Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0B032708.842ON52052028200.0
Suva_13.288.842ON53047617480.0
YML115C (VAN1)8.842ON53548517400.0
Smik_13.198.842ON53642617260.0
NCAS0B003008.842ON52351517220.0
Kpol_541.158.842ON49851117120.0
ZYRO0G14234g8.842ON50949917020.0
Skud_13.268.842ON53942217000.0
KNAG0G034208.842ON51142916860.0
KAFR0A028308.842ON50742016690.0
NDAI0E002908.842ON52251516690.0
TDEL0B005608.842ON50952116380.0
SAKL0D01430g8.842ON44742516180.0
KLTH0C03828g8.842ON40440215590.0
CAGL0B02321g8.842ON51242115610.0
KLLA0D01529g8.842ON50141815490.0
Ecym_46138.842ON52447115210.0
ABL124W8.842ON48541915110.0
TPHA0C047808.842ON52547114980.0
Kwal_27.102468.842ON33934113420.0
Ecym_35731.479ON44737410221e-134
KLTH0C03432g1.479ON48937410061e-131
SAKL0D11792g1.479ON48337510021e-131
KNAG0I003001.479ON4573599951e-130
Kwal_27.101571.479ON4763749901e-129
YEL036C (ANP1)1.479ON5003689911e-129
KAFR0I027701.479ON4553749861e-129
CAGL0L01331g1.479ON4473639811e-128
TDEL0C026001.479ON4623649811e-128
TBLA0B021701.479ON5723659911e-128
AFR357W1.479ON4343649771e-127
NDAI0B012501.479ON4463639781e-127
NCAS0G041101.479ON4943749821e-127
NDAI0G003401.479ON5043579811e-127
Smik_5.571.479ON4913689791e-127
Suva_5.331.479ON4953689781e-127
Skud_5.541.479ON4913689771e-127
Kpol_370.51.479ON6453689871e-126
KLLA0E22155g1.479ON4503639571e-124
TPHA0O004301.479ON5483589651e-124
ZYRO0F05170g1.479ON6083699571e-122
KLLA0E12849g8.500ON3923525292e-61
CAGL0L12804g8.500ON3933575064e-58
KNAG0A021508.500ON3964225056e-58
TPHA0L013708.500ON3924345031e-57
KAFR0H013908.500ON3984725022e-57
ZYRO0F08492g8.500ON3963495022e-57
TBLA0H033408.500ON3934245012e-57
TDEL0B013708.500ON3963524986e-57
NCAS0C023308.500ON3933514979e-57
KLTH0E11616g8.500ON3943594961e-56
Smik_16.1868.500ON3953494952e-56
YPL050C (MNN9)8.500ON3953494942e-56
NDAI0E030208.500ON3963494882e-55
Skud_16.2328.500ON3953494855e-55
SAKL0H11110g8.500ON3933524846e-55
Suva_16.2658.500ON3953494848e-55
Kpol_1031.788.500ON3923514803e-54
Kwal_27.118648.500ON4533564801e-53
Ecym_25508.500ON3903484714e-53
AGL259C8.500ON3893474444e-49
NCAS0B024408.500ON4003464402e-48
NDAI0C052508.500ON4023444156e-45
KNAG0A039908.500ON3571782297e-20
SAKL0H20438gsingletonON5652081662e-11
YCR019W (MAK32)1.440ON363136820.18
KLLA0E05413g4.232ON754109810.33
TBLA0A018806.180ON133241732.5
ZYRO0E09790g3.577ON28290687.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0B03270
         (520 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0B03270 Chr2 (762231..763793) [1563 bp, 520 aa] {ON} Anc_8.8...  1090   0.0  
Suva_13.28 Chr13 complement(39946..41538) [1593 bp, 530 aa] {ON}...   677   0.0  
YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}  V...   674   0.0  
Smik_13.19 Chr13 complement(36444..38054) [1611 bp, 536 aa] {ON}...   669   0.0  
NCAS0B00300 Chr2 complement(35915..37418,37529..37596) [1572 bp,...   667   0.0  
Kpol_541.15 s541 (41403..42899) [1497 bp, 498 aa] {ON} (41403..4...   664   0.0  
ZYRO0G14234g Chr7 (1134555..1136084) [1530 bp, 509 aa] {ON} simi...   660   0.0  
Skud_13.26 Chr13 complement(39821..41440) [1620 bp, 539 aa] {ON}...   659   0.0  
KNAG0G03420 Chr7 (733195..734730) [1536 bp, 511 aa] {ON} Anc_8.8...   654   0.0  
KAFR0A02830 Chr1 (586557..588080) [1524 bp, 507 aa] {ON} Anc_8.8...   647   0.0  
NDAI0E00290 Chr5 complement(39735..41238,41371..41435) [1569 bp,...   647   0.0  
TDEL0B00560 Chr2 complement(107343..108872) [1530 bp, 509 aa] {O...   635   0.0  
SAKL0D01430g Chr4 complement(113921..115264) [1344 bp, 447 aa] {...   627   0.0  
KLTH0C03828g Chr3 complement(334500..335714) [1215 bp, 404 aa] {...   605   0.0  
CAGL0B02321g Chr2 (220222..221760) [1539 bp, 512 aa] {ON} simila...   605   0.0  
KLLA0D01529g Chr4 complement(135998..137503) [1506 bp, 501 aa] {...   601   0.0  
Ecym_4613 Chr4 (1195057..1196631) [1575 bp, 524 aa] {ON} similar...   590   0.0  
ABL124W Chr2 (162889..164346) [1458 bp, 485 aa] {ON} Syntenic ho...   586   0.0  
TPHA0C04780 Chr3 (1031751..1033328) [1578 bp, 525 aa] {ON} Anc_1...   581   0.0  
Kwal_27.10246 s27 complement(260882..261901) [1020 bp, 339 aa] {...   521   0.0  
Ecym_3573 Chr3 complement(1085088..1086431) [1344 bp, 447 aa] {O...   398   e-134
KLTH0C03432g Chr3 complement(297214..298683) [1470 bp, 489 aa] {...   392   e-131
SAKL0D11792g Chr4 (979538..980989) [1452 bp, 483 aa] {ON} simila...   390   e-131
KNAG0I00300 Chr9 complement(39873..41246) [1374 bp, 457 aa] {ON}...   387   e-130
Kwal_27.10157 s27 complement(219928..221358) [1431 bp, 476 aa] {...   385   e-129
YEL036C Chr5 complement(83050..84552) [1503 bp, 500 aa] {ON}  AN...   386   e-129
KAFR0I02770 Chr9 (559196..560563) [1368 bp, 455 aa] {ON} Anc_1.4...   384   e-129
CAGL0L01331g Chr12 complement(151156..152499) [1344 bp, 447 aa] ...   382   e-128
TDEL0C02600 Chr3 complement(450202..451590) [1389 bp, 462 aa] {O...   382   e-128
TBLA0B02170 Chr2 complement(499391..501109) [1719 bp, 572 aa] {O...   386   e-128
AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic ...   380   e-127
NDAI0B01250 Chr2 complement(293756..295096) [1341 bp, 446 aa] {O...   381   e-127
NCAS0G04110 Chr7 (766896..768380) [1485 bp, 494 aa] {ON} Anc_1.479    382   e-127
NDAI0G00340 Chr7 complement(56898..58412) [1515 bp, 504 aa] {ON}...   382   e-127
Smik_5.57 Chr5 complement(85152..86627) [1476 bp, 491 aa] {ON} Y...   381   e-127
Suva_5.33 Chr5 complement(58480..59967) [1488 bp, 495 aa] {ON} Y...   381   e-127
Skud_5.54 Chr5 complement(81169..82644) [1476 bp, 491 aa] {ON} Y...   380   e-127
Kpol_370.5 s370 (7329..9266) [1938 bp, 645 aa] {ON} (7329..9266)...   384   e-126
KLLA0E22155g Chr5 complement(1976362..1977714) [1353 bp, 450 aa]...   373   e-124
TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.47...   376   e-124
ZYRO0F05170g Chr6 (432802..434628) [1827 bp, 608 aa] {ON} simila...   373   e-122
KLLA0E12849g Chr5 complement(1138282..1139460) [1179 bp, 392 aa]...   208   2e-61
CAGL0L12804g Chr12 (1371568..1372749) [1182 bp, 393 aa] {ON} hig...   199   4e-58
KNAG0A02150 Chr1 complement(187175..188365) [1191 bp, 396 aa] {O...   199   6e-58
TPHA0L01370 Chr12 (286001..287179) [1179 bp, 392 aa] {ON} Anc_8....   198   1e-57
KAFR0H01390 Chr8 complement(258984..260180) [1197 bp, 398 aa] {O...   197   2e-57
ZYRO0F08492g Chr6 (684329..685519) [1191 bp, 396 aa] {ON} highly...   197   2e-57
TBLA0H03340 Chr8 (820028..821209) [1182 bp, 393 aa] {ON} Anc_8.5...   197   2e-57
TDEL0B01370 Chr2 complement(242546..243736) [1191 bp, 396 aa] {O...   196   6e-57
NCAS0C02330 Chr3 complement(437234..438415) [1182 bp, 393 aa] {O...   196   9e-57
KLTH0E11616g Chr5 (1035396..1036580) [1185 bp, 394 aa] {ON} high...   195   1e-56
Smik_16.186 Chr16 complement(336170..337357) [1188 bp, 395 aa] {...   195   2e-56
YPL050C Chr16 complement(460779..461966) [1188 bp, 395 aa] {ON} ...   194   2e-56
NDAI0E03020 Chr5 complement(643198..644388) [1191 bp, 396 aa] {O...   192   2e-55
Skud_16.232 Chr16 complement(424904..426091) [1188 bp, 395 aa] {...   191   5e-55
SAKL0H11110g Chr8 complement(957784..958965) [1182 bp, 393 aa] {...   191   6e-55
Suva_16.265 Chr16 complement(463836..465023) [1188 bp, 395 aa] {...   191   8e-55
Kpol_1031.78 s1031 (197094..198272) [1179 bp, 392 aa] {ON} (1970...   189   3e-54
Kwal_27.11864 s27 (981923..983284) [1362 bp, 453 aa] {ON} YPL050...   189   1e-53
Ecym_2550 Chr2 (1066925..1068097) [1173 bp, 390 aa] {ON} similar...   186   4e-53
AGL259C Chr7 complement(221445..222614) [1170 bp, 389 aa] {ON} S...   175   4e-49
NCAS0B02440 Chr2 complement(408198..409400) [1203 bp, 400 aa] {O...   174   2e-48
NDAI0C05250 Chr3 (1217841..1219049) [1209 bp, 402 aa] {ON} Anc_8...   164   6e-45
KNAG0A03990 Chr1 complement(535490..536563) [1074 bp, 357 aa] {O...    93   7e-20
SAKL0H20438g Chr8 (1793911..1793929,1794594..1796272) [1698 bp, ...    69   2e-11
YCR019W Chr3 (152837..153928) [1092 bp, 363 aa] {ON}  MAK32Prote...    36   0.18 
KLLA0E05413g Chr5 (485919..488183) [2265 bp, 754 aa] {ON} unipro...    36   0.33 
TBLA0A01880 Chr1 (458462..462460) [3999 bp, 1332 aa] {ON} Anc_6....    33   2.5  
ZYRO0E09790g Chr5 complement(776416..777264) [849 bp, 282 aa] {O...    31   7.6  

>TBLA0B03270 Chr2 (762231..763793) [1563 bp, 520 aa] {ON} Anc_8.842
           YML115C
          Length = 520

 Score = 1090 bits (2820), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 520/520 (100%), Positives = 520/520 (100%)

Query: 1   MVLNFSIIKEKQKQKDELPTTRSKLYPKKSVYDRKRRSPAFYWTCILATCLAIYLLCKAT 60
           MVLNFSIIKEKQKQKDELPTTRSKLYPKKSVYDRKRRSPAFYWTCILATCLAIYLLCKAT
Sbjct: 1   MVLNFSIIKEKQKQKDELPTTRSKLYPKKSVYDRKRRSPAFYWTCILATCLAIYLLCKAT 60

Query: 61  LGDSSFDPLSAINNYNSYGSYPLSRSSNKNYKNAKELEDVEYYDYDFRSIDEMSFHNFDQ 120
           LGDSSFDPLSAINNYNSYGSYPLSRSSNKNYKNAKELEDVEYYDYDFRSIDEMSFHNFDQ
Sbjct: 61  LGDSSFDPLSAINNYNSYGSYPLSRSSNKNYKNAKELEDVEYYDYDFRSIDEMSFHNFDQ 120

Query: 121 GEQHYLITQYGGDVVTSKDKERYIQEMENLLSSSVDKYDLSQFEGTANGAENREHLLYLT 180
           GEQHYLITQYGGDVVTSKDKERYIQEMENLLSSSVDKYDLSQFEGTANGAENREHLLYLT
Sbjct: 121 GEQHYLITQYGGDVVTSKDKERYIQEMENLLSSSVDKYDLSQFEGTANGAENREHLLYLT 180

Query: 181 PLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSDCSEGDKTLDTLITFARHLQDGTLVDI 240
           PLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSDCSEGDKTLDTLITFARHLQDGTLVDI
Sbjct: 181 PLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSDCSEGDKTLDTLITFARHLQDGTLVDI 240

Query: 241 FKDMDASIAKSEKKNENPNKHYLKFMDQNYIKMADASFAGPHHNEYNKPFRSVQIFQKDF 300
           FKDMDASIAKSEKKNENPNKHYLKFMDQNYIKMADASFAGPHHNEYNKPFRSVQIFQKDF
Sbjct: 241 FKDMDASIAKSEKKNENPNKHYLKFMDQNYIKMADASFAGPHHNEYNKPFRSVQIFQKDF 300

Query: 301 GQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQD 360
           GQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQD
Sbjct: 301 GQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQD 360

Query: 361 LMSKNYDVIVPNVWRPLPEFLNKEQPYDLNSWMESGEALELAKTLDEDDVIVEGYAEYPT 420
           LMSKNYDVIVPNVWRPLPEFLNKEQPYDLNSWMESGEALELAKTLDEDDVIVEGYAEYPT
Sbjct: 361 LMSKNYDVIVPNVWRPLPEFLNKEQPYDLNSWMESGEALELAKTLDEDDVIVEGYAEYPT 420

Query: 421 WRVHLAYLRDPNGDPNQTLDIDGVGGVSILAKAKLFRHGVHFPAFTFENHAETEAFGKMA 480
           WRVHLAYLRDPNGDPNQTLDIDGVGGVSILAKAKLFRHGVHFPAFTFENHAETEAFGKMA
Sbjct: 421 WRVHLAYLRDPNGDPNQTLDIDGVGGVSILAKAKLFRHGVHFPAFTFENHAETEAFGKMA 480

Query: 481 KKMGYSVGGLPNYMLWHIYEPSDDDLKDMAAIERGEYNQN 520
           KKMGYSVGGLPNYMLWHIYEPSDDDLKDMAAIERGEYNQN
Sbjct: 481 KKMGYSVGGLPNYMLWHIYEPSDDDLKDMAAIERGEYNQN 520

>Suva_13.28 Chr13 complement(39946..41538) [1593 bp, 530 aa] {ON}
           YML115C (REAL)
          Length = 530

 Score =  677 bits (1748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/476 (69%), Positives = 381/476 (80%), Gaps = 18/476 (3%)

Query: 45  CILATCLAIYLLCKATLGDSSFDPLSAINNYNSYGSYPLSRSSNKNYKNAKELEDVEYYD 104
            +L+  L I  L +  LG S       I N N     PL  S  +NYK   +LED EYY+
Sbjct: 73  IVLSLYLMILFLSEMKLGIS-------IQNGN-----PLLGS--ENYKTI-DLEDEEYYN 117

Query: 105 YDFRSIDEMSFHNFDQGEQHYLITQYGGDVVTSKDKERYIQEMENLLSSSVDKYDLSQFE 164
           YDF  ID      FD G QHYLITQ+G +V+T  D E+Y +EM  LL S+V+KYDL+ FE
Sbjct: 118 YDFEDIDPEVVSKFDDGVQHYLITQFGSEVLTPGDNEKYQEEMSMLLDSTVEKYDLTNFE 177

Query: 165 GTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSDCSEGDKTLDT 224
           G  NG E R+H+L   PLR+A  VLP+MFKHLMNLTYPHELID+AFLVSDCSEGD TLD 
Sbjct: 178 GAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDTTLDA 237

Query: 225 LITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKMADASFAGPHHN 284
           LI ++R LQ+GTL +IF+++DA I   + + +  +K YLK+MD++YI     +F+ P H+
Sbjct: 238 LIAYSRQLQNGTLSEIFQEIDAVI---DSQTKGTDKLYLKYMDEDYINRVHQAFSPPFHD 294

Query: 285 EYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVY 344
            Y+KPFRSVQ+FQKDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVY
Sbjct: 295 NYDKPFRSVQVFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVY 354

Query: 345 WRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKEQPYDLNSWMESGEALELAKT 404
           WRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLP FLN EQPYDLNSWMESGEAL+LAKT
Sbjct: 355 WRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLNSEQPYDLNSWMESGEALDLAKT 414

Query: 405 LDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILAKAKLFRHGVHFPA 464
           LDEDDVIVEGYAEYPTWRVHLAY+RD  GDPN+ +D+DGVGGVSILAKAK+FR+GV FPA
Sbjct: 415 LDEDDVIVEGYAEYPTWRVHLAYIRDAGGDPNEVVDLDGVGGVSILAKAKIFRNGVQFPA 474

Query: 465 FTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPSDDDLKDMAAIERGEYNQN 520
           FTFENHAETEAFGKMAKKMGY VGGLP+Y +WHIYEPSDDDLK++A  ER +  Q+
Sbjct: 475 FTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIATREREKRRQS 530

>YML115C Chr13 complement(40187..41794) [1608 bp, 535 aa] {ON}
           VAN1Component of the mannan polymerase I, which contains
           Van1p and Mnn9p and is involved in the first steps of
           mannan synthesis; mutants are vanadate-resistant
          Length = 535

 Score =  674 bits (1740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/485 (67%), Positives = 380/485 (78%), Gaps = 4/485 (0%)

Query: 36  RRSPAFYWTCILATCLAIYLLCKATLGDSSFDPLSAINNYNSYGSYPLSRSSNKNYKNAK 95
           R +P+ +   +  T L I  +    L  S    +    +  +  S   S  S++NYK   
Sbjct: 54  RSTPSKFQLTVSITSLIIIAVLSLYLFISFLSGMGIGVSTQNGRSLLGSSKSSENYKTI- 112

Query: 96  ELEDVEYYDYDFRSIDEMSFHNFDQGEQHYLITQYGGDVVTSKDKERYIQEMENLLSSSV 155
           +LED EYYDYDF  ID      FD G QHYLI+Q+G +V+T KD E+Y +E+  L  S+V
Sbjct: 113 DLEDEEYYDYDFEDIDPEVISKFDDGVQHYLISQFGSEVLTPKDDEKYQRELNMLFDSTV 172

Query: 156 DKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSDC 215
           ++YDLS FEG  NG E R+H+L   PLR+A  VLP+MFKHLMNLTYPHELID+AFLVSDC
Sbjct: 173 EEYDLSNFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLAFLVSDC 232

Query: 216 SEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKMAD 275
           SEGD TLD LI ++RHLQ+GTL  IF+++DA I   + + +  +K YLK+MD+ YI    
Sbjct: 233 SEGDTTLDALIAYSRHLQNGTLSQIFQEIDAVI---DSQTKGTDKLYLKYMDEGYINRVH 289

Query: 276 ASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANA 335
            +F+ P H  Y+KPFRSVQIFQKDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWLTANA
Sbjct: 290 QAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLTANA 349

Query: 336 LKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKEQPYDLNSWMES 395
           LKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLP FL  EQPYDLNSWMES
Sbjct: 350 LKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPTFLGTEQPYDLNSWMES 409

Query: 396 GEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILAKAKL 455
            EAL LAKTLDEDDVIVEGYAEYPTWRVHLAY+RD  GDPN+ +D+DGVGGVSILAKAK+
Sbjct: 410 QEALALAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEAVDLDGVGGVSILAKAKI 469

Query: 456 FRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPSDDDLKDMAAIERG 515
           FR+GV FPAFTFENHAETEAFGKMAKKMGY VGGLP+Y +WHIYEPSDDDLK++A+ ER 
Sbjct: 470 FRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEIASRERE 529

Query: 516 EYNQN 520
           +  Q+
Sbjct: 530 KRRQS 534

>Smik_13.19 Chr13 complement(36444..38054) [1611 bp, 536 aa] {ON}
           YML115C (REAL)
          Length = 536

 Score =  669 bits (1726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/426 (73%), Positives = 357/426 (83%), Gaps = 4/426 (0%)

Query: 84  SRSSNKNYKNAKELEDVEYYDYDFRSIDEMSFHNFDQGEQHYLITQYGGDVVTSKDKERY 143
           S  S+ NYK   +LED EYYDYDF  ID      FD G +HYLI+Q+G DV+T KD E+Y
Sbjct: 102 SSKSSDNYKTI-DLEDEEYYDYDFEDIDPEVVSKFDNGVEHYLISQFGSDVLTPKDDEKY 160

Query: 144 IQEMENLLSSSVDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPH 203
             E+  LL S+V+KYDLS+FEG +NG E R+H+L   PLR+A  VLP+MFKHLMNLTYPH
Sbjct: 161 QSELSMLLDSTVEKYDLSRFEGASNGVETRDHILLCVPLRNAADVLPLMFKHLMNLTYPH 220

Query: 204 ELIDIAFLVSDCSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYL 263
           ELID+AFLVSDCSE D TLD LI ++R LQ+GTL  IF+++DA I   + + +  +K YL
Sbjct: 221 ELIDLAFLVSDCSEDDTTLDALIAYSRQLQNGTLSQIFQEIDAVI---DSQTKGTDKLYL 277

Query: 264 KFMDQNYIKMADASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKL 323
           ++MDQNYI     +F+ P H  Y+KPFRSVQIFQKDFGQ+IGQGFSDRHAVKVQGIRRKL
Sbjct: 278 QYMDQNYINRVRQAFSPPFHENYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKL 337

Query: 324 MGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNK 383
           MGRARNWLTANALKPYHSWVYWRDADVELCPGS+IQDLMSKNYDVIVPNVWRPLP FL  
Sbjct: 338 MGRARNWLTANALKPYHSWVYWRDADVELCPGSIIQDLMSKNYDVIVPNVWRPLPTFLES 397

Query: 384 EQPYDLNSWMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDG 443
           EQPYDLNSWMES E LELAKTLDEDDVIVEGYAEYPTWRVHLAY+RD  GDPN+ +D+DG
Sbjct: 398 EQPYDLNSWMESKEGLELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGDPNEVIDLDG 457

Query: 444 VGGVSILAKAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPSD 503
           VGGVSILAKAKLFR+GV FPAFTFENHAETEAFGKMAKKMGY VGGLP+Y +WHIYEPSD
Sbjct: 458 VGGVSILAKAKLFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSD 517

Query: 504 DDLKDM 509
           DDLK++
Sbjct: 518 DDLKEI 523

>NCAS0B00300 Chr2 complement(35915..37418,37529..37596) [1572 bp,
           523 aa] {ON} Anc_8.842
          Length = 523

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/515 (61%), Positives = 395/515 (76%), Gaps = 15/515 (2%)

Query: 8   IKEKQKQKDELPTTRSKL-----YPKKSVYDRKRR---SPAFYWTCILATCLAIYLLCKA 59
           ++ K +Q++ LPT+R+         KK+ +  KRR   S     T      + +Y+   +
Sbjct: 11  VQNKAQQEELLPTSRNNSNYGDEEQKKNSFVPKRRKTLSSLMKLTVFSLLIIIVYIFWGS 70

Query: 60  TLGDSSFDPLSAINNYNSYGSYPLSRSSNKNYKNAKELEDVEYYDYDFRSIDEMSFHNFD 119
           +L + +       + Y+S  +    +++       K+L + EYYD+DF  I+      FD
Sbjct: 71  SLTEMT-------SKYDSVTNLHAGQNTKTASYKTKQLTENEYYDHDFEDIEPAVVKKFD 123

Query: 120 QGEQHYLITQYGGDVVTSKDKERYIQEMENLLSSSVDKYDLSQFEGTANGAENREHLLYL 179
            G QHYLI+QYG DV+T  D E Y +E++ +L +SV+KYDLS F G++NGA NR+HLL  
Sbjct: 124 NGVQHYLISQYGTDVLTPSDNEVYAKELQMVLDASVEKYDLSTFTGSSNGATNRDHLLLC 183

Query: 180 TPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSDCSEGDKTLDTLITFARHLQDGTLVD 239
            PLRDAEHVLP+MFKHLMNLTYPHELID+AFLVSDCSEGD+TLD L+ +++HLQ+GTL  
Sbjct: 184 VPLRDAEHVLPLMFKHLMNLTYPHELIDLAFLVSDCSEGDRTLDALLAYSKHLQNGTLSQ 243

Query: 240 IFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKMADASFAGPHHNEYNKPFRSVQIFQKD 299
           +F +MD       KK++     +LK+M+ +Y+K+ D SF    H+ Y+KPFRS+Q+FQKD
Sbjct: 244 VFTEMDQYEMDHSKKSKGTKNLHLKYMNPDYLKLVDTSFKKRKHSNYDKPFRSIQVFQKD 303

Query: 300 FGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQ 359
           FGQIIGQGFSDRHAVKVQGIRRKLMGRARNWL ANALKPYH+WVYWRDAD+ELCPGSVI+
Sbjct: 304 FGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHAWVYWRDADIELCPGSVIE 363

Query: 360 DLMSKNYDVIVPNVWRPLPEFLNKEQPYDLNSWMESGEALELAKTLDEDDVIVEGYAEYP 419
           DLMSK+YDVIVPNVWRPLPEFL+ EQPYDLNSW+ES EAL+LAKTLDEDDVIVEGYAEYP
Sbjct: 364 DLMSKDYDVIVPNVWRPLPEFLDGEQPYDLNSWIESDEALKLAKTLDEDDVIVEGYAEYP 423

Query: 420 TWRVHLAYLRDPNGDPNQTLDIDGVGGVSILAKAKLFRHGVHFPAFTFENHAETEAFGKM 479
           TWRVHLAY+RD  GDPN+ +D+DGVGGVSILAKAK+FR GV FPAFTFENHAETEAFGKM
Sbjct: 424 TWRVHLAYIRDAAGDPNEVVDLDGVGGVSILAKAKIFRSGVQFPAFTFENHAETEAFGKM 483

Query: 480 AKKMGYSVGGLPNYMLWHIYEPSDDDLKDMAAIER 514
           A+KMG+ VGGLP+Y +WHIYEPSDDDL ++A  ER
Sbjct: 484 ARKMGFRVGGLPHYTIWHIYEPSDDDLMEIANKER 518

>Kpol_541.15 s541 (41403..42899) [1497 bp, 498 aa] {ON}
           (41403..42899) [1497 nt, 499 aa]
          Length = 498

 Score =  664 bits (1712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/511 (62%), Positives = 396/511 (77%), Gaps = 30/511 (5%)

Query: 9   KEKQKQKDELPTTRSKLYPKKSVYDRKRRSPA-----FYWTCILATCLAIYLLCKATLGD 63
           K + K+KDELP + S+  PK     R + +PA          I+   L +  +C+ +   
Sbjct: 8   KRQLKKKDELPISDSRWAPKSKY--RHKFNPANSENFVKINAIITLILFLVFICQNSFSS 65

Query: 64  SSFDPLSAINNYNSYGSYPLSRSSNKNYKNAKELEDVEYYDYDFRSIDEMSFHNFDQGEQ 123
           SS + + +  N                   AK LED EYYDYDF++ DE     FD G +
Sbjct: 66  SSSNVVDSHTN------------------EAKILEDNEYYDYDFKNFDEPLVKKFDDGAK 107

Query: 124 HYLITQYGGDVVTSKDKERYIQEMENLLSSSVDKYDLSQFEGTANGAENREHLLYLTPLR 183
           HYLI++YG +V+T +DK RY QE++ LLS++V  YDLS++ GT NG +NREH+L   PLR
Sbjct: 108 HYLISKYGSEVLTPEDKSRYEQELQELLSTTVQNYDLSKYSGTENGIQNREHVLLCVPLR 167

Query: 184 DAEHVLPMMFKHLMNLTYPHELIDIAFLVSDCSEGDKTLDTLITFARHLQDGTLVDIFKD 243
           DAE VLP+MFK++MNLTYPHELID+AFLVSDC+EGD TL++LI ++RHLQDGTL  +F++
Sbjct: 168 DAEDVLPLMFKNIMNLTYPHELIDLAFLVSDCTEGDHTLESLIAYSRHLQDGTLAGLFQE 227

Query: 244 MDASIAKSEKKNENPNKHYLKFMDQNYIKMADASFAGPHHNEYNKPFRSVQIFQKDFGQI 303
           MD   +K + +     K YLK+M+++Y+KM + +++ P HN+Y KPFRSVQIFQKDFGQ 
Sbjct: 228 MDKDDSKKDSE-----KLYLKYMNKDYLKMVEDAYSPPFHNDYEKPFRSVQIFQKDFGQE 282

Query: 304 IGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMS 363
           +GQGF++RH+VKVQGIRRKLMGRARNWL  NALKPYH+WVYWRDADVELCPG+VI+DLMS
Sbjct: 283 VGQGFTERHSVKVQGIRRKLMGRARNWLMTNALKPYHAWVYWRDADVELCPGTVIEDLMS 342

Query: 364 KNYDVIVPNVWRPLPEFLNKEQPYDLNSWMESGEALELAKTLDEDDVIVEGYAEYPTWRV 423
           KN+DV+VPNVWRPLPEFLN EQPYDLNSWMES EAL+LAK LDEDDVIVEGYAEYPTWRV
Sbjct: 343 KNFDVMVPNVWRPLPEFLNSEQPYDLNSWMESNEALKLAKNLDEDDVIVEGYAEYPTWRV 402

Query: 424 HLAYLRDPNGDPNQTLDIDGVGGVSILAKAKLFRHGVHFPAFTFENHAETEAFGKMAKKM 483
           HLAY+R+ NG+PNQ +D+DGVGGVSIL KAKLFR G+HFPAFTFENHAETEAFGKMAKKM
Sbjct: 403 HLAYIREKNGNPNQVVDLDGVGGVSILVKAKLFRSGIHFPAFTFENHAETEAFGKMAKKM 462

Query: 484 GYSVGGLPNYMLWHIYEPSDDDLKDMAAIER 514
           G+ VGGLP+Y LWHIYEPSDDDL ++A+ ER
Sbjct: 463 GFRVGGLPHYTLWHIYEPSDDDLLEIASKER 493

>ZYRO0G14234g Chr7 (1134555..1136084) [1530 bp, 509 aa] {ON} similar
           to uniprot|P23642 Saccharomyces cerevisiae YML115C VAN1
           Mannosyltransferase with a role in protein N-
           glycosylation
          Length = 509

 Score =  660 bits (1702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/499 (64%), Positives = 380/499 (76%), Gaps = 17/499 (3%)

Query: 17  ELPTTRSKLYPKKSVYDRKRRSPAFYWTCILATCLAIYLLCKATLGDSSFDPLSAINNYN 76
           +LPT+ SKL PK      + R     W  I    L +Y                A +   
Sbjct: 22  KLPTSHSKLSPKGKRSSWQNRK-IVSWVIITVMVLILY---------------KAFSGVV 65

Query: 77  SYGSYPL-SRSSNKNYKNAKELEDVEYYDYDFRSIDEMSFHNFDQGEQHYLITQYGGDVV 135
             G   + +  SN +  + + LE+  YYDYDF  ID      FD G QHYLITQ+G DV+
Sbjct: 66  RGGREVMKTVGSNTSSNDGQVLEEDAYYDYDFEDIDPKVIEKFDGGVQHYLITQFGNDVL 125

Query: 136 TSKDKERYIQEMENLLSSSVDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKH 195
           T +D E + +E + LLSS+V+ YDLS F G+ANGA N EH+L   PLRDAE VLP+MFKH
Sbjct: 126 TPQDGEVFEREQKMLLSSTVESYDLSMFRGSANGAANGEHVLLCVPLRDAEKVLPLMFKH 185

Query: 196 LMNLTYPHELIDIAFLVSDCSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKN 255
           LMNLTYPHELID+AFLVSDC+E DKTLD LI ++R LQ GTL  +F DMD + A++E+ +
Sbjct: 186 LMNLTYPHELIDLAFLVSDCTEDDKTLDALIAYSRQLQSGTLSQVFADMDQAAAEAEQAS 245

Query: 256 ENPNKHYLKFMDQNYIKMADASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVK 315
           +   K YLK+M+ +Y++    SF+ P H  Y+KPFRSVQ+FQKDFGQ+IGQGFSDRHAVK
Sbjct: 246 KGTEKLYLKYMNPDYLETVKESFSPPFHENYDKPFRSVQVFQKDFGQMIGQGFSDRHAVK 305

Query: 316 VQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWR 375
           VQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVI+DLMSK+YDV VPNVWR
Sbjct: 306 VQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKDYDVAVPNVWR 365

Query: 376 PLPEFLNKEQPYDLNSWMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDP 435
           PLP+FL+ EQPYDLNSWMESGEAL LAKTLDEDDVIVEGYAEYPT+RVHLAY+RDP  DP
Sbjct: 366 PLPQFLDGEQPYDLNSWMESGEALNLAKTLDEDDVIVEGYAEYPTYRVHLAYIRDPTQDP 425

Query: 436 NQTLDIDGVGGVSILAKAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYML 495
           N+ LD+DGVGGVSILAKA+LFR G+ FPAFTFENHAETE FGKMAKKMGY VGGLP+Y L
Sbjct: 426 NEILDLDGVGGVSILAKAELFRRGIQFPAFTFENHAETEGFGKMAKKMGYRVGGLPHYTL 485

Query: 496 WHIYEPSDDDLKDMAAIER 514
           WHIYEPSDDDL+++A  ER
Sbjct: 486 WHIYEPSDDDLREIANKER 504

>Skud_13.26 Chr13 complement(39821..41440) [1620 bp, 539 aa] {ON}
           YML115C (REAL)
          Length = 539

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/422 (73%), Positives = 357/422 (84%), Gaps = 4/422 (0%)

Query: 90  NYKNAKELEDVEYYDYDFRSIDEMSFHNFDQGEQHYLITQYGGDVVTSKDKERYIQEMEN 149
           NYK   +LED EYY+YDF  ID      FD GEQHYLI+Q+G +V+  +++E Y +E+  
Sbjct: 108 NYKTI-DLEDEEYYNYDFEDIDPEVISKFDGGEQHYLISQFGSEVLPPENEEEYQKELNM 166

Query: 150 LLSSSVDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIA 209
           LL S+V+KYDLS FEG  NG E R+H+L   PLR+A  VLP+MFKHLMNLTYPHELID+A
Sbjct: 167 LLDSTVEKYDLSDFEGAPNGLETRDHILLCIPLRNAADVLPLMFKHLMNLTYPHELIDLA 226

Query: 210 FLVSDCSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYLKFMDQN 269
           FLVSDCSEGD TLD LI ++R LQ+GTL  IF+D+DA I   + + +  +K YLK+MD++
Sbjct: 227 FLVSDCSEGDTTLDALIAYSRQLQNGTLSQIFQDIDAII---DSQTKGTDKLYLKYMDED 283

Query: 270 YIKMADASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARN 329
           YI     +F+ P H+ Y+KPFRSVQIFQKDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARN
Sbjct: 284 YINRVHQAFSPPFHDNYDKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARN 343

Query: 330 WLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKEQPYDL 389
           WLTANALKPYHSWVYWRDADVELCPGSVI+DLMSKNYDV+VPNVWRPLP FLN EQ YDL
Sbjct: 344 WLTANALKPYHSWVYWRDADVELCPGSVIEDLMSKNYDVVVPNVWRPLPTFLNSEQAYDL 403

Query: 390 NSWMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSI 449
           NSWMES EALELAKTLDEDDVIVEGYAEYPTWRVHLAY+RD  G+PN+ +D+DGVGGVSI
Sbjct: 404 NSWMESREALELAKTLDEDDVIVEGYAEYPTWRVHLAYIRDAEGNPNEVVDLDGVGGVSI 463

Query: 450 LAKAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPSDDDLKDM 509
           LAKAK+FR+GV FPAFTFENHAETEAFGKMAKKMGY VGGLP+Y +WHIYEPSDDDLK++
Sbjct: 464 LAKAKIFRNGVQFPAFTFENHAETEAFGKMAKKMGYRVGGLPHYTIWHIYEPSDDDLKEI 523

Query: 510 AA 511
           A 
Sbjct: 524 AT 525

>KNAG0G03420 Chr7 (733195..734730) [1536 bp, 511 aa] {ON} Anc_8.842
           YML115C
          Length = 511

 Score =  654 bits (1686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/429 (70%), Positives = 359/429 (83%), Gaps = 1/429 (0%)

Query: 86  SSNKNYKNAKELEDVEYYDYDFRSIDEMSFHNFDQGEQHYLITQYGGDVVTSKDKERYIQ 145
           S N NYK    L++ EYY+YDF ++D      FDQG QHYLI+++G DV+T KD+ERY  
Sbjct: 79  SGNHNYKTVN-LQENEYYNYDFETLDPHVIGKFDQGVQHYLISEFGNDVLTPKDQERYEA 137

Query: 146 EMENLLSSSVDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHEL 205
           E++ L  S+V +YDL++F G+ +G  NR+H+L   PLRDAE VLP+MFKHLMNLTYPHEL
Sbjct: 138 EVKQLFDSTVQRYDLNEFTGSPDGETNRDHVLICVPLRDAEEVLPLMFKHLMNLTYPHEL 197

Query: 206 IDIAFLVSDCSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYLKF 265
           ID+AFLVSDCS+ D TL+ LI ++R LQ+GTL  IF +MDA       K+   NK YLK+
Sbjct: 198 IDVAFLVSDCSDDDNTLEALIAYSRQLQNGTLSQIFGEMDAVTDYLNAKDRKNNKLYLKY 257

Query: 266 MDQNYIKMADASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMG 325
           M Q Y+   + +F  P+H  Y+KPFRSVQIF+K+FGQIIGQGFSDRHAVKVQGIRRKLMG
Sbjct: 258 MKQEYLNKVEKAFTPPYHENYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMG 317

Query: 326 RARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKEQ 385
           R+RNWLTANALKPYHSWVYWRDAD+ELCPGSVIQD+M+K+YDV+VPNVWRPLPEFLN EQ
Sbjct: 318 RSRNWLTANALKPYHSWVYWRDADIELCPGSVIQDMMAKDYDVLVPNVWRPLPEFLNGEQ 377

Query: 386 PYDLNSWMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVG 445
           PYDLNSWMES EALELA+TLDEDDVIVEGYAEYPTWRVHLAY+RD  GDP++ +D+DGVG
Sbjct: 378 PYDLNSWMESPEALELAETLDEDDVIVEGYAEYPTWRVHLAYIRDEEGDPSEVVDLDGVG 437

Query: 446 GVSILAKAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPSDDD 505
           GVSILA+AKLFR+GV FPAFTFENHAETEAFGKMA+K+G+ VGGLP+Y LWHIYEPSDDD
Sbjct: 438 GVSILARAKLFRNGVQFPAFTFENHAETEAFGKMARKLGFRVGGLPHYTLWHIYEPSDDD 497

Query: 506 LKDMAAIER 514
           L+++A  ER
Sbjct: 498 LREIANKER 506

>KAFR0A02830 Chr1 (586557..588080) [1524 bp, 507 aa] {ON} Anc_8.842
           YML115C
          Length = 507

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/420 (72%), Positives = 350/420 (83%), Gaps = 3/420 (0%)

Query: 97  LEDVEYYDYDFRSIDEMSFHNFDQGEQHYLITQYGGDVVTSKDKERYIQEMENLLSSSVD 156
           L D EYY++DF  ID      FDQG QHYLI+Q+G DV+T +D+E Y +EM  L  S+++
Sbjct: 89  LSDQEYYNFDFEDIDPTVIQKFDQGAQHYLISQFGTDVLTPEDQEIYEREMNMLYDSTIE 148

Query: 157 KYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSDCS 216
            YDL  F G  NGAENR+H+L   PLRDA HVLP+MF+HLMNLTYPHELID+AFLVSDCS
Sbjct: 149 TYDLQDFGGNPNGAENRDHVLLCIPLRDASHVLPLMFRHLMNLTYPHELIDLAFLVSDCS 208

Query: 217 EGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKMADA 276
           E D TLD LI F+++LQ+GTL  +  ++DA     E+ +   N H LK+MD  Y+K    
Sbjct: 209 ENDNTLDALIEFSKNLQNGTLSQVLNEIDA--FTKEETSTKSNLH-LKYMDPEYLKRVQK 265

Query: 277 SFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 336
           +F+ P H +Y+KPFRSVQIF+K+FGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL
Sbjct: 266 AFSPPFHEDYDKPFRSVQIFEKNFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 325

Query: 337 KPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKEQPYDLNSWMESG 396
           KPYHSWVYWRDAD+ELCPGSVI+DLM+K+YDVIVPNVWRPLP FL+ EQPYDLNSW ES 
Sbjct: 326 KPYHSWVYWRDADIELCPGSVIEDLMAKDYDVIVPNVWRPLPAFLSGEQPYDLNSWRESA 385

Query: 397 EALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILAKAKLF 456
           EAL+LA+TLDEDDVIVEGYAEYPTWRVHLAY+RDP G+P++ +DIDGVGGVSILAKAKLF
Sbjct: 386 EALKLAQTLDEDDVIVEGYAEYPTWRVHLAYIRDPQGNPDEVVDIDGVGGVSILAKAKLF 445

Query: 457 RHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPSDDDLKDMAAIERGE 516
           R GV FPAFTFENHAETEAFGKMAKKMGY VGGLP+Y LWHIYEPSDDDLK+MA  ER E
Sbjct: 446 RSGVQFPAFTFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDLKEMANKEREE 505

>NDAI0E00290 Chr5 complement(39735..41238,41371..41435) [1569 bp,
           522 aa] {ON} Anc_8.842
          Length = 522

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/515 (60%), Positives = 387/515 (75%), Gaps = 22/515 (4%)

Query: 11  KQKQKDELPTTRS------KLYPKKSVYDRKRRSPAFYWTCILATCLAIYLLCKATLGDS 64
           ++  K ELP +R+      +L  ++ +  +K  +       +++  +   + C  +   +
Sbjct: 13  RKDAKLELPISRNNSNVADELKKQRFIPKKKSTAKNVAIGSVVSFIICALIYCGYSYFFN 72

Query: 65  SFDPLSAINNYNSYGSYPLSRSSNKNYK-----NAKELEDVEYYDYDFRSIDEMSFHNFD 119
           +   L  IN Y           +NKN K        EL D EYY+YDF +I+      F+
Sbjct: 73  TSPRLGKINLY-----------ANKNNKVSTSYKTTELSDKEYYNYDFENIEADVLGKFE 121

Query: 120 QGEQHYLITQYGGDVVTSKDKERYIQEMENLLSSSVDKYDLSQFEGTANGAENREHLLYL 179
            G QHYLI+++G DV+T KDKE+Y +E+  LL +SV+KYDL +F+G+ NGAENR+HLL  
Sbjct: 122 NGVQHYLISEFGTDVLTPKDKEQYEKELAMLLDASVEKYDLKKFDGSRNGAENRDHLLLC 181

Query: 180 TPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSDCSEGDKTLDTLITFARHLQDGTLVD 239
            PLRDAE VLP+MFKHLMN+TYPHELID+AFLVSDCS+GD TL+ L+ ++RHLQ+GTL  
Sbjct: 182 VPLRDAESVLPLMFKHLMNMTYPHELIDLAFLVSDCSDGDNTLEALLQYSRHLQNGTLSQ 241

Query: 240 IFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKMADASFAGPHHNEYNKPFRSVQIFQKD 299
           +F+DMD    +           +LK+M+Q Y+KM + +F  P H  Y+KPFRSVQIF+KD
Sbjct: 242 VFQDMDEYQYEHSDDTRGTKNLHLKYMNQEYLKMVETAFNTPPHENYDKPFRSVQIFRKD 301

Query: 300 FGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQ 359
           FGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWL ANALKPYHSWVYWRDAD+ELCPG++++
Sbjct: 302 FGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMANALKPYHSWVYWRDADIELCPGTIVE 361

Query: 360 DLMSKNYDVIVPNVWRPLPEFLNKEQPYDLNSWMESGEALELAKTLDEDDVIVEGYAEYP 419
           D+M+ +YDV+VPNVWRPLPEFL+ EQPYDLNSW+ES EAL+LAKTL EDDVIVEGYAEYP
Sbjct: 362 DMMANDYDVLVPNVWRPLPEFLDSEQPYDLNSWIESDEALKLAKTLPEDDVIVEGYAEYP 421

Query: 420 TWRVHLAYLRDPNGDPNQTLDIDGVGGVSILAKAKLFRHGVHFPAFTFENHAETEAFGKM 479
           TWRVHLAY+R+  GDP   +D+DGVGGVSILAKAKLFR GVHFPAFTFENHAETE FGKM
Sbjct: 422 TWRVHLAYIREAQGDPTSVVDLDGVGGVSILAKAKLFRSGVHFPAFTFENHAETEGFGKM 481

Query: 480 AKKMGYSVGGLPNYMLWHIYEPSDDDLKDMAAIER 514
           AK+MGY VGGLP+Y +WHIYEPSDDDLK++A  ER
Sbjct: 482 AKRMGYRVGGLPHYTIWHIYEPSDDDLKEIANKER 516

>TDEL0B00560 Chr2 complement(107343..108872) [1530 bp, 509 aa] {ON}
           Anc_8.842 YML115C
          Length = 509

 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/521 (61%), Positives = 382/521 (73%), Gaps = 24/521 (4%)

Query: 1   MVLNFSIIKEKQKQKD--ELPTTRSKLYPKKS----VYDRKRRSPAFYWTCILATCLAIY 54
           M+  +   +EK+K  D   LP +RSKL PK       ++  R      W  I   C  ++
Sbjct: 1   MMFRWGSKREKRKDDDNYRLPVSRSKLNPKTKSASFTWNGSRVKRIANWALISVICFLMF 60

Query: 55  -LLCKATLGDSSFDPLSAINNYNSYGSYPLSRSSNKNYKNAKELEDVEYYDYDFRSIDEM 113
             L    LG S            SY +  LS              D  YYDYDF +ID  
Sbjct: 61  KFLSTVILGSSESSSPLPSIWTKSYDTITLS--------------DEAYYDYDFENIDPD 106

Query: 114 SFHNFDQGEQHYLITQYGGDVVTSKDKERYIQEMENLLSSSVDKYDLSQFEGTANGAENR 173
               FD G  +Y ITQ+G + +TS++  ++ QE+  LL S+V+KYD+ QF GT N AEN+
Sbjct: 107 VIKKFDNGVTYYKITQFGEETMTSEETTKFEQEVSMLLDSTVEKYDMEQFRGTTNAAENQ 166

Query: 174 EHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSDCSEGDKTLDTLITFARHLQ 233
           EH+L   PLRDAE+VLP+MFKHLMN+TYPHELID+AFLVSDCSEGD TLD LI ++R LQ
Sbjct: 167 EHVLLCVPLRDAENVLPLMFKHLMNITYPHELIDLAFLVSDCSEGDHTLDALIAYSRQLQ 226

Query: 234 DGTLVDIFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKMADASFAGPHHNEYNKPFRSV 293
           +GTL  +F +++ S  + +K  EN    YL++MDQ+Y++    SF+ P H  Y+K FRSV
Sbjct: 227 NGTLSQVFAEVEMSEKERKKGGEN---LYLQYMDQDYLQRVKDSFSPPFHENYDKSFRSV 283

Query: 294 QIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELC 353
           QIFQKDFGQ IGQGFSDRHAVKVQG+RRKLM RARNWLTANALKPYHSWVYWRDADVELC
Sbjct: 284 QIFQKDFGQKIGQGFSDRHAVKVQGLRRKLMARARNWLTANALKPYHSWVYWRDADVELC 343

Query: 354 PGSVIQDLMSKNYDVIVPNVWRPLPEFLNKEQPYDLNSWMESGEALELAKTLDEDDVIVE 413
           PGSVIQDLM+K+YDV+VPNVWRPLP FL+ +QPYDLNSW+ES EAL+LAKTLDEDDVIVE
Sbjct: 344 PGSVIQDLMAKDYDVMVPNVWRPLPVFLDGQQPYDLNSWIESREALDLAKTLDEDDVIVE 403

Query: 414 GYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILAKAKLFRHGVHFPAFTFENHAET 473
           GYAEYPTWR HLAY RD NGDPN+ +++DGVGGVSILA+A+LFR G+HFPAFTFENHAET
Sbjct: 404 GYAEYPTWRGHLAYFRDANGDPNEVVNLDGVGGVSILARARLFRLGIHFPAFTFENHAET 463

Query: 474 EAFGKMAKKMGYSVGGLPNYMLWHIYEPSDDDLKDMAAIER 514
           EAFGKMAKKMG+ VGGLP+Y LWHIYEPSDDDLK++   ER
Sbjct: 464 EAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLKEIGNKER 504

>SAKL0D01430g Chr4 complement(113921..115264) [1344 bp, 447 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 447

 Score =  627 bits (1618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/425 (69%), Positives = 356/425 (83%), Gaps = 3/425 (0%)

Query: 90  NYKNAKELEDVEYYDYDFRSIDEMSFHNFDQGEQHYLITQYGGDVVTSKDKERYIQEMEN 149
           NYK    L+D EYY+YDF++ID      +D+G +H+LI+Q G +V+T +D ERY +E+E 
Sbjct: 21  NYKTFS-LKDHEYYNYDFKNIDVDIIQKYDKGAEHFLISQGGAEVLTPEDNERYEKEVEM 79

Query: 150 LLSSSVDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIA 209
           LL ++VD YDLS++EG+ NGAENR+H+L   PLR+A +VLP+MFKHLMNLTYPHELID+A
Sbjct: 80  LLGATVDVYDLSKYEGSENGAENRDHVLLCVPLRNAGNVLPLMFKHLMNLTYPHELIDLA 139

Query: 210 FLVSDCSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYLKFMDQN 269
           FLVSDCSE D TLD LI +++ LQ+GTL ++F + D    K+  K  +P+  YLK+M+Q+
Sbjct: 140 FLVSDCSEDDDTLDALIAYSKELQNGTLSELFAEQDEMRRKASIKG-SPDL-YLKYMNQD 197

Query: 270 YIKMADASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARN 329
           Y+ M + +F  P H +Y+KPFRSVQ+FQKDFGQ+IGQGFSDRHAV VQGIRRKLMGRARN
Sbjct: 198 YLNMVEMAFKPPFHKDYDKPFRSVQVFQKDFGQVIGQGFSDRHAVTVQGIRRKLMGRARN 257

Query: 330 WLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKEQPYDL 389
           WLTANALKPYHSWVYWRD D+ELCPGSVI+DLMS N DV VPNVWRPLPEFL  EQ YDL
Sbjct: 258 WLTANALKPYHSWVYWRDVDIELCPGSVIEDLMSLNLDVAVPNVWRPLPEFLGGEQAYDL 317

Query: 390 NSWMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSI 449
           NSW+ESGEAL+LA TLDEDDVIVEGYAEYPTWRVHL Y+R+P+ +P + LD+DGVGGVSI
Sbjct: 318 NSWVESGEALKLANTLDEDDVIVEGYAEYPTWRVHLGYIRNPDANPYEILDLDGVGGVSI 377

Query: 450 LAKAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPSDDDLKDM 509
           LAKAKLFR GVHFPAFTFENHAETEAFGKMAKKM Y VGGLP+Y +WHIYEPSDDDLK++
Sbjct: 378 LAKAKLFRAGVHFPAFTFENHAETEAFGKMAKKMHYRVGGLPHYTVWHIYEPSDDDLKEI 437

Query: 510 AAIER 514
           A  ER
Sbjct: 438 AKKER 442

>KLTH0C03828g Chr3 complement(334500..335714) [1215 bp, 404 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 404

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/402 (71%), Positives = 334/402 (83%), Gaps = 6/402 (1%)

Query: 115 FHNFDQGEQHYLITQYGGDVVTSKDKERYIQEMENLLSSSVDKYDLSQFEGTANGAENRE 174
              FD G +HYLI++ G +++ S DKERY +E+++LL S+V+ YDL  FEG+A G  NRE
Sbjct: 2   LRKFDNGAEHYLISKGGQEILDSSDKERYEEEVKSLLDSTVEHYDLRDFEGSAQGEVNRE 61

Query: 175 HLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSDCSEGDKTLDTLITFARHLQD 234
           H+L L PLR+AE VLP+MFK+LMNLTYPHELID+AFLVSDCSE DKTL+ L+ + + LQ 
Sbjct: 62  HVLLLVPLRNAEQVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDKTLEALLEYCKELQS 121

Query: 235 GTLVDIFKDMDASIAKSEKKNENPNKH--YLKFMDQNYIKMADASFAGPHHNEYNKPFRS 292
           GTL D+F    A+ +  E+  +    H  +LK+M  +Y+KM   +++ P H  Y+KPFRS
Sbjct: 122 GTLSDVF----AAHSSDEELIKEKGTHDLFLKYMRPSYLKMVKDAYSPPFHKGYDKPFRS 177

Query: 293 VQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVEL 352
           VQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVEL
Sbjct: 178 VQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVEL 237

Query: 353 CPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKEQPYDLNSWMESGEALELAKTLDEDDVIV 412
           CPGSVIQDLMS ++DV VPNVWRPLPEFL  EQPYDLNSW+ES  AL+LA+TLDEDDVIV
Sbjct: 238 CPGSVIQDLMSTDFDVAVPNVWRPLPEFLQGEQPYDLNSWIESDPALQLAQTLDEDDVIV 297

Query: 413 EGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILAKAKLFRHGVHFPAFTFENHAE 472
           EGYAEYPTWRVHLAYLRDP+ +P   +++DGVGGVSILAKAKLFR+GVHFPAFTFENHAE
Sbjct: 298 EGYAEYPTWRVHLAYLRDPDSNPKDIIELDGVGGVSILAKAKLFRNGVHFPAFTFENHAE 357

Query: 473 TEAFGKMAKKMGYSVGGLPNYMLWHIYEPSDDDLKDMAAIER 514
           TEAFGKMAKKMGY V GLP+Y LWHIYEPSDDDL  +A  ER
Sbjct: 358 TEAFGKMAKKMGYRVAGLPHYTLWHIYEPSDDDLIQIAERER 399

>CAGL0B02321g Chr2 (220222..221760) [1539 bp, 512 aa] {ON} similar
           to uniprot|P23642 Saccharomyces cerevisiae YML115c VAN1
           Vanadate resistance protein
          Length = 512

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/421 (68%), Positives = 342/421 (81%), Gaps = 5/421 (1%)

Query: 96  ELEDVEYYDYDFRSIDEMSFHNFDQGEQHYLITQYGGDVVTSKDKERYIQEMENLLSSSV 155
           E +D  Y+ +DF  ID      FDQG  +YLI++YG +  +  D   Y   ++ LL S+V
Sbjct: 97  EFKDAAYHSFDFEDIDMDIVSKFDQGIMNYLISEYGTENPSESDLAEYNDNLQMLLDSTV 156

Query: 156 DKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSDC 215
           +KYDL  F+G+A+G E +EH+L   PLRDAE VLP+MFK+LMNLTYPHELID+AFLVSDC
Sbjct: 157 EKYDLGNFQGSADGFEQQEHILVCVPLRDAEEVLPLMFKNLMNLTYPHELIDLAFLVSDC 216

Query: 216 SEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKMAD 275
           SEGDKTL+ L T+++ LQ+G L DI  DMD       K   N + H LK+M+ +Y+K   
Sbjct: 217 SEGDKTLEALETYSQLLQEGILPDILADMD----NYNKGKSNESIH-LKYMEPDYLKRVK 271

Query: 276 ASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANA 335
           A++  P H  Y+KPFRSVQIFQKDFGQ+IGQGFSDRHAVKVQGIRRKLMGRARNWL +NA
Sbjct: 272 AAYKPPFHPNYSKPFRSVQIFQKDFGQVIGQGFSDRHAVKVQGIRRKLMGRARNWLMSNA 331

Query: 336 LKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKEQPYDLNSWMES 395
           LKPYHSWVYWRDADVELCPGSVI+DLM ++YDVIVPNVWRPLP+FLN  QPYDLNSWMES
Sbjct: 332 LKPYHSWVYWRDADVELCPGSVIEDLMLQDYDVIVPNVWRPLPKFLNSAQPYDLNSWMES 391

Query: 396 GEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILAKAKL 455
            EAL+LAKTLDEDDVIVEGYAEYPT+RVHLAY+R+ +GDP Q +D+DGVGGVSILA+A++
Sbjct: 392 NEALQLAKTLDEDDVIVEGYAEYPTYRVHLAYIREEDGDPTQVVDLDGVGGVSILARARV 451

Query: 456 FRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPSDDDLKDMAAIERG 515
           FR GVHF AFTFENHAETEAFGKMAKK+G+ VGGLP+Y LWHIYEPSDDDL  MA +E+G
Sbjct: 452 FREGVHFSAFTFENHAETEAFGKMAKKVGFRVGGLPHYTLWHIYEPSDDDLLAMAKLEKG 511

Query: 516 E 516
           +
Sbjct: 512 K 512

>KLLA0D01529g Chr4 complement(135998..137503) [1506 bp, 501 aa] {ON}
           similar to uniprot|P23642 Saccharomyces cerevisiae
           YML115C VAN1 Mannosyltransferase with a role in protein
           N- glycosylation
          Length = 501

 Score =  601 bits (1549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/418 (65%), Positives = 344/418 (82%), Gaps = 4/418 (0%)

Query: 97  LEDVEYYDYDFRSIDEMSFHNFDQGEQHYLITQYGGDVVTSKDKERYIQEMENLLSSSVD 156
           L++ EYYDYDF+ +D  +   +D+G  HY+I++ G + ++S+DKE + +E + LL+S+ D
Sbjct: 81  LDEQEYYDYDFKGLDIDTIKKYDEGVSHYIISKGGMEALSSEDKEAFEREADMLLASTTD 140

Query: 157 KYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSDCS 216
            YDLSQ+ G +NGA NR+H+L   PLRDA  +LPM+FK+LMNLTYPHELIDIAFLVSDC+
Sbjct: 141 LYDLSQYNGASNGAANRDHVLLCVPLRDAASLLPMLFKNLMNLTYPHELIDIAFLVSDCT 200

Query: 217 EGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKMADA 276
           +  +T+ +L+ F++ LQ+GTL    +D +A     + K  +  + YLK+M ++Y+KM   
Sbjct: 201 DNGRTMSSLLDFSKELQNGTLSKTLQDFEAD----KDKGNSAEQLYLKYMGKDYLKMVKN 256

Query: 277 SFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANAL 336
           +F  P H++Y+KPFRS+QIF+KDFGQ IGQGFSDRHAVKVQG+RRKLMGRARNWLTANAL
Sbjct: 257 AFNPPFHDDYDKPFRSIQIFEKDFGQQIGQGFSDRHAVKVQGVRRKLMGRARNWLTANAL 316

Query: 337 KPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKEQPYDLNSWMESG 396
           KPYHSWVYWRD DVELCPG+VI+DLM  +YDVIVPNVWRPLP FL   Q YDLNSW+ES 
Sbjct: 317 KPYHSWVYWRDVDVELCPGTVIEDLMKHDYDVIVPNVWRPLPTFLGGAQAYDLNSWVESN 376

Query: 397 EALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILAKAKLF 456
           EA++LAKTLDEDDVIVEGYAEYPTWRVHL YLR  NG+P+  LD+DGVGGVSILA+A+LF
Sbjct: 377 EAIKLAKTLDEDDVIVEGYAEYPTWRVHLGYLRKDNGNPDDLLDLDGVGGVSILARAQLF 436

Query: 457 RHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPSDDDLKDMAAIER 514
           R G+HFPAFTFENHAETEAFGKMAKKMG+ VGGL +Y LWHIYEPSDDDL+++A +ER
Sbjct: 437 RKGIHFPAFTFENHAETEAFGKMAKKMGFKVGGLMHYTLWHIYEPSDDDLREIAKLER 494

>Ecym_4613 Chr4 (1195057..1196631) [1575 bp, 524 aa] {ON} similar to
           Ashbya gossypii ABL124W
          Length = 524

 Score =  590 bits (1521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/471 (62%), Positives = 354/471 (75%), Gaps = 18/471 (3%)

Query: 47  LATCLAIYLLCKATLGDSSFDPLSAINNYNSYGSYPLSRSSNKNYKNAKELEDVEYYDYD 106
           L T   I+ L K T+  +   P           SY    S + +Y  A  LE+ EYY+++
Sbjct: 64  LLTIACIFFLIKQTMDRNGSTP----------RSYAGLLSISDSYDTAV-LEESEYYNFE 112

Query: 107 FRSIDEMSFHNFDQGEQHYLITQYGGDVVTSKDKERYIQEMENLLSSSVDKYDLSQFEGT 166
           +R +D  +   +D G +H LI Q G   + S  +E + + ++ LLS++V+ YDLS++ GT
Sbjct: 113 YRPLDLDTVRRYDDGFKHILIDQDG--TLNSNQEEGFEEHLDMLLSTTVETYDLSKYAGT 170

Query: 167 ANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSDCSEGDKTLDTLI 226
           ANGAENREH+L   PLR+AE+VLP+MF+HLMNLTYPHELID+AFLVSDCS+ D T+D+LI
Sbjct: 171 ANGAENREHVLICVPLRNAENVLPLMFRHLMNLTYPHELIDLAFLVSDCSKDDHTMDSLI 230

Query: 227 TFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKH---YLKFMDQNYIKMADASFAGPHH 283
           ++A  LQ GTL    K  DA   K  KK+++ NK    +LK+M+++Y+ M + +   P H
Sbjct: 231 SYAEELQKGTLSKSLKLQDA--YKMHKKSKSKNKEGDLHLKYMNKDYLNMVENALKEPFH 288

Query: 284 NEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWV 343
             Y+KPFRSVQIFQKDFGQIIGQGFSDRH VKVQG RRKLMG+ARNWLTANALKPYHSWV
Sbjct: 289 KNYDKPFRSVQIFQKDFGQIIGQGFSDRHHVKVQGTRRKLMGKARNWLTANALKPYHSWV 348

Query: 344 YWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKEQPYDLNSWMESGEALELAK 403
           YWRDADVELCPGSVI+DLMS  YDVIVPNVWRPLPEFL  EQ YDLNSW+ES  AL LAK
Sbjct: 349 YWRDADVELCPGSVIEDLMSVGYDVIVPNVWRPLPEFLGSEQEYDLNSWIESDNALNLAK 408

Query: 404 TLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILAKAKLFRHGVHFP 463
           TLDEDDVIVEGYAEY TWR HLA  RDP G+    LD+DGVGGVSILAKAKLFR+GVHF 
Sbjct: 409 TLDEDDVIVEGYAEYATWRFHLANNRDPQGNTMDVLDLDGVGGVSILAKAKLFRNGVHFA 468

Query: 464 AFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPSDDDLKDMAAIER 514
           AF FENHAETEAFGKMAKKMGY VGGL +Y LWHIYEPS+DDL ++A  ER
Sbjct: 469 AFAFENHAETEAFGKMAKKMGYRVGGLSHYTLWHIYEPSNDDLMEIARKER 519

>ABL124W Chr2 (162889..164346) [1458 bp, 485 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YML115C (VAN1)
          Length = 485

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/419 (66%), Positives = 331/419 (78%), Gaps = 4/419 (0%)

Query: 97  LEDVEYYDYDFRSIDEMSFHNFDQGEQHYLITQYGGDVVTSKDKERYIQEMENLLSSSVD 156
           L+D EYYDY+F +        +D+G +HY +T+ G     S+D   + ++ME L+S++V+
Sbjct: 65  LDDPEYYDYEFAAASAERLAKYDEGFEHYFVTRDGQ---ISRDDPEFEEQMEELVSATVE 121

Query: 157 KYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSDCS 216
           +YDL  +EGT NGAENREH+L   PLR+A  VLPMMFKHLMNLTYPHELID+AFLVSDCS
Sbjct: 122 QYDLRNYEGTPNGAENREHVLICIPLRNAHPVLPMMFKHLMNLTYPHELIDVAFLVSDCS 181

Query: 217 EGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKH-YLKFMDQNYIKMAD 275
           E DKTL +L+ +A +LQ GTL ++    +A I + + K+ N     YLK+MDQ Y++M  
Sbjct: 182 ENDKTLQSLMEYATYLQKGTLNNVLAREEAEIKRLKAKHGNGGGDLYLKYMDQEYLQMVR 241

Query: 276 ASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANA 335
            +F+ P+H  Y KPFRSVQ+F+KDFGQ IGQGFSDRH VKVQGIRR+LMGRARNWLTANA
Sbjct: 242 DAFSPPYHENYEKPFRSVQVFKKDFGQKIGQGFSDRHHVKVQGIRRRLMGRARNWLTANA 301

Query: 336 LKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKEQPYDLNSWMES 395
           LKPYHSWVYWRD DVELCPGSVI+DLMS  YDVIVPNVWRPLPEFL  +Q YDLNSW+ES
Sbjct: 302 LKPYHSWVYWRDVDVELCPGSVIEDLMSIGYDVIVPNVWRPLPEFLGGKQGYDLNSWIES 361

Query: 396 GEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILAKAKL 455
            +AL LAK L+EDDVIVEGYAEY TWR HL   R+  G+P + +D+DGVGGVSILAKAKL
Sbjct: 362 TDALNLAKKLEEDDVIVEGYAEYATWRFHLITAREAKGNPREVIDLDGVGGVSILAKAKL 421

Query: 456 FRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPSDDDLKDMAAIER 514
           FR G HF AF FENHAETEAFGKMAKKMGY VGGLP+Y LWHIYEPSDDD+ D+A  ER
Sbjct: 422 FRQGAHFTAFAFENHAETEAFGKMAKKMGYKVGGLPHYTLWHIYEPSDDDIMDIARRER 480

>TPHA0C04780 Chr3 (1031751..1033328) [1578 bp, 525 aa] {ON}
           Anc_1.479 YEL036C
          Length = 525

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/471 (61%), Positives = 356/471 (75%), Gaps = 10/471 (2%)

Query: 49  TCLAIYLLCKATLGDSSFDPLSAINNYNSYGSYPLSRSSNKNYKNAKELEDVEYYDYDFR 108
             L++ LLC       S +   +I  YNS+        +     + + L   EYY+YDF 
Sbjct: 56  VALSVILLCIFIAKTISVN--VSIYKYNSFVH---EEETETVTFDTQVLTAPEYYNYDFH 110

Query: 109 SIDEMSFHNFDQGEQHYLITQYGGDVVTS---KDKERYIQEMENLLSSSVDKYDLSQFEG 165
             +  +   +D+G + YL+  Y  D V+    + KE Y  E+  LLSSSVD YD+  F G
Sbjct: 111 DYNLDTISKYDKGVRQYLLDTYKTDDVSQLSVQAKEAYDAELPKLLSSSVDIYDMKDFSG 170

Query: 166 TANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSDCSEGDKTLDTL 225
           T++G  +REH+L   PLRDAE VLP+MFK+LMNLTYPHELID+AFLVSDCSE D TL++L
Sbjct: 171 TSHGVSSREHVLLCIPLRDAEDVLPLMFKNLMNLTYPHELIDVAFLVSDCSENDHTLESL 230

Query: 226 ITFARHLQDGTLVDIFKDMDASIAKSEKKNENPN--KHYLKFMDQNYIKMADASFAGPHH 283
           + + R LQ+GTL D+F++MD     ++K  EN +  K YLK+M + Y++    +F  P H
Sbjct: 231 LQYTRFLQNGTLPDVFEEMDKLDEMTDKVVENADDSKLYLKYMKKEYLQRVKEAFKSPFH 290

Query: 284 NEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWV 343
             Y+KPFRS+QI++KDFGQ +GQ FSDRH VKVQGIRRKLMGRARNWL  NALKPYHSWV
Sbjct: 291 ENYDKPFRSIQIYKKDFGQTVGQSFSDRHDVKVQGIRRKLMGRARNWLMTNALKPYHSWV 350

Query: 344 YWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKEQPYDLNSWMESGEALELAK 403
           YWRDADVELCPG+VI+DLMSK++DVIVPNVWRPLPEF+N EQPYDLNSWMES EA++LAK
Sbjct: 351 YWRDADVELCPGTVIEDLMSKDFDVIVPNVWRPLPEFMNSEQPYDLNSWMESREAIDLAK 410

Query: 404 TLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILAKAKLFRHGVHFP 463
            L ED+VIVEGYAEYPTWRVHLAYLR+ +GDPNQ +D+DGVGGVSILA+A+LFR GVHFP
Sbjct: 411 KLHEDEVIVEGYAEYPTWRVHLAYLREKDGDPNQVVDVDGVGGVSILARARLFRAGVHFP 470

Query: 464 AFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPSDDDLKDMAAIER 514
           AFTFENHAETEAFGKMAKKMG+ VGGLP+Y LWHIYEPSDDDL  +A  E+
Sbjct: 471 AFTFENHAETEAFGKMAKKMGFRVGGLPHYTLWHIYEPSDDDLMAIATKEK 521

>Kwal_27.10246 s27 complement(260882..261901) [1020 bp, 339 aa] {ON}
           YML115C (VAN1) - mannosyltransferase [contig 38] FULL
          Length = 339

 Score =  521 bits (1342), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/341 (71%), Positives = 283/341 (82%), Gaps = 2/341 (0%)

Query: 179 LTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSDCSEGDKTLDTLITFARHLQDGTLV 238
           + PLR+A+ VLP+MFK+LMNLTYPHELID+AFLVSDCSE D+T + L+ +A+ LQ GTL 
Sbjct: 1   MVPLRNAQKVLPLMFKNLMNLTYPHELIDLAFLVSDCSEDDRTFEALLEYAKELQSGTLS 60

Query: 239 DIFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKMADASFAGPHHNEYNKPFRSVQIFQK 298
            +F   ++   ++  + E  +  +LK+M  +Y+KM   +F  P H  Y+KPFRSVQIFQK
Sbjct: 61  QVFASHNS--GENVLREEGSSDLFLKYMRPSYLKMVKDAFTPPFHKNYDKPFRSVQIFQK 118

Query: 299 DFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVI 358
           +FGQ+IGQ FSDRHAVKVQG RRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVI
Sbjct: 119 NFGQVIGQTFSDRHAVKVQGTRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVI 178

Query: 359 QDLMSKNYDVIVPNVWRPLPEFLNKEQPYDLNSWMESGEALELAKTLDEDDVIVEGYAEY 418
           +DLM+  YDV VPNVWRPLPEFL+ EQ YDLNSW+ES  AL+LAK LDEDDVIVEGYAEY
Sbjct: 179 EDLMATGYDVTVPNVWRPLPEFLSGEQAYDLNSWVESDIALDLAKQLDEDDVIVEGYAEY 238

Query: 419 PTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILAKAKLFRHGVHFPAFTFENHAETEAFGK 478
           PTWRVHL Y+R+ +GDP  T+D+DGVGGVSILAKA+LFR+GVHFPAFTFENHAETEAFGK
Sbjct: 239 PTWRVHLGYIREEDGDPKSTIDLDGVGGVSILAKAQLFRNGVHFPAFTFENHAETEAFGK 298

Query: 479 MAKKMGYSVGGLPNYMLWHIYEPSDDDLKDMAAIERGEYNQ 519
           MAKKMGYSV GLP+Y LWHIYEPSDDDL  +   ER    Q
Sbjct: 299 MAKKMGYSVAGLPHYTLWHIYEPSDDDLIQVRERERESKRQ 339

>Ecym_3573 Chr3 complement(1085088..1086431) [1344 bp, 447 aa] {ON}
           similar to Ashbya gossypii AFR357W
          Length = 447

 Score =  398 bits (1022), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 197/374 (52%), Positives = 252/374 (67%), Gaps = 52/374 (13%)

Query: 143 YIQEMENLLSSSVDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYP 202
           Y+   +N+    VD YDLS ++G  +G +  + +L+  PLRDA + LPM FKHL ++TYP
Sbjct: 40  YVPNFKNV--PGVDYYDLSNYQGNKDGWQRADRVLFCVPLRDAANHLPMFFKHLKSMTYP 97

Query: 203 HELIDIAFLVSDCSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHY 262
           H LID++FLVSD ++     DT+         G L++   D+ +                
Sbjct: 98  HNLIDLSFLVSDSTD-----DTM---------GVLLNSLHDLQSQ--------------- 128

Query: 263 LKFMDQNYIKMADASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRK 322
                      AD +          K F  ++IFQKDFGQIIGQ FSDRH    QG RRK
Sbjct: 129 -----------ADGT----------KRFGDIEIFQKDFGQIIGQSFSDRHGFAAQGPRRK 167

Query: 323 LMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLN 382
           LM RARNWL + A+KPYHSWVYWRD DVE  P ++++DLM  + D+IVPNVWRPLP++LN
Sbjct: 168 LMARARNWLGSAAIKPYHSWVYWRDVDVEYVPETILEDLMHHDKDIIVPNVWRPLPKWLN 227

Query: 383 KEQPYDLNSWMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDID 442
             QPYDLNSW+ES   L+LA +L EDDVIVEGY EY TWRVHLAY+RDPNGDP   +++D
Sbjct: 228 YIQPYDLNSWVESEGGLQLAASLKEDDVIVEGYPEYATWRVHLAYMRDPNGDPETEMELD 287

Query: 443 GVGGVSILAKAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPS 502
           G+GGVSIL+KAK+FR G HFPAF+FE HAETEAFGK++++M YSV GLP+Y++WH+YEPS
Sbjct: 288 GIGGVSILSKAKVFRTGSHFPAFSFEKHAETEAFGKLSRRMKYSVVGLPHYVIWHVYEPS 347

Query: 503 DDDLKDMAAIERGE 516
            DDLK MA +   E
Sbjct: 348 SDDLKHMAWMAEEE 361

>KLTH0C03432g Chr3 complement(297214..298683) [1470 bp, 489 aa] {ON}
           similar to uniprot|P32629 Saccharomyces cerevisiae
           YEL036C ANP1 Mannan 8 Protein of the endoplasmic
           reticulum with a role in retention of
           glycosyltransferases in the Golgi also involved in
           osmotic sensitivity and resistance to aminonitrophenyl
           propanediol subunit of mannosyltransferase complex
          Length = 489

 Score =  392 bits (1006), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 192/374 (51%), Positives = 247/374 (66%), Gaps = 52/374 (13%)

Query: 143 YIQEMENLLSSSVDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYP 202
           Y+   EN+   +V  YDL  ++G A+G +  +H+L+  PLRDA   LPM F H+  ++YP
Sbjct: 43  YVPSFENV--PNVQYYDLRNYQGHADGWQRGDHVLFTVPLRDAAEHLPMFFDHMDRISYP 100

Query: 203 HELIDIAFLVSDCSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHY 262
           H LID++FLVSD S+     DT+     +LQ                   K    P++  
Sbjct: 101 HNLIDLSFLVSDSSD-----DTMGVLLEYLQ-------------------KAQSKPDR-- 134

Query: 263 LKFMDQNYIKMADASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRK 322
                                    + F +++I++KDFGQ IGQ FSDRH    QG RRK
Sbjct: 135 ------------------------TQRFGNIEIYEKDFGQAIGQSFSDRHGFAAQGPRRK 170

Query: 323 LMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLN 382
           LMGRARNWL + ALKPYHSWVYWRD DVE  P ++++DLM  + DVIVPNVWRPLP++L 
Sbjct: 171 LMGRARNWLGSVALKPYHSWVYWRDVDVETIPPTILEDLMHHDRDVIVPNVWRPLPDWLG 230

Query: 383 KEQPYDLNSWMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDID 442
             QPYDLNSW ES   L+LA++LDED VIVEGY EY TWR HLAY+RDP+GDP   +++D
Sbjct: 231 NIQPYDLNSWQESEGGLQLAESLDEDSVIVEGYPEYATWRTHLAYMRDPSGDPEDEMELD 290

Query: 443 GVGGVSILAKAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPS 502
           G+GGVSIL+KAK+FR G HFPAF+FE HAETEAFGK+++++GYSV GLP+Y++WHIYEPS
Sbjct: 291 GIGGVSILSKAKVFRAGSHFPAFSFEKHAETEAFGKLSRRLGYSVVGLPHYVIWHIYEPS 350

Query: 503 DDDLKDMAAIERGE 516
            DDLK MA +   E
Sbjct: 351 SDDLKHMAWMAEEE 364

>SAKL0D11792g Chr4 (979538..980989) [1452 bp, 483 aa] {ON} similar
           to uniprot|P32629 Saccharomyces cerevisiae YEL036C ANP1
           Mannan 8 Protein of the endoplasmic reticulum with a
           role in retention of glycosyltransferases in the Golgi
           also involved in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol subunit of
           mannosyltransferase complex
          Length = 483

 Score =  390 bits (1002), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 191/375 (50%), Positives = 250/375 (66%), Gaps = 52/375 (13%)

Query: 142 RYIQEMENLLSSSVDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTY 201
           +Y+  ++N+    V+ YDL+ ++G A+G +  + +L+  PLRDA   LPM FKH+  ++Y
Sbjct: 71  QYVPNLKNV--PQVEYYDLNNYQGNADGWQRGDRVLFCVPLRDAAEHLPMFFKHMDEISY 128

Query: 202 PHELIDIAFLVSDCSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKH 261
           PH LID++FLVSD S+     DT+         G L+   K   ++  KS++        
Sbjct: 129 PHNLIDLSFLVSDSSD-----DTM---------GVLLSSLKKAQSNQDKSQR-------- 166

Query: 262 YLKFMDQNYIKMADASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRR 321
                                       F +++IF+KDFGQ+IGQ FSDRH    QG RR
Sbjct: 167 ----------------------------FGNIEIFEKDFGQVIGQSFSDRHGFAAQGPRR 198

Query: 322 KLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFL 381
           KLM RARNWL + ALKPYHSWVYWRD DVE  P ++++DLM  N DVIVPNVWRPLP++L
Sbjct: 199 KLMARARNWLGSVALKPYHSWVYWRDVDVETIPRTILEDLMHHNKDVIVPNVWRPLPDWL 258

Query: 382 NKEQPYDLNSWMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDI 441
              QPYDLNSW ES   L+LA +L+ED VIVEGY EY TWR HLAY+RDP+GDP   +++
Sbjct: 259 GNIQPYDLNSWKESEGGLQLADSLEEDAVIVEGYPEYATWRTHLAYMRDPSGDPEAEMEL 318

Query: 442 DGVGGVSILAKAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEP 501
           DG+GGVSIL+KAK+FR G HFPAF+FE HAETEAFGK++++M YSV GLP+Y++WH+YEP
Sbjct: 319 DGIGGVSILSKAKVFRTGSHFPAFSFEKHAETEAFGKLSRRMKYSVVGLPHYVIWHVYEP 378

Query: 502 SDDDLKDMAAIERGE 516
           S DDLK MA +   E
Sbjct: 379 SSDDLKHMAWMAEEE 393

>KNAG0I00300 Chr9 complement(39873..41246) [1374 bp, 457 aa] {ON}
           Anc_1.479 YEL036C
          Length = 457

 Score =  387 bits (995), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 190/359 (52%), Positives = 238/359 (66%), Gaps = 50/359 (13%)

Query: 158 YDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSDCSE 217
           YDL  + G +NG +  + +L+  PLRDA   LPM FKHL  +TYPH L+D++FLVSD  +
Sbjct: 70  YDLKNYRGNSNGWQTGDRILFCVPLRDAAEHLPMFFKHLNEMTYPHNLVDLSFLVSDSKD 129

Query: 218 GDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKMADAS 277
                DT+     +LQ               A+S+K                        
Sbjct: 130 -----DTMGVLLSNLQ--------------TAQSQK------------------------ 146

Query: 278 FAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTANALK 337
                  + +K F +++ F+KDFGQIIGQ FSDRH    QG RRKLM RARNWL + A+K
Sbjct: 147 -------DRSKRFGNIEFFEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGSVAIK 199

Query: 338 PYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKEQPYDLNSWMESGE 397
           PYHSWVYWRD DVE  P ++++DLM    DVIVPNVWRPLPE+L   QPYDLNSW ES  
Sbjct: 200 PYHSWVYWRDVDVETAPVTIMEDLMHHGKDVIVPNVWRPLPEWLGNIQPYDLNSWQESDA 259

Query: 398 ALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILAKAKLFR 457
            LELA +LD+D VIVEGY EY TWR HLAY+RDPNGDP   +++DG+GGVSIL+KA++FR
Sbjct: 260 GLELADSLDDDAVIVEGYPEYATWRPHLAYMRDPNGDPEVEMELDGIGGVSILSKARVFR 319

Query: 458 HGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPSDDDLKDMAAIERGE 516
            G HFPAF+FE HAETEAFGK++++MGYSV GLP+Y++WHIYEPS +DLK MA +   E
Sbjct: 320 SGSHFPAFSFEKHAETEAFGKLSRRMGYSVVGLPHYVIWHIYEPSTEDLKHMAWMAEEE 378

>Kwal_27.10157 s27 complement(219928..221358) [1431 bp, 476 aa] {ON}
           YEL036C (ANP1) - subunit of mannosyltransferase complex
           [contig 41] FULL
          Length = 476

 Score =  385 bits (990), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 191/374 (51%), Positives = 250/374 (66%), Gaps = 52/374 (13%)

Query: 143 YIQEMENLLSSSVDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYP 202
           Y+   +N+    V+ YDL  ++G  +G +  + +L+  PLRDA   LPM F H+  ++YP
Sbjct: 43  YVPSFKNV--PGVEYYDLRNYQGNRDGWQRGDRVLFTVPLRDAAEHLPMFFDHMDKISYP 100

Query: 203 HELIDIAFLVSDCSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHY 262
           H LID++FLVSD S+     DT+         G L+D  K    + +K+++K        
Sbjct: 101 HNLIDLSFLVSDSSD-----DTM---------GVLLDHLK---KAQSKTDRK-------- 135

Query: 263 LKFMDQNYIKMADASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRK 322
                                    K F +++IF+KDFGQ IGQ FSDRH    QG RRK
Sbjct: 136 -------------------------KRFGNIEIFEKDFGQAIGQSFSDRHGFAAQGPRRK 170

Query: 323 LMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLN 382
           LMGRARNWL + ALKPYHSWVYWRD DVE  P ++++DLM  + DVIVPNVWRPLP++L 
Sbjct: 171 LMGRARNWLGSVALKPYHSWVYWRDVDVETIPRTILEDLMHHDRDVIVPNVWRPLPDWLG 230

Query: 383 KEQPYDLNSWMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDID 442
             QPYDLNSW ES   ++LA++LDED VIVEGY EY TWR HLAY+RDP+G+P   +++D
Sbjct: 231 NIQPYDLNSWQESEGGMQLAESLDEDAVIVEGYPEYATWRTHLAYMRDPSGNPEDEMELD 290

Query: 443 GVGGVSILAKAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPS 502
           G+GGVSIL+KAK+FR G HFPAF+FE HAETEAFGK+++++GYSV GLP+Y++WHIYEPS
Sbjct: 291 GIGGVSILSKAKVFRAGSHFPAFSFEKHAETEAFGKLSRRLGYSVIGLPHYVIWHIYEPS 350

Query: 503 DDDLKDMAAIERGE 516
            DDLK MA +   E
Sbjct: 351 SDDLKHMAWMAEEE 364

>YEL036C Chr5 complement(83050..84552) [1503 bp, 500 aa] {ON}
           ANP1Subunit of the alpha-1,6 mannosyltransferase
           complex; type II membrane protein; has a role in
           retention of glycosyltransferases in the Golgi; involved
           in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol
          Length = 500

 Score =  386 bits (991), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 190/368 (51%), Positives = 247/368 (67%), Gaps = 52/368 (14%)

Query: 143 YIQEMENLLSSSVDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYP 202
           Y+ + +N  + SV+ YDL  ++G  +G +  + +L+  PLRDA   LPM F HL  +TYP
Sbjct: 52  YVPDFKN--TPSVEFYDLRNYQGNKDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMTYP 109

Query: 203 HELIDIAFLVSDCSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHY 262
           H LID++FLVSD S  D T+  L++                 +  +A+S++         
Sbjct: 110 HNLIDLSFLVSDSS--DNTMGVLLS-----------------NLQMAQSQQ--------- 141

Query: 263 LKFMDQNYIKMADASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRK 322
                                 + +K F +++I++KDFGQIIGQ FSDRH    QG RRK
Sbjct: 142 ----------------------DKSKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRK 179

Query: 323 LMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLN 382
           LM RARNWL + ALKPYHSWVYWRD DVE  P ++++DLM  + DVIVPNVWRPLP++L 
Sbjct: 180 LMARARNWLGSVALKPYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLG 239

Query: 383 KEQPYDLNSWMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDID 442
             QPYDLNSW ES   L+LA +LDED VIVEGY EY TWR HLAY+RDPNG+P   +++D
Sbjct: 240 NIQPYDLNSWKESEGGLQLADSLDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELD 299

Query: 443 GVGGVSILAKAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPS 502
           G+GGVSILAKAK+FR G HFPAF+FE HAETEAFG+++++M Y+V GLP+Y++WHIYEPS
Sbjct: 300 GIGGVSILAKAKVFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPS 359

Query: 503 DDDLKDMA 510
            DDLK MA
Sbjct: 360 SDDLKHMA 367

>KAFR0I02770 Chr9 (559196..560563) [1368 bp, 455 aa] {ON} Anc_1.479
           YEL036C
          Length = 455

 Score =  384 bits (986), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 190/374 (50%), Positives = 245/374 (65%), Gaps = 52/374 (13%)

Query: 143 YIQEMENLLSSSVDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYP 202
           Y+ + +N+    V+ YDL  ++G ++G +  + +L+  PLRDA   LPM F+HL  +TYP
Sbjct: 52  YVPDFKNV--PGVEYYDLRNYQGNSDGWQRNDRILFCVPLRDAAEHLPMFFEHLNLMTYP 109

Query: 203 HELIDIAFLVSDCSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHY 262
           H  ID++FLVSD S+     DT+     HLQ          MD S               
Sbjct: 110 HNFIDLSFLVSDSSD-----DTMGVLLSHLQSAQ-----SQMDKS--------------- 144

Query: 263 LKFMDQNYIKMADASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRK 322
                                    K F +++I++KDFGQIIGQ FSDRH    QG RRK
Sbjct: 145 -------------------------KRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRK 179

Query: 323 LMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLN 382
           LM RARNWL + ALKPYHSWVYWRD DVE  P ++++DLM  + DVIVPNVWRPLP++L 
Sbjct: 180 LMARARNWLGSVALKPYHSWVYWRDVDVETVPRTIMEDLMHHDKDVIVPNVWRPLPDWLG 239

Query: 383 KEQPYDLNSWMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDID 442
             QPYDLNSW ES   L+LA+ L+ED VIVEGY EY TWR HLAY+RDPNGDP + +++D
Sbjct: 240 NIQPYDLNSWQESEGGLQLAEALEEDAVIVEGYPEYATWRPHLAYMRDPNGDPEEEMELD 299

Query: 443 GVGGVSILAKAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPS 502
           G+GGVSIL+KAK+FR G HFPAF+FE HAETEAFG+++++M Y+V GLP+Y++WHIYEPS
Sbjct: 300 GIGGVSILSKAKVFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVVGLPHYVIWHIYEPS 359

Query: 503 DDDLKDMAAIERGE 516
            +DLK MA +   E
Sbjct: 360 TEDLKHMAWMAEEE 373

>CAGL0L01331g Chr12 complement(151156..152499) [1344 bp, 447 aa]
           {ON} highly similar to uniprot|P32629 Saccharomyces
           cerevisiae YEL036c ANP1 required for protein
           glycosylation in the golgi
          Length = 447

 Score =  382 bits (981), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 189/363 (52%), Positives = 239/363 (65%), Gaps = 52/363 (14%)

Query: 154 SVDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVS 213
            V+ YDL+ + G  +G +  + +L+  PLRDA   LPM F HL  +TYPH LID++FLVS
Sbjct: 53  GVEFYDLNDYTGLPDGWQRNDRILFCVPLRDAAEHLPMFFDHLNAMTYPHHLIDLSFLVS 112

Query: 214 DCSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKM 273
           D S+     +T+     HLQ               A+ +K                    
Sbjct: 113 DSSD-----NTMGVLMHHLQQ--------------AQKDK-------------------- 133

Query: 274 ADASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTA 333
                        NK F +++IF+KDFGQIIGQ FSDRH    QG RRKLM RARNWL +
Sbjct: 134 -------------NKRFGNIEIFEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWLGS 180

Query: 334 NALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKEQPYDLNSWM 393
            A+KPYHSWVYWRD DVE+ P S+++DLM  + DVIVPNVWRPLP++L   QPYDLNSW+
Sbjct: 181 VAIKPYHSWVYWRDVDVEVIPRSIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWV 240

Query: 394 ESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILAKA 453
           ES   L+LA TL ED VIVEGY EY TWR HLAY+RDPNG+P   + +DG+GGVSIL+KA
Sbjct: 241 ESEGGLQLADTLSEDSVIVEGYPEYATWRTHLAYMRDPNGNPEDEMMLDGIGGVSILSKA 300

Query: 454 KLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPSDDDLKDMAAIE 513
           ++FR G HFPAF+F+ HAETEAFGK++++MG+ V GLP+Y++WHIYEPS DDLK MA + 
Sbjct: 301 RVFRAGSHFPAFSFQKHAETEAFGKLSRRMGFDVVGLPHYVIWHIYEPSTDDLKYMAWMA 360

Query: 514 RGