLGNLPKDVKLEEICNSVRGGLLQHIKLLSDRHVCFVTFIDPTAAAQFYAMSSLH 399

Query: 884  PIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINNPDYEKYHE 943
             + +H    K+GWG HSGPLP  ++LAV+ GA+RN+Y+   +FA         D +  H 
Sbjct: 400  GLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFA--------ADKKSQHP 451

Query: 944  IYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVNEDDGIRFHNK 1003
            I+    E  LR  F ++GE+EQIN+L + +CC+INF NI+SAI  ++++          K
Sbjct: 452  IF---TEAALRAVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKI----------K 498

Query: 1004 FDGRYNGLIIGYGKDRCGNVNKNLV 1028
                +  L I +GKDRCGNV +   
Sbjct: 499  SIPTFKDLKINFGKDRCGNVPRQFC 523

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 55/204 (26%), Positives = 99/204 (48%), Gaps = 20/204 (9%)

Query: 825  NRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFFANAYIDP 884
            +RTVY+GN+ P    ++L + VR G+++++  L +K   F++F+E  +A  F ++A +  
Sbjct: 102  SRTVYLGNVPPYITTKELLDHVRSGVVEEVKILPEKMCAFISFVEENSALLFHSDAILKR 161

Query: 885  IVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINNPDYEKYHEI 944
            + +    +K+GWG  +   P   +     GA RNVY+         K   N D      +
Sbjct: 162  LNIDDRDIKIGWGKPTQIDPIVAAGITNDGATRNVYIG--------KLNTNKDICAQWGV 213

Query: 945  ---YKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVNEDDGIRFH 1001
                ++  E +LR D S +GE+E +  + +    +++F +I +AI +V  +   +     
Sbjct: 214  DPNEEVITEEKLRNDLSDFGEVENVKIVPEKGIAFVHFSSIFAAIKVVANLANINPYYAQ 273

Query: 1002 NKFDGRYNGLIIGYGKDRCGNVNK 1025
             K         I YGKDRC  + K
Sbjct: 274  KK---------IFYGKDRCAFITK 288

>NCAS0H01040 Chr8 complement(194824..196713) [1890 bp, 629 aa] {ON}
            Anc_6.183
          Length = 629

 Score =  181 bits (460), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 92/206 (44%), Positives = 132/206 (64%), Gaps = 24/206 (11%)

Query: 821  GGP---GNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFF 877
            GGP   GNRTVY+GN+    K E++CNVVRGG+LQ +  L D+++CFVTFI+ T AAQF+
Sbjct: 440  GGPNNLGNRTVYLGNLPKDIKIEEICNVVRGGLLQSVKLLSDRYVCFVTFIDPTAAAQFY 499

Query: 878  ANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINNPD 937
            A + +  + +     KVGWG HSGPLP +++LAV+ GA+RNVY+      F+   + +P 
Sbjct: 500  AMSSLHGLTIQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYIG--NINFEKDAMRDP- 556

Query: 938  YEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVNEDDG 997
                    ++  E  LRK F QYGE+EQIN+L + +CC+INF NI++AI  ++++     
Sbjct: 557  --------RIFTEDSLRKLFRQYGEVEQINFLPEKNCCFINFTNISNAILALDKI----- 603

Query: 998  IRFHNKFDGRYNGLIIGYGKDRCGNV 1023
                 K +  +  L I +GKDRCGNV
Sbjct: 604  -----KSNPHFEDLKINFGKDRCGNV 624

 Score = 85.1 bits (209), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 96/201 (47%), Gaps = 20/201 (9%)

Query: 825  NRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFFANAYIDP 884
            +RTVY+GNI      ++L + VR G+++ +  + +K   F++F++ ++A  F ++A +  
Sbjct: 213  SRTVYLGNIPSNLTVKELLDHVRSGVVEDVKIIPEKLCAFISFVDESSALLFHSDAILKR 272

Query: 885  IVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINNPDYEKYHEI 944
            + + G  +K+GWG  +   P   +  +   A RNV++        D     P        
Sbjct: 273  LNIGGKDIKIGWGKPTTVDPMISARIINDDATRNVFIGHLNKTDNDSCTKEPI------- 325

Query: 945  YKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVNEDDGIRFHNKF 1004
                 E +LR+D   +GEIE +  + +    +++F +I SAI  V        +R  N +
Sbjct: 326  ----TEAKLREDLEDFGEIETVKIIPEKGIAFVHFSSITSAIKCVHN------LRSMNPY 375

Query: 1005 DGRYNGLIIGYGKDRCGNVNK 1025
               Y    I YGKDRC  + K
Sbjct: 376  ---YENKKIAYGKDRCAFITK 393

>TBLA0B05210 Chr2 complement(1225521..1227653) [2133 bp, 710 aa] {ON}
            Anc_6.183 YPL184C
          Length = 710

 Score =  182 bits (462), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 94/206 (45%), Positives = 129/206 (62%), Gaps = 23/206 (11%)

Query: 821  GGP---GNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFF 877
            GGP   GNRTVY+GN+    K +++CN VRGG+LQ I  L D+H+CFVTFI+ T AAQF+
Sbjct: 520  GGPNNLGNRTVYLGNLPVDVKIDEICNAVRGGLLQHIKLLTDRHVCFVTFIDPTAAAQFY 579

Query: 878  ANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINNPD 937
            A + +  + +     KVGWG HSGPLP  I+LAV+ GA+RNVY+   +F    K  N P 
Sbjct: 580  AMSSLHGLSIQKKRCKVGWGKHSGPLPNLIALAVSNGASRNVYLGNIDFENDIKLHNPPI 639

Query: 938  YEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVNEDDG 997
            +           EL LR  F QYG++EQIN+L + +CC+INF NI++AI  +E++     
Sbjct: 640  FT----------ELSLRNIFQQYGDVEQINFLPEKNCCFINFTNISNAILAIEKI----- 684

Query: 998  IRFHNKFDGRYNGLIIGYGKDRCGNV 1023
                 K +  +  L I +GKDRCGN+
Sbjct: 685  -----KNNPDFKDLKINFGKDRCGNI 705

 Score = 90.1 bits (222), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 69/236 (29%), Positives = 108/236 (45%), Gaps = 30/236 (12%)

Query: 810  NTSTELSAV-----LGGGPGNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICF 864
            NTS + S +      G  P  RTVY+GNI      +DL + VR G+++ I  L DK   F
Sbjct: 248  NTSIQTSTLPNNNTFGNTPS-RTVYLGNIPSDLSVKDLLDHVRSGVVENIKILPDKMCAF 306

Query: 865  VTFIEATNAAQFFANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVS-- 922
            ++F++ ++A  F ++A +  + + G  +K+GWG  +   P   +  VT GA RNVY+   
Sbjct: 307  ISFVDESSALLFHSDAILKRLNIGGRDIKIGWGKPTPIDPIVATSIVTDGATRNVYIGQL 366

Query: 923  ------------LPEFAFKDKFINNPDYEKYHEIYKLP-NELQLRKDFSQYGEIEQINYL 969
                                    + D EK   I   P  E +LR+D   YGEI+ +  +
Sbjct: 367  SNSSNNNTSSSSSSTSPSSPSNNTSDDLEKKKNIDDSPLTEEKLREDLKDYGEIDCVKIV 426

Query: 970  NDGHCCWINFMNINSAITLVEEVNEDDGIRFHNKFDGRYNGLIIGYGKDRCGNVNK 1025
             D    +++  +I SAI +V  + + +           Y    I YGKDRC  + K
Sbjct: 427  QDKGFAFVHMSSILSAIKVVNNLAQTNPY---------YQNKRIFYGKDRCAFITK 473

>KAFR0B06690 Chr2 (1394829..1396430) [1602 bp, 533 aa] {ON} Anc_6.183
            YPL184C
          Length = 533

 Score =  177 bits (450), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 90/206 (43%), Positives = 129/206 (62%), Gaps = 28/206 (13%)

Query: 821  GGP---GNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFF 877
            GGP   GNRT+Y+GN+    K E++CNVVRGG+LQ I  L D+  CF+TFI+ T AAQF+
Sbjct: 348  GGPNNLGNRTIYLGNLPKGVKIEEICNVVRGGLLQNIKLLSDRFACFITFIDPTAAAQFY 407

Query: 878  ANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINNPD 937
            A + +  + +  N  KVGWG HSGPL  +++LA++ GA+RN+Y            I N D
Sbjct: 408  AMSSLHGLTIQKNRCKVGWGKHSGPLSNALALAISNGASRNIY------------IGNVD 455

Query: 938  YEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVNEDDG 997
            +EK +E +   NE  LR+ F ++GE+EQIN+L +  CC++NF NIN AI  ++++     
Sbjct: 456  FEKKNEYF---NEEHLREIFEEFGEVEQINFLREKGCCFVNFTNINHAILALDKI----- 507

Query: 998  IRFHNKFDGRYNGLIIGYGKDRCGNV 1023
                 K    +  L I +GKDRCGN+
Sbjct: 508  -----KSLPEFEDLKINFGKDRCGNI 528

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 103/201 (51%), Gaps = 28/201 (13%)

Query: 826  RTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFFANAYIDPI 885
            RTVY+GNI      ++L + VR G+++ +  L  K   F++FI+   A  F ++A +  +
Sbjct: 128  RTVYLGNIPQGLTIKELLDHVRSGVVESVKILPTKLCAFISFIDERGALLFHSDAILKRL 187

Query: 886  VLHGNILKVGWGNHSGPLPKSISLAVT-IGANRNVYVSLPEFAFKDKFINNPDYEKYHEI 944
             + G  +K+GWG  S  +   ++  +T  GA RNVY+         +  ++P        
Sbjct: 188  NIRGKDIKIGWGK-SNHIDSIVAARITNDGATRNVYIG--------QLNDDP-------- 230

Query: 945  YKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVNEDDGIRFHNKF 1004
              +  E +L KD  ++GEI+ I +L++    +++F +I+ AI +V+ +         +K 
Sbjct: 231  -TITTEQELEKDMQKFGEIDCIKFLSNKGIAFVHFASISVAIYVVQNL---------SKL 280

Query: 1005 DGRYNGLIIGYGKDRCGNVNK 1025
            + +Y    I YGKDRC  + K
Sbjct: 281  NEKYKNKRIFYGKDRCAFITK 301

>NDAI0F02260 Chr6 (546978..549020) [2043 bp, 680 aa] {ON} Anc_6.183
          Length = 680

 Score =  179 bits (453), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 92/206 (44%), Positives = 133/206 (64%), Gaps = 24/206 (11%)

Query: 821  GGP---GNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFF 877
            GGP   GNRT+Y+GN+    + E++CNVVRGG+LQ +  L D+++CFVTFI+ T AAQFF
Sbjct: 491  GGPNNLGNRTIYLGNLPKDIRVEEICNVVRGGLLQSVKLLGDRYVCFVTFIDPTAAAQFF 550

Query: 878  ANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINNPD 937
            A + +  + +     KVGWG HSGPL  +++LAV+ GA+RN+Y+   +FA  DK  +NP 
Sbjct: 551  AMSSLHGLTIQKKRCKVGWGKHSGPLSNALALAVSHGASRNIYIGNIDFA-TDKKRDNPI 609

Query: 938  YEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVNEDDG 997
            +           E  LRK FS YGE+EQIN+L + +CC+INF NI++AI  ++++     
Sbjct: 610  F----------TEDSLRKMFSMYGEMEQINFLPEKNCCFINFTNISNAILALDKI----- 654

Query: 998  IRFHNKFDGRYNGLIIGYGKDRCGNV 1023
                 K +  +  L I +GKDRCGN+
Sbjct: 655  -----KSNPVFKDLKINFGKDRCGNI 675

 Score = 81.6 bits (200), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 60/232 (25%), Positives = 104/232 (44%), Gaps = 41/232 (17%)

Query: 826  RTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFFANAYIDPI 885
            RTVY+GNI      ++L + VR G+++ +  + +K   F++F++  +A  F ++A +  +
Sbjct: 222  RTVYLGNIPSDLTVKELLDHVRSGVIEDVKIIPEKLCAFISFLDENSALLFHSDAILKRL 281

Query: 886  VLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVS-LPEFAF---KDKFINNPDYEKY 941
             ++G  +K+GWG  +   P   +  +  GA RNV++  L   +F   K K    P    +
Sbjct: 282  NINGKDIKIGWGKSTAVDPMIATRIINDGATRNVFIGQLKTKSFDPNKAKVTKMPPSRNH 341

Query: 942  HEIYKLPNE----------------------------LQLRKDFSQYGEIEQINYLNDGH 973
                 + NE                             +LRKD + +G+I+ I  + D  
Sbjct: 342  DINATISNENDEKENGVDTAHVEGEVEVGEEEEPISDAKLRKDLADFGDIDCIKIVEDKG 401

Query: 974  CCWINFMNINSAITLVEEVNEDDGIRFHNKFDGRYNGLIIGYGKDRCGNVNK 1025
              +I+F +I SAI  V  +N           +  Y+   I YGKDRC  + K
Sbjct: 402  IAFIHFASITSAIKCVHNLNS---------MNDYYSTKKIFYGKDRCAFITK 444

>SAKL0A05280g Chr1 complement(475021..476769) [1749 bp, 582 aa] {ON}
            similar to uniprot|Q08925 Saccharomyces cerevisiae
            YPL184C Hypothetical ORF
          Length = 582

 Score =  177 bits (448), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 128/200 (64%), Gaps = 21/200 (10%)

Query: 824  GNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFFANAYID 883
            GNRTVY+GN+    K E++CN VRGG+LQ +  L D+H+CFVTFI+ T AAQF+A + + 
Sbjct: 399  GNRTVYLGNLPKDVKIEEICNAVRGGLLQSVKLLSDRHVCFVTFIDPTAAAQFYAMSSLH 458

Query: 884  PIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINNPDYEKYHE 943
             + +H    K+GWG HSG LP +++LAV+ GA+RN+YV   +F   D        E    
Sbjct: 459  GLTIHNKRCKIGWGKHSGSLPNALALAVSHGASRNIYVGNIDFNAID--------ETGET 510

Query: 944  IYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVNEDDGIRFHNK 1003
            I+    E  LR+ F ++GE+EQIN+L++ +CC+INF NI++AI  ++++          K
Sbjct: 511  IF---TEQNLRETFQEFGEVEQINFLHEKNCCFINFTNISNAILAIDKI----------K 557

Query: 1004 FDGRYNGLIIGYGKDRCGNV 1023
             +  +  L + +GKDRCGNV
Sbjct: 558  CNPYFKNLKVNFGKDRCGNV 577

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 63/205 (30%), Positives = 107/205 (52%), Gaps = 22/205 (10%)

Query: 825  NRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFFANAYIDP 884
            +RTVY+GNI P    + L + VR G+++++  L D+   F++F++ ++A  F ++A +  
Sbjct: 160  SRTVYLGNIPPFLPAKQLLDHVRSGVIEELKILPDRMCAFISFVDESSALLFHSDAILKR 219

Query: 885  IVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSL----PEFAFKDKFINNPDYEK 940
            + + G  +KVGWG  +   P   +   + GA RNVY+      P+ A   +F  +P+ E 
Sbjct: 220  LNIEGRDIKVGWGKPTPIDPIVAAGIASDGATRNVYIGRLNTDPQLA--PQFGTDPNEE- 276

Query: 941  YHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVNEDDGIRF 1000
                  + +E +LRKD + +GEIE I  + D    +++F +I SAI +V  +        
Sbjct: 277  ------IVSEEKLRKDLNDFGEIESIKIVRDKGIAFVHFSSIFSAIKVVSNLAS------ 324

Query: 1001 HNKFDGRYNGLIIGYGKDRCGNVNK 1025
                +  Y    I YGKDRC  + K
Sbjct: 325  ---VNPYYTNKKIFYGKDRCAFITK 346

>Ecym_2233 Chr2 complement(453154..454884) [1731 bp, 576 aa] {ON}
            similar to Ashbya gossypii AFL061C
          Length = 576

 Score =  177 bits (448), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 87/205 (42%), Positives = 127/205 (61%), Gaps = 21/205 (10%)

Query: 824  GNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFFANAYID 883
            GNRT+Y+GN+    K E++CN VRGG+LQ I  L D+H+CFVTFI+ T AAQF+A + + 
Sbjct: 393  GNRTIYLGNLPKDVKLEEICNSVRGGLLQHIKLLNDRHVCFVTFIDPTAAAQFYAMSSLH 452

Query: 884  PIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINNPDYEKYHE 943
             + +H    K+GWG HSGPLP  ++LAV+ GA+RN+Y+   +F   D+ +  P +     
Sbjct: 453  GLTIHNKRCKIGWGKHSGPLPNPLALAVSRGASRNIYLGNIDFE-DDRKLEQPIF----- 506

Query: 944  IYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVNEDDGIRFHNK 1003
                  E  LR  F ++GE+EQIN+L + +CC+INF NI+SAI  ++++          K
Sbjct: 507  -----TETSLRSVFQEFGEVEQINFLYERNCCFINFANISSAILAIDKI----------K 551

Query: 1004 FDGRYNGLIIGYGKDRCGNVNKNLV 1028
                +  L I +GKDRCGNV +   
Sbjct: 552  SIPTFKDLKINFGKDRCGNVPRQFC 576

 Score = 79.3 bits (194), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 98/206 (47%), Gaps = 24/206 (11%)

Query: 825  NRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFFANAYIDP 884
            +RTVY+GN+ P     +L + VR G+++ +  L +K   F++F++  +A  F ++A +  
Sbjct: 155  SRTVYLGNVPPYITTRELLDHVRSGVVEDVKILPEKMCAFISFVDENSALLFHSDAILKR 214

Query: 885  IVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINNPDYEKYHEI 944
            + +    +K+GWG  +   P   +     GA RNVY+         K   NP  +   + 
Sbjct: 215  LNIDDRDIKIGWGKPTQIDPIVAAGINNDGATRNVYLG--------KLNTNP--KMCAQW 264

Query: 945  YKLPN-----ELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVNEDDGIR 999
               PN     E +LR D + +GE+E +  + +    +++F +I SAI +V  +   +   
Sbjct: 265  GADPNEETITEEKLRNDLADFGEVESVKIVTEKGIAFVHFSSIFSAIKVVANLANVNPYY 324

Query: 1000 FHNKFDGRYNGLIIGYGKDRCGNVNK 1025
               K         I YGKDRC  + K
Sbjct: 325  AQKK---------IFYGKDRCAFITK 341

>Kpol_1002.69 s1002 complement(185133..186905) [1773 bp, 590 aa] {ON}
            complement(185133..186905) [1773 nt, 591 aa]
          Length = 590

 Score =  177 bits (448), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 90/206 (43%), Positives = 130/206 (63%), Gaps = 24/206 (11%)

Query: 821  GGP---GNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFF 877
            GGP   GNRTVY+GN+    K E++CN VR G+LQ +  L D+H+CFVTFI+ T AAQF+
Sbjct: 401  GGPNNLGNRTVYLGNLPKGIKIEEICNTVRSGLLQSVKLLSDRHVCFVTFIDPTAAAQFY 460

Query: 878  ANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINNPD 937
            A + +  ++L     KVGWG HSGPLP  I+LAV+ GA+RNVY+   +F          D
Sbjct: 461  AMSSLHGLILQRKRCKVGWGKHSGPLPNLIALAVSNGASRNVYIGNIDF--------EED 512

Query: 938  YEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVNEDDG 997
             ++   ++    E  LRK F +YGE+EQIN+L   +CC+IN+ NI++AI+ ++++     
Sbjct: 513  SKRNERVF---TEDNLRKLFQEYGEVEQINFLPSKNCCFINYTNISNAISAIDKI----- 564

Query: 998  IRFHNKFDGRYNGLIIGYGKDRCGNV 1023
                 K +  +  L I +GKDRCGN+
Sbjct: 565  -----KSNPYFKDLKINFGKDRCGNI 585

 Score = 84.0 bits (206), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 68/230 (29%), Positives = 115/230 (50%), Gaps = 23/230 (10%)

Query: 797  THNNLTQTLENHFNTSTELSAVLGGGPGNRTVYIGNINPRSKPEDLCNVVRGGILQKIVF 856
            T NNL   L+N F +    ++       +RTVY+GNI      ++L + VR G+++ +  
Sbjct: 147  TENNLP--LQNSFESPVNFTSA-----PSRTVYLGNIPTTLTVKELLDHVRSGVVEDVKI 199

Query: 857  LRDKHICFVTFIEATNAAQFFANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGAN 916
            L +K   F++F++ ++A  F ++A +  + + G  +K+GWG  +   P   +   T GA 
Sbjct: 200  LPEKMCAFISFVDDSSALLFHSDAILKRLNIEGRDIKIGWGKPTKIDPIVANGITTDGAT 259

Query: 917  RNVYVS-LPEFAFKDKFINNPDYEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCC 975
            RNVY+  L   A   + +N P   K  EI     E +L  D   YG+I+ +  + +    
Sbjct: 260  RNVYIGQLYTDAEVAESLNIP---KESEIV---TEERLIADLEIYGDIDSVKIVKEKGIA 313

Query: 976  WINFMNINSAITLVEEVNEDDGIRFHNKFDGRYNGLIIGYGKDRCGNVNK 1025
            +I+F +I SAI +V      + +   N++   Y    I YGKDRC  + K
Sbjct: 314  FIHFASILSAIKVV------NNLAASNRY---YQNRKIFYGKDRCAFITK 354

>Kwal_27.11158 s27 (665984..667687) [1704 bp, 567 aa] {ON} YPL184C -
            Hypothetical ORF [contig 30] FULL
          Length = 567

 Score =  175 bits (443), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 128/200 (64%), Gaps = 21/200 (10%)

Query: 824  GNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFFANAYID 883
            GNRT+Y+GN+    K E++CNVVRGG+LQ I  L D+H+CFVTFI+ T AAQ +A A + 
Sbjct: 384  GNRTIYLGNLPKDVKIEEICNVVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMASLH 443

Query: 884  PIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINNPDYEKYHE 943
             + +H    K+GWG HSG L  +++LAV+ GA+RN+Y+   +F          D E  H 
Sbjct: 444  GLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIYLGNIDF--------KADSETEHP 495

Query: 944  IYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVNEDDGIRFHNK 1003
            I+    E  LR  F ++GE+EQIN+L + +CC++NF NI++AI  ++++          K
Sbjct: 496  IF---TEQNLRSIFEEFGEVEQINFLIERNCCFVNFTNISNAILAIDKI----------K 542

Query: 1004 FDGRYNGLIIGYGKDRCGNV 1023
             + +++ L I +GKDRCGNV
Sbjct: 543  NNPQFSDLKINFGKDRCGNV 562

 Score = 97.8 bits (242), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 62/203 (30%), Positives = 102/203 (50%), Gaps = 18/203 (8%)

Query: 825  NRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFFANAYIDP 884
            +RTVY+GNI P  +   L + VR G+++ I  LR+K   F++F++ ++A  F ++A +  
Sbjct: 145  SRTVYLGNIPPNLEARQLLDHVRSGVVEDIRILREKMCAFISFLDESSALLFHSDAILKR 204

Query: 885  IVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSL--PEFAFKDKFINNPDYEKYH 942
            + + G  +K+GWG  +   P   S     GA RNVY+     + +F  +   +P  E   
Sbjct: 205  LNIDGRDIKIGWGKPTPIDPVVTSAVANDGATRNVYIGRLNTDSSFAPQIGADPRDE--- 261

Query: 943  EIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVNEDDGIRFHN 1002
                +  E +LR D S YGEIE +  + +    +++F +I SAI +V  +          
Sbjct: 262  ----VVTEQKLRDDLSFYGEIESVKIITEKGIAFVHFCSIFSAIKVVSSL---------A 308

Query: 1003 KFDGRYNGLIIGYGKDRCGNVNK 1025
              +  Y    I YGKDRC  + K
Sbjct: 309  AVNPYYANKKIFYGKDRCAFITK 331

>KLLA0E19031g Chr5 (1694566..1696524) [1959 bp, 652 aa] {ON} similar
            to uniprot|Q08925 Saccharomyces cerevisiae YPL184C
            Hypothetical ORF
          Length = 652

 Score =  176 bits (445), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 126/200 (63%), Gaps = 21/200 (10%)

Query: 824  GNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFFANAYID 883
            GNRTVY+GN+    K E++CN +RGG+LQ I  L D+H+CFVTFI+ T AAQF+A + + 
Sbjct: 470  GNRTVYLGNLPKNVKLEEICNAIRGGLLQNIKLLNDRHVCFVTFIDPTAAAQFYAMSSLH 529

Query: 884  PIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINNPDYEKYHE 943
             + +H    K+GWG HSGPLP  I+LAV+ GA+RN+Y+    F          D ++   
Sbjct: 530  GLTIHNKRCKIGWGKHSGPLPNPIALAVSRGASRNIYLGNINF--------EEDAKQEES 581

Query: 944  IYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVNEDDGIRFHNK 1003
            ++    E  LR  F ++G +EQIN+L + +CC+INF NI++AI  ++++          K
Sbjct: 582  VFA---EDTLRAIFEEFGTVEQINFLYEKNCCFINFANISNAILAIDKI----------K 628

Query: 1004 FDGRYNGLIIGYGKDRCGNV 1023
             +  +N L I +GKDRCGNV
Sbjct: 629  SNPHFNNLKINFGKDRCGNV 648

 Score = 88.2 bits (217), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 62/204 (30%), Positives = 99/204 (48%), Gaps = 20/204 (9%)

Query: 825  NRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFFANAYIDP 884
            +RTVY+GNI      + L + VR G+++++  L +K   FV+F++  +A  F ++A +  
Sbjct: 232  SRTVYLGNIPATITYKALLDYVRTGVVEEVKILSEKMCAFVSFVDENDALLFHSDAILKR 291

Query: 885  IVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINNPD-YEKYHE 943
            + + G  +K+GWG      P   +     GA RNVY+         K   N D  EK+  
Sbjct: 292  LNIDGRDIKIGWGKPQPIDPIVRAGIANDGATRNVYIG--------KLNTNKDSCEKWGA 343

Query: 944  IYK--LPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVNEDDGIRFH 1001
              K  L  + +L  D SQ+GEIE I  + D    +++F +I +AI  V  +         
Sbjct: 344  DPKEILVTKEKLYDDLSQFGEIESIKLVEDRGIAFVHFTSIFAAIKAVANIGS------- 396

Query: 1002 NKFDGRYNGLIIGYGKDRCGNVNK 1025
               D  Y+   + YGKDRC  + K
Sbjct: 397  --IDPYYSNKKVFYGKDRCAFITK 418

>KNAG0M00430 Chr13 complement(63427..64758) [1332 bp, 443 aa] {ON}
            Anc_6.183 YPL184C
          Length = 443

 Score =  169 bits (428), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 87/206 (42%), Positives = 126/206 (61%), Gaps = 26/206 (12%)

Query: 821  GGP---GNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFF 877
            GGP   GNRT+Y+GN++ R + E++CNVVRGG+LQ + FL D+H+CFVTF + T AAQF+
Sbjct: 257  GGPNNLGNRTIYVGNLSARCRIEEVCNVVRGGLLQSVKFLPDRHVCFVTFADPTAAAQFY 316

Query: 878  ANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINNPD 937
            A A +  + +     K+GWG HSGPLP  ++ A++ GA+RNVY       F +    +P 
Sbjct: 317  AMASLHGLTIQRRRCKIGWGKHSGPLPAHLADAISHGASRNVY-------FGNVNWQDPA 369

Query: 938  YEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVNEDDG 997
              ++ E      E  LR+  S +GE+EQ+N + +  C ++NF N+ SAI  VE+V     
Sbjct: 370  VAEFFE------ERHLRQAMSHFGEMEQVNAVPERRCVFVNFTNLESAIAAVEQV----- 418

Query: 998  IRFHNKFDGRYNGLIIGYGKDRCGNV 1023
                 K   ++  L + YGKDRCGNV
Sbjct: 419  -----KKWPQFQQLKVNYGKDRCGNV 439

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Composition-based stats.
 Identities = 59/216 (27%), Positives = 96/216 (44%), Gaps = 35/216 (16%)

Query: 816  SAVLGGGPGN------RTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIE 869
            SA +   P N      RTVY+GNI P     +L + V+ G+++       K   FV+F++
Sbjct: 23   SATVSSNPLNFTSAPSRTVYLGNIAPEVTLRELLDHVQSGVVEDARLFPAKSCAFVSFVD 82

Query: 870  ATNAAQFFANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFK 929
              +A  F ++A ++ + +    +K+GW   +   P   +   + GA RNVY+        
Sbjct: 83   ENSALLFHSDAILNRLRIGDRDVKIGWATATLMDPLVATRIQSEGATRNVYLG------- 135

Query: 930  DKFINNPDYEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLV 989
                N PD    +E         L KD S YGEI+ +  L+     +++  +I  AI  V
Sbjct: 136  ----NLPDGVSRYE---------LTKDLSVYGEIDSVKLLSSKGVAFVHMASIGQAIHAV 182

Query: 990  EEVNEDDGIRFHNKFDGRYNGLIIGYGKDRCGNVNK 1025
              +  D+ I         Y+   + +GKDRC  V K
Sbjct: 183  ANLQRDNKI---------YSDRRVSFGKDRCAYVTK 209

>KLTH0H04906g Chr8 complement(436720..438429) [1710 bp, 569 aa] {ON}
            similar to uniprot|Q08925 Saccharomyces cerevisiae
            YPL184C Hypothetical ORF
          Length = 569

 Score =  171 bits (433), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 83/200 (41%), Positives = 125/200 (62%), Gaps = 21/200 (10%)

Query: 824  GNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFFANAYID 883
            GNRT+Y+GN+    K E++CN VRGG+LQ I  L D+H+CFVTFI+ T AAQ +A   + 
Sbjct: 386  GNRTIYLGNLPKDVKIEEICNAVRGGLLQSIKLLTDRHVCFVTFIDPTAAAQLYAMTSLH 445

Query: 884  PIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINNPDYEKYHE 943
             + +H    K+GWG HSG L  +++LAV+ GA+RN+Y+   +F          D E+   
Sbjct: 446  GLTIHNKRCKIGWGKHSGALSNALALAVSHGASRNIYLGNIDF--------KADSERDVP 497

Query: 944  IYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVNEDDGIRFHNK 1003
            ++    E  LRK F +YGE+EQIN+L +  CC++NF NI++AI  ++++  ++       
Sbjct: 498  VF---TEQNLRKLFEEYGEVEQINFLPERSCCFVNFTNISNAILAIDKIKSNE------- 547

Query: 1004 FDGRYNGLIIGYGKDRCGNV 1023
               ++  L I +GKDRCGNV
Sbjct: 548  ---QFKDLKINFGKDRCGNV 564

 Score = 93.2 bits (230), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 62/210 (29%), Positives = 106/210 (50%), Gaps = 32/210 (15%)

Query: 825  NRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFFANAYIDP 884
            +RTVY+GNI P  +  +L + VR G+++ +  LR+K   F++F++ ++A  F ++A +  
Sbjct: 147  SRTVYLGNIPPNLEVRELLDHVRSGVVEDVRILREKMCAFISFLDESSALLFHSDAILKR 206

Query: 885  IVLHGNILKVGWGNHSGPLPKSISLAVT-IGANRNVYVS--------LPEFAFKDKFINN 935
            + + G  +KVGWG  + P+   ++ AV+  GA RNVY+          P+F    + +  
Sbjct: 207  LNIGGRDIKVGWGKPT-PIDPVVTAAVSNDGATRNVYIGRLNTDRDLAPQFGADPRDL-- 263

Query: 936  PDYEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVNED 995
                       +  E +LR D   YGEIE +  + +    +++F +I SAI +V  +   
Sbjct: 264  -----------IATEEKLRADLDFYGEIESVKIIVEKGIAFVHFSSIFSAIKVVSSL--- 309

Query: 996  DGIRFHNKFDGRYNGLIIGYGKDRCGNVNK 1025
                     +  Y+   I YGKDRC  V K
Sbjct: 310  ------ATVNPYYSNKKIFYGKDRCAFVTK 333

>YPL184C Chr16 complement(195950..197788) [1839 bp, 612 aa] {ON}
            MRN1RNA-binding protein proposed to be involved in
            translational regulation; binds specific categories of
            mRNAs, including those that contain upstream open reading
            frames (uORFs) and internal ribosome entry sites (IRES)
          Length = 612

 Score =  171 bits (434), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 130/209 (62%), Gaps = 30/209 (14%)

Query: 821  GGP---GNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFF 877
            GGP   GNRTVY+G++    K E++CN VRGG+LQ I  L D+++CFVTFI+ T AAQF+
Sbjct: 423  GGPNNLGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFY 482

Query: 878  ANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEF---AFKDKFIN 934
            A + +    +     KVGWG HSGPLP +++LAV+ GA+RNVYV   +F   + +D+   
Sbjct: 483  AMSSLYGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNIDFVGDSLRDE--- 539

Query: 935  NPDYEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVNE 994
                       ++  E  LR  F QYGE+EQIN+L + +CC+IN+ NI++AI  ++++  
Sbjct: 540  -----------RVFTESNLRHIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKI-- 586

Query: 995  DDGIRFHNKFDGRYNGLIIGYGKDRCGNV 1023
                    K +  +  L I +GKDRCGNV
Sbjct: 587  --------KSNPYFKDLKINFGKDRCGNV 607

 Score = 85.9 bits (211), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 98/201 (48%), Gaps = 24/201 (11%)

Query: 825  NRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFFANAYIDP 884
            +RTVY+GN+ P    ++L + VR G+++ +  + +K   FV+FI+ + A  F ++A +  
Sbjct: 200  SRTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFVSFIDESAALLFHSDAILKR 259

Query: 885  IVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINNPDYEKYHEI 944
            + +    +K+GWG  +   P   +   T GA RNVY+       ++  +           
Sbjct: 260  LNIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIEGEESHL----------- 308

Query: 945  YKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVNEDDGIRFHNKF 1004
                +E QLR D  +YGEI+ I  + +    +I+F +I +AI +V        +   N +
Sbjct: 309  ----SEEQLRVDLEEYGEIDCIKIIKEKGIAFIHFASILNAIKVVTN------LPIRNPY 358

Query: 1005 DGRYNGLIIGYGKDRCGNVNK 1025
               Y    I YGKDRC  + K
Sbjct: 359  ---YQNKRIFYGKDRCAFITK 376

>Smik_6.390 Chr6 (626853..628730) [1878 bp, 625 aa] {ON} YPL184C
            (REAL)
          Length = 625

 Score =  171 bits (434), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 90/206 (43%), Positives = 128/206 (62%), Gaps = 24/206 (11%)

Query: 821  GGP---GNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFF 877
            GGP   GNRTVY+G++    K E++CN VRGG+LQ I  L D+++CFVTFI+ T AAQF+
Sbjct: 436  GGPNNLGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFY 495

Query: 878  ANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINNPD 937
            A + +    +     KVGWG HSGPLP +++LAV+ GA+RNVYV   +F          D
Sbjct: 496  AMSSLYGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNIDFV--------SD 547

Query: 938  YEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVNEDDG 997
              +   I+    E  LR  F QYGE+EQIN+L + +CC++N+ NI++AI  ++++     
Sbjct: 548  SLRDERIF---TESNLRHVFQQYGEVEQINFLPEKNCCFVNYTNISNAILALDKI----- 599

Query: 998  IRFHNKFDGRYNGLIIGYGKDRCGNV 1023
                 K +  +  L I +GKDRCGNV
Sbjct: 600  -----KSNPYFKDLKINFGKDRCGNV 620

 Score = 86.7 bits (213), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 99/201 (49%), Gaps = 24/201 (11%)

Query: 825  NRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFFANAYIDP 884
            +RTVY+GN+ P    ++L + VR G+++ +  + +K   F++F++ + A  F ++A +  
Sbjct: 213  SRTVYLGNVPPNLSVKELLDHVRSGVVEDVKIISEKMCAFISFVDESAALLFHSDAILKR 272

Query: 885  IVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINNPDYEKYHEI 944
            + +    +K+GWG  +   P   +   T GA RNVY+               D E+ H  
Sbjct: 273  LNIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTI----------DGEESHL- 321

Query: 945  YKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVNEDDGIRFHNKF 1004
                +E QLR D  +YGEI+ I  + +    +I+F +I +AI +V        +   N +
Sbjct: 322  ----SEEQLRIDLKEYGEIDCIKVIKEKGIAFIHFASILNAIKVVTN------LPIRNPY 371

Query: 1005 DGRYNGLIIGYGKDRCGNVNK 1025
               Y    I YGKDRC  + K
Sbjct: 372  ---YQNKRIFYGKDRCAFITK 389

>Suva_16.123 Chr16 complement(205700..207490) [1791 bp, 596 aa] {ON}
            YPL184C (REAL)
          Length = 596

 Score =  171 bits (433), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 92/206 (44%), Positives = 128/206 (62%), Gaps = 24/206 (11%)

Query: 821  GGP---GNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFF 877
            GGP   GNRTVY+G++    K E++CN VRGG+LQ I  L D+++CFVTFI+ T AAQF+
Sbjct: 407  GGPNNLGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFY 466

Query: 878  ANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINNPD 937
            A + +    +     KVGWG HSGPLP +++LAV+ GA+RNVYV   +FA         D
Sbjct: 467  AMSSLYGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNIDFA--------SD 518

Query: 938  YEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVNEDDG 997
                  I+    E  LR  F QYGE+EQIN+L + +CC+IN+ NI++AI  ++++     
Sbjct: 519  SLNDERIF---TENNLRSIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKI----- 570

Query: 998  IRFHNKFDGRYNGLIIGYGKDRCGNV 1023
                 K +  +  L I +GKDRCGNV
Sbjct: 571  -----KSNPYFKDLKINFGKDRCGNV 591

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 55/200 (27%), Positives = 97/200 (48%), Gaps = 24/200 (12%)

Query: 826  RTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFFANAYIDPI 885
            RTVY+GN+ P    ++L + VR G+++ +  + +K   F++F++ + A  F ++A +  +
Sbjct: 185  RTVYLGNVPPHLTVKELLDHVRSGVVEDVKIIPEKMCAFISFVDESAALLFHSDAILKRL 244

Query: 886  VLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINNPDYEKYHEIY 945
             +    +K+GWG  +   P   +   T GA RNVY+       ++  +            
Sbjct: 245  NIGDRDIKIGWGKPTRIDPIVAARITTDGATRNVYIGRMTVEGEESHL------------ 292

Query: 946  KLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVNEDDGIRFHNKFD 1005
               +E QLR D  +YGEI+ I  + +    +I+F +I +AI +V        +   N + 
Sbjct: 293  ---SEEQLRADLQEYGEIDCIKIIKEKGIAFIHFASILNAIKVVTN------LPIRNPY- 342

Query: 1006 GRYNGLIIGYGKDRCGNVNK 1025
              Y    I YGKDRC  + K
Sbjct: 343  --YQNKRIFYGKDRCAFITK 360

>TPHA0J02210 Chr10 (494346..496127) [1782 bp, 593 aa] {ON} Anc_6.183
            YPL184C
          Length = 593

 Score =  170 bits (431), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 86/200 (43%), Positives = 125/200 (62%), Gaps = 21/200 (10%)

Query: 824  GNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFFANAYID 883
            GNRTVY+GN+    + ED+CN +R G+LQ I  L D+H+CFVTFI+  +AAQF+A + I 
Sbjct: 413  GNRTVYLGNLPNDIRIEDICNTIRCGLLQNIKLLSDRHVCFVTFIDPVSAAQFYAMSSIY 472

Query: 884  PIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINNPDYEKYHE 943
              VL     KVGWG HSGPL   ++LAV+ GA+RNVY+   +F       +    E+Y  
Sbjct: 473  GFVLQKKRCKVGWGKHSGPLSNPLTLAVSNGASRNVYIGNIDFT-----ADGTKRERYF- 526

Query: 944  IYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVNEDDGIRFHNK 1003
                  +  LR+ FS+YGE+EQIN+L   +CC++N+ NIN+AI+ ++++          K
Sbjct: 527  -----TDSNLRRIFSEYGEVEQINFLYSKNCCFVNYTNINNAISAIDKI----------K 571

Query: 1004 FDGRYNGLIIGYGKDRCGNV 1023
             +  +  L I +GKDRCGN+
Sbjct: 572  NNPTFKNLKINFGKDRCGNI 591

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 63/204 (30%), Positives = 108/204 (52%), Gaps = 15/204 (7%)

Query: 826  RTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFFANAYIDPI 885
            RTVY+GNI P     DL + VR G+++++  L +K   F++F++  ++  F ++A +  +
Sbjct: 168  RTVYLGNIPPTLTASDLLDHVRSGVIEEVKILPEKMCAFISFLDENSSLLFHSDAILKRL 227

Query: 886  VLHGNILKVGWGNHSGPLPKSISLAV-TIGANRNVYVSLPEFAFKDKFINNPDYEKYH-- 942
             + G  +K+GWG  S PL   I+ +V T GA RN+++        +K  +N D   YH  
Sbjct: 228  NIDGKDIKIGWGKPS-PLSPIIATSVATDGATRNIFIGQLNTTDHNKQKDN-DATIYHGS 285

Query: 943  -EIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVNEDDGIRFH 1001
             +   +  E +LRKD  +YG+I+ I    +    +++F +I SAI +V  ++  +     
Sbjct: 286  DDFEDIMTEEKLRKDLEEYGDIDCIKIFKEKGFAFVHFTSILSAIKVVNNLSNSNPY--- 342

Query: 1002 NKFDGRYNGLIIGYGKDRCGNVNK 1025
                  Y+   I YGKDRC  + K
Sbjct: 343  ------YSKKKIYYGKDRCAFITK 360

>Skud_16.94 Chr16 complement(169165..171009) [1845 bp, 614 aa] {ON}
            YPL184C (REAL)
          Length = 614

 Score =  171 bits (432), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 90/206 (43%), Positives = 129/206 (62%), Gaps = 24/206 (11%)

Query: 821  GGP---GNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFF 877
            GGP   GNRTVY+G++    K E++CN VRGG+LQ I  L D+++CFVTFI+ T AAQF+
Sbjct: 425  GGPNNLGNRTVYLGSLPKDVKIEEICNAVRGGLLQSIKLLNDRYVCFVTFIDPTAAAQFY 484

Query: 878  ANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINNPD 937
            A + +    +     KVGWG HSGPLP +++LAV+ GA+RNVYV   ++          D
Sbjct: 485  AMSSLYGFTVQKKRCKVGWGKHSGPLPNALALAVSNGASRNVYVGNIDYV--------SD 536

Query: 938  YEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVNEDDG 997
              +   I+    E +LR  F QYGE+EQIN+L + +CC+IN+ NI++AI  ++++     
Sbjct: 537  SVRDERIF---TEGKLRGIFQQYGEVEQINFLPEKNCCFINYTNISNAILALDKI----- 588

Query: 998  IRFHNKFDGRYNGLIIGYGKDRCGNV 1023
                 K +  +  L I +GKDRCGNV
Sbjct: 589  -----KSNPYFKDLKINFGKDRCGNV 609

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 99/201 (49%), Gaps = 24/201 (11%)

Query: 825  NRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFFANAYIDP 884
            +RTVY+GN+ P    ++L + VR G+++ +  + +K   F++F++ + A  F ++A +  
Sbjct: 202  SRTVYLGNVPPNLSVKELLDHVRSGVVEDVKIIPEKMCAFISFVDESAALLFHSDAILKR 261

Query: 885  IVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINNPDYEKYHEI 944
            + +    +K+GWG  +   P   +   T GA RNVY+       ++  ++          
Sbjct: 262  LNIGDRDIKIGWGKPTRIDPIVAARISTDGATRNVYIGRMTIEGEESHLSGE-------- 313

Query: 945  YKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVNEDDGIRFHNKF 1004
                   QLR D  +YGEI+ I  + +    +I+F +I +AI +V  +   + + + NK 
Sbjct: 314  -------QLRADLEEYGEIDCIKIIKEKGVAFIHFASILNAIKVVTNLPIRN-LYYQNKR 365

Query: 1005 DGRYNGLIIGYGKDRCGNVNK 1025
                    I YGKDRC  + K
Sbjct: 366  --------IFYGKDRCAFITK 378

>ZYRO0G08140g Chr7 (663951..665849) [1899 bp, 632 aa] {ON} similar to
            uniprot|Q08925 Saccharomyces cerevisiae YPL184C
            Hypothetical ORF
          Length = 632

 Score =  170 bits (431), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 92/206 (44%), Positives = 127/206 (61%), Gaps = 24/206 (11%)

Query: 821  GGP---GNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFF 877
            GGP   GNRTVY+GN+    K E++CNVVRGG+LQ +  L D+H+CFVTFI+ T AAQF+
Sbjct: 443  GGPNNLGNRTVYLGNLPKDVKVEEICNVVRGGLLQNVKVLSDRHVCFVTFIDPTAAAQFY 502

Query: 878  ANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINNPD 937
            A + +  I +     +VGWG H G L  +++LAV+ GA+RNVYV    F        + D
Sbjct: 503  AMSSLHGITIQKRRCRVGWGKHPGSLENALALAVSNGASRNVYVGNINF--------DED 554

Query: 938  YEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVNEDDG 997
             ++   I+    E  LR  F Q+GE+EQINYL + +CC++N+ NI++AI  +      D 
Sbjct: 555  SKREDPIF---TESSLRSIFQQWGEVEQINYLPERNCCFVNYTNISNAILAI------DK 605

Query: 998  IRFHNKFDGRYNGLIIGYGKDRCGNV 1023
            I+ H  F      L I +GKDRCGNV
Sbjct: 606  IKGHPVF----KDLKINFGKDRCGNV 627

 Score = 72.0 bits (175), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 55/204 (26%), Positives = 96/204 (47%), Gaps = 19/204 (9%)

Query: 825  NRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFFANAYIDP 884
            ++TVY+GN       ++L + VR G+++ +  L DK   FV+F++ + A  F ++A +  
Sbjct: 209  SKTVYLGNTPITLTVKELLDHVRSGVVEDVRILPDKMCAFVSFVDESAALLFHSDAILKR 268

Query: 885  IVLHGNILKVGWGNHSGPLPKSISLAVTIG---ANRNVYVSLPEFAFKDKFINNPDYEKY 941
            + + G  +K+GWG    P P    +A  +    A RNVY+   +     K  +       
Sbjct: 269  LHIDGRDIKIGWGK---PTPIDPVVATAVANDNATRNVYIG--QLNTGPKLSSQVSPVDV 323

Query: 942  HEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVNEDDGIRFH 1001
             E   +  E +LR D  ++GEI+ I  + +    +++F +I +AI  V  +         
Sbjct: 324  TE--PVITEDKLRLDLQEFGEIDCIKIVEEKGIAFVHFASILNAIKAVANL--------- 372

Query: 1002 NKFDGRYNGLIIGYGKDRCGNVNK 1025
               +  Y    I YGKDRC  + K
Sbjct: 373  ANINPYYRNKKIFYGKDRCAFITK 396

>TDEL0G01620 Chr7 complement(316768..318522) [1755 bp, 584 aa] {ON}
            Anc_6.183 YPL184C
          Length = 584

 Score =  169 bits (428), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 87/206 (42%), Positives = 129/206 (62%), Gaps = 24/206 (11%)

Query: 821  GGP---GNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFF 877
            GGP   GNRTVY+GN+    K E++CNVVRGGILQ I  L D+H+CFVTFI+   AAQF+
Sbjct: 395  GGPNNLGNRTVYLGNLPKDVKIEEICNVVRGGILQAIKVLSDRHVCFVTFIDPIAAAQFY 454

Query: 878  ANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINNPD 937
            A + +  I +     +VGWG H GPLP +I+LAV+ GA+RNVY+   +F ++D     P 
Sbjct: 455  AMSSLHGITIQKRRCRVGWGKHPGPLPNAIALAVSNGASRNVYIGNIDF-YEDSKRQEPI 513

Query: 938  YEKYHEIYKLPNELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVNEDDG 997
            +   +          LRK F +YGE+EQ+N+L + +C ++N+ NI++AI+ ++++     
Sbjct: 514  FTADY----------LRKIFQEYGEVEQLNFLPEKNCAFVNYTNISNAISAIDKI----- 558

Query: 998  IRFHNKFDGRYNGLIIGYGKDRCGNV 1023
                 K +  +  L I +GKDRCG +
Sbjct: 559  -----KSNPLFKNLKINFGKDRCGTI 579

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 103/205 (50%), Gaps = 24/205 (11%)

Query: 826  RTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDKHICFVTFIEATNAAQFFANAYIDPI 885
            +TVY+GNI P     +L + VR G+++++  L +K   F+TF++ + A  F ++A +  +
Sbjct: 163  KTVYLGNIPPSLTVRELLDHVRSGVVEEVKILPEKTCAFLTFVDESAALLFHSDAILKRL 222

Query: 886  VLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINNPDYEKYHEIY 945
             + G  +K+GWG  +   P   +   + GA RNVY+ L           N D +   ++ 
Sbjct: 223  HIDGRDIKIGWGKATPVDPLVTTAIASDGATRNVYIGLL----------NTDSDIALQVG 272

Query: 946  KLPN-----ELQLRKDFSQYGEIEQINYLNDGHCCWINFMNINSAITLVEEVNEDDGIRF 1000
              PN     E +LR D  ++GEI+ +  + +    +I+F +I SA+ +V  +    GI  
Sbjct: 273  ADPNDEKITEEKLRSDLGEFGEIDCVKIVEEKGIAFIHFASILSAVKVVANL---AGINP 329

Query: 1001 HNKFDGRYNGLIIGYGKDRCGNVNK 1025
            +      Y    I YGKDRC  + K
Sbjct: 330  Y------YENKKIYYGKDRCAFITK 348

>KLTH0D11088g Chr4 complement(906439..907707) [1269 bp, 422 aa] {ON}
            some similarities with uniprot|Q96US5 Saccharomyces
            cerevisiae YOR242C SSP2 Sporulation SPecific involved in
            sporulation
          Length = 422

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 38/67 (56%), Gaps = 5/67 (7%)

Query: 953  LRKDFSQYGEIEQIN-YLNDGHCCWINFMNINSAITLVEEVNEDDGIRFHNKFDGRYNGL 1011
            LRKDF Q+GEI +I+  ++   C  ++F ++ SAI  +E   E D    H K++  +   
Sbjct: 350  LRKDFEQFGEISEISPMISRKLCVSVSFYDVRSAINALESFGEPDSF-MHKKYNRDWT-- 406

Query: 1012 IIGYGKD 1018
             + YG+D
Sbjct: 407  -MAYGRD 412

>Suva_8.292 Chr8 complement(527751..528863) [1113 bp, 370 aa] {ON}
            YOR242C (REAL)
          Length = 370

 Score = 40.4 bits (93), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 88/204 (43%), Gaps = 16/204 (7%)

Query: 826  RTVYIGNINPRSKPEDLCNVVRGGILQKIVFLR------DKHICFVTFIEATNAAQFFAN 879
            R+V I +I   +    + + VRGG L++IV  R        H   + F+    A  F   
Sbjct: 163  RSVSINDIPRGTGIASVLSQVRGGSLERIVVYRYDTPERSLHKVDLFFLNYDGAQSFMKY 222

Query: 880  AYIDPIVLHGNILKVGW---GNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDK-FINN 935
            A  +   ++G  L+  W    +    + K  S+   +   + +   L       K  +N 
Sbjct: 223  ATTNIFKVNGTHLRPEWIFLESTYENIMKEQSVNRILDEEKLISRCLIVKKSSSKTIVNK 282

Query: 936  PDYEKYHEIYKLPNELQLRKDFSQYGEIEQIN-YLNDGHCCWINFMNINSAITLVEEVNE 994
            P  +K   +  +  + +L KDF  +GE+ +I   ++   C  I F +I+SA+  +EE  E
Sbjct: 283  PSQDKSQSLENIDIQ-ELEKDFQNFGEVLEITPIVSRKLCVSIFFYDISSAMRAMEEY-E 340

Query: 995  DDGIRFHNKFDGRYNGLIIGYGKD 1018
              G   +NK+   +    I YGKD
Sbjct: 341  QKGSYLYNKY---FKTWTIWYGKD 361

>Smik_15.426 Chr15 complement(738453..739568) [1116 bp, 371 aa] {ON}
            YOR242C (REAL)
          Length = 371

 Score = 38.9 bits (89), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 85/203 (41%), Gaps = 14/203 (6%)

Query: 826  RTVYIGNINPRSKPEDLCNVVRGGILQKIVFLR------DKHICFVTFIEATNAAQFFAN 879
            R+V I +I   +    + + VRGG L++I+  R        H   + F+    A  F   
Sbjct: 164  RSVSISDIPRGTGIASVLSQVRGGSLERIIVYRYDTPERSLHKVDLFFLNYDGAQSFMRY 223

Query: 880  AYIDPIVLHGNILKVGW---GNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINNP 936
            A      ++G  LK  W    +    + K  S+   +   + +   L       K + N 
Sbjct: 224  ANTSVFKVNGVRLKPEWIFLESTYENVIKEQSVNRIVEEEKLISRCLIVKKSSTKTVFNK 283

Query: 937  DYEKYHEIYKLPNELQLRKDFSQYGEIEQIN-YLNDGHCCWINFMNINSAITLVEEVNED 995
              +   +  +  N  +L KDF  +GEI +I   ++   C  I F +I+SA+  +EE  E 
Sbjct: 284  SNQDRSQNLETINVRELEKDFQNFGEILEITPIVSRKLCVSIFFYDISSAMRAMEEY-EQ 342

Query: 996  DGIRFHNKFDGRYNGLIIGYGKD 1018
             G   +NK+   +    I YGKD
Sbjct: 343  KGSGLNNKY---FKTWTIWYGKD 362

>NCAS0B01600 Chr2 complement(261098..262219) [1122 bp, 373 aa] {ON}
            Anc_8.670 YOR242C
          Length = 373

 Score = 38.9 bits (89), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 47/203 (23%), Positives = 83/203 (40%), Gaps = 21/203 (10%)

Query: 826  RTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRDK------HICFVTFIEATNAAQFFAN 879
            R+V I NI   +    + N + GG L+K  + R++      +   + F+ + NA  F   
Sbjct: 173  RSVTIENIPTYTGMYSILNQISGGPLEKFCYYRNENSRQATYTMTLNFLSSNNAQDFMKF 232

Query: 880  AYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNV---YVSLPEFAFKDKFINNP 936
               +   ++G  L+  W +  G +    + A +  A       Y+ L   + K      P
Sbjct: 233  GKTNLFKVNGFHLQPKWSSVEGSVSSQTNSAKSKLAKTGCICRYIILKRHSGKTTCTKVP 292

Query: 937  DYEKYHEIYKLPNELQLRKDFSQYGEIEQIN-YLNDGHCCWINFMNINSAITLVEEVNED 995
              E Y +I       ++RKDF  YG I +I   ++   C  I + +I SA+  +    E+
Sbjct: 293  ILE-YVDI------QEIRKDFGCYGGIVEITPVISKKVCLSIGYYDIYSAVRAMVAY-EN 344

Query: 996  DGIRFHNKFDGRYNGLIIGYGKD 1018
                 H K+   +    + YG D
Sbjct: 345  SSTDLHKKY---FQSWTLWYGND 364

>KAFR0D01660 Chr4 (330013..330651) [639 bp, 212 aa] {ON} Anc_8.797
           YOR319W
          Length = 212

 Score = 37.0 bits (84), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 84/180 (46%), Gaps = 29/180 (16%)

Query: 826 RTVYIGNINPRSKPEDLCNV-VRGGILQKIVFLRDK----HICFVTFIEATNAAQFFANA 880
           RTVY+GNI+PR   EDL  + V+ G ++KI + RDK    H  +  FIE      F  ++
Sbjct: 7   RTVYVGNIDPRVNKEDLYELFVQFGRIKKINYPRDKVLDTHQGY-AFIE------FLNDS 59

Query: 881 YIDPIV-LHGNILKVGWGNHSGPLPKS--ISLAVTIGANRNVYVSLPEFAFKDKFINNPD 937
            +D ++ L GN   V     S  + KS     A   G N+N+ V +   A     + N D
Sbjct: 60  TVDYVLKLFGNTNLVSLYERSLKIRKSENGKEANANGTNKNIDVDMLPIA--KIIVKNVD 117

Query: 938 YEKYHEIYKLPNELQLRKDFSQYGEIEQ----INYLNDGHCCWINFMNINSAITLVEEVN 993
                      + ++L K  S++G++ +    +   N   C +++F +   +   ++++N
Sbjct: 118 ES--------VDIMKLNKICSKFGKLARDSDIVTMSNGMRCGFVHFRDYKDSDLAIDKLN 169

>ACR135C Chr3 complement(585997..587127) [1131 bp, 376 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOR242C
            (SSP2)
          Length = 376

 Score = 37.4 bits (85), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 75/190 (39%), Gaps = 22/190 (11%)

Query: 844  NVVRGGILQKIVFLRDKHI-----CFVTFIEATNAAQFFANAYIDPIVLHGNILKVGWGN 898
            N V+GG L+ I     K         + F+   +A  F          ++G  L+  WG 
Sbjct: 185  NQVQGGALKHITPQYKKETNQLKSVELEFLCPEDAQHFMEYGRHAVFQINGVHLRPRWGI 244

Query: 899  HSGPLPKSISLAVTIGANRNVYV-SLPEFAFKDKFINNPDYEKYHEIYKLP-------NE 950
             S       SL        N+Y  S      K +   NP +   H  Y  P       N 
Sbjct: 245  QSLSENFEASLNANQRDRLNLYAPSSRCLLLKKQGSKNPKHSTCH--YPSPRSHICDLNV 302

Query: 951  LQLRKDFSQYGEIEQIN-YLNDGHCCWINFMNINSAITLVEEVNEDDGIRFHNKFDGRY- 1008
             +L+KDFSQ+G I  I+  ++   C  INF +I SA+  ++     +     +  + +Y 
Sbjct: 303  QELKKDFSQFGNILDISPMISRKLCVQINFYDIKSAMDALQSYKNAN-----SPLNRKYA 357

Query: 1009 NGLIIGYGKD 1018
                IGYGKD
Sbjct: 358  ESWTIGYGKD 367

>YOR242C Chr15 complement(788742..789857) [1116 bp, 371 aa] {ON}
            SSP2Sporulation specific protein that localizes to the
            spore wall; required for sporulation at a point after
            meiosis II and during spore wall formation; SSP2
            expression is induced midway in meiosis
          Length = 371

 Score = 37.4 bits (85), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 53/214 (24%), Positives = 88/214 (41%), Gaps = 36/214 (16%)

Query: 826  RTVYIGNINPRSKPEDLCNVVRGGILQKIVFLR------DKHICFVTFIEATNAAQFFAN 879
            R++ + +I   +    + + VRGG L++I+  R        H   + F+    A  F   
Sbjct: 164  RSISLNDIPRGTGISSVLSQVRGGSLERIIVYRYDTPERSLHKVDLFFLNYEGAQSFMRY 223

Query: 880  AYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINNPDYE 939
            A  +   ++G  LK          P+ I L  T   N     S+     ++KFI+     
Sbjct: 224  AKTNIFKVNGVQLK----------PEWIFLESTY-ENIMKEQSVNRIIEEEKFISRCLIV 272

Query: 940  KYHEIYKLPNE--------------LQLRKDFSQYGEIEQIN-YLNDGHCCWINFMNINS 984
            K      +PN+               +L KDF  +GE+ +I   ++   C  I F +I+S
Sbjct: 273  KKSSTTAMPNKSNLNKGQTLENIDIQELEKDFQNFGEVLEITPIVSRKLCVSIFFYDISS 332

Query: 985  AITLVEEVNEDDGIRFHNKFDGRYNGLIIGYGKD 1018
            A+  +EE  E  G   +NK+   +    I YGKD
Sbjct: 333  AMRAMEEY-EQKGSYLYNKY---FKTWTIWYGKD 362

>KLLA0F11275g Chr6 (1038770..1039927) [1158 bp, 385 aa] {ON} weakly
            similar to uniprot|Q96US5 Saccharomyces cerevisiae
            YOR242C SSP2 Sporulation SPecific involved in sporulation
          Length = 385

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 54/222 (24%), Positives = 93/222 (41%), Gaps = 35/222 (15%)

Query: 823  PGNRTVYIGNINPRSKPEDLCNVVRGGILQKIVFLRD-----KHICFVT--FIEATNAAQ 875
             G R V   ++        L   V GG L+K+++  D     + + +V   F+   +AAQ
Sbjct: 164  AGRRVVIFQDLLKNIGVGTLLAQVSGGPLEKVLYAYDNKTGSRDVVYVELHFLFPDDAAQ 223

Query: 876  FFANAYIDPIVLHGNILKVGWG----------------NHSGP-LPKSISLAVTIGANRN 918
            F   A      ++G  L   WG                 +  P   K I    + GA R 
Sbjct: 224  FMKYARFHLFKVNGVHLVPHWGVIDSLDSSEKSLLDIQQYVHPDFCKDIQNFDSTGARRC 283

Query: 919  VYVSLPEFAFKDKFINNPDYEKYHEIYKLPNELQLRKDFSQYGEIEQIN-YLNDGHCCWI 977
            +   + +++ K K I+     K H IY L  + Q+  DF+Q+G++ +++  ++   C  I
Sbjct: 284  LI--MKKYSRKHKSISTELNSKSH-IYDLDIQ-QIIDDFNQFGQVLEVSPLISRKICLQI 339

Query: 978  NFMNINSAITLVEEVNEDDGIRFHNKFDGRY-NGLIIGYGKD 1018
            +F +I SAI  +      +     +  +G+Y     I YGKD
Sbjct: 340  SFHDIRSAIEAMRSYETSN-----SYINGKYFKDWSIWYGKD 376

>TPHA0D01210 Chr4 complement(253331..254425) [1095 bp, 364 aa] {ON}
            Anc_8.670 YOR242C
          Length = 364

 Score = 33.9 bits (76), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 37/68 (54%), Gaps = 5/68 (7%)

Query: 952  QLRKDFSQYGEIEQIN-YLNDGHCCWINFMNINSAITLVEEVNEDDGIRFHNKFDGRYNG 1010
            ++RKDF Q+G I  I   ++   C  I++ NI +A+  ++   +D    FH K+   +  
Sbjct: 292  EVRKDFFQFGNIVDITPIVSRKVCLSISYYNIKAAMDAMKAY-DDPYSEFHKKYSEEW-- 348

Query: 1011 LIIGYGKD 1018
             ++ YGKD
Sbjct: 349  -VVWYGKD 355

>SAKL0F04774g Chr6 (381688..382542) [855 bp, 284 aa] {ON} similar to
           gnl|GLV|CAGL0J02200g Candida glabrata CAGL0J02200g and
           some similarites with YIR001C uniprot|P40561
           Saccharomyces cerevisiae YIR001C SGN1 Cytoplasmic RNA-
           binding protein contains an RNA recognition motif (RRM)
           may have a role in mRNA translation as suggested by
           genetic interactions with genes encoding proteins
           involved in translational initiation
          Length = 284

 Score = 33.1 bits (74), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 25/38 (65%), Gaps = 1/38 (2%)

Query: 826 RTVYIGNINPRSKPEDL-CNVVRGGILQKIVFLRDKHI 862
           R++++GNI+P + PE L  +    G+++++  L +KH 
Sbjct: 83  RSIFVGNISPSTTPESLEAHFEDAGVIKRVTILYNKHT 120

>KLTH0E14036g Chr5 complement(1240971..1241600) [630 bp, 209 aa]
           {ON} similar to uniprot|Q99181 Saccharomyces cerevisiae
           YOR319W
          Length = 209

 Score = 32.7 bits (73), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 79/183 (43%), Gaps = 37/183 (20%)

Query: 823 PGNRTVYIGNINPRSKPEDLCNV-VRGGILQKIVFLRDKHI------CFVTFIEATNAAQ 875
           P N TVY+GN++P+   E L  + ++ G + KI + +DK +       FV F  +   A+
Sbjct: 8   PAN-TVYVGNVDPKVSKELLYELFLQIGPVAKIRYPKDKVLQTHQGFAFVEF-NSPQDAE 65

Query: 876 FFANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINN 935
           + +    + + L+   LKV   N +   P S + A+ +GA                FI N
Sbjct: 66  YASKCLNNTVRLYDRTLKVRKANGASSSPTSQN-ALDVGAKL--------------FIKN 110

Query: 936 PDYEKYHEIYKLPNELQLRKDFSQYGEI---EQINYLNDG--HCCWINFMNINSAITLVE 990
            D        +L +   L K F ++G +    +I  L  G   C +I +     +   +E
Sbjct: 111 ID--------ELVDSEMLTKIFGKFGSLVRPPEIFTLKQGLLRCAYICYSTFEHSDAALE 162

Query: 991 EVN 993
           ++N
Sbjct: 163 KLN 165

>NCAS0I00990 Chr9 complement(178176..179043,179119..179153) [903 bp,
           300 aa] {ON} Anc_3.379 YBR119W
          Length = 300

 Score = 32.7 bits (73), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 30/55 (54%), Gaps = 3/55 (5%)

Query: 863 CFVTFIEATNAAQFFANAYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANR 917
           CF+TF + ++A +F  N Y   + ++GN++++ W      L  S+SL   I   +
Sbjct: 86  CFITFNDHSHAMEFM-NEYNSKLKVNGNVVEIQWAKKESLL--SLSLQNKIALEK 137

>NCAS0B00950 Chr2 (150330..150989) [660 bp, 219 aa] {ON} Anc_8.797
          Length = 219

 Score = 32.3 bits (72), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 40/162 (24%), Positives = 69/162 (42%), Gaps = 21/162 (12%)

Query: 827 TVYIGNINPRSKPEDLCNV-VRGGILQKIVFLRDKHI------CFVTFIEATNAAQFFAN 879
           TVY+GNI+P+   E L  + ++   + K+ + +DK +       F+ F  A +  Q+   
Sbjct: 11  TVYVGNIDPKVTKEQLYELFIQVSPISKLRYPKDKILQMHQGYAFIEFYTAKD-VQYVIQ 69

Query: 880 AYIDPIVLHGNILKVGWGNHSGPLPKSISLAVTIGANRNVYVSLPEFAFKDKFINNPDYE 939
              + + L+   LKV     S   P S         N N  + LP       F+ N D  
Sbjct: 70  VMNNTVALYDRFLKV---RQSVQNPTSSMGGANTSENSNQSIVLP---IAKLFVKNLD-- 121

Query: 940 KYHEIYKLPNELQLRKDFSQYGEIEQINYLNDG--HCCWINF 979
              E  + P  ++L + F    +  +I +L++G   C +I F
Sbjct: 122 ---ESIENPQLIKLFQKFGPLFKDPEIFFLSNGKLRCAYIYF 160

>Suva_9.140 Chr9 complement(235080..235988) [909 bp, 302 aa] {ON}
            YIL061C (REAL)
          Length = 302

 Score = 32.3 bits (72), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 42/83 (50%), Gaps = 9/83 (10%)

Query: 930  DKFINNPDYEKYHEIYKLP---NELQLRKDFSQYGEIEQINYLND------GHCCWINFM 980
            D  I + D  K   I +LP   NE++L+K F+++GEIE+I  + D          +I F 
Sbjct: 97   DPHIKDTDPYKTIFIGRLPYDLNEIELQKHFARFGEIEKIRIVKDKITQQNKGYAFIVFK 156

Query: 981  NINSAITLVEEVNEDDGIRFHNK 1003
            +  S+    +E+    GI+  ++
Sbjct: 157  DPISSKMAFKEIGVHRGIQIKDR 179

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 111,324,650
Number of extensions: 4452665
Number of successful extensions: 21532
Number of sequences better than 10.0: 79
Number of HSP's gapped: 21817
Number of HSP's successfully gapped: 173
Length of query: 1362
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1240
Effective length of database: 39,492,147
Effective search space: 48970262280
Effective search space used: 48970262280
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 72 (32.3 bits)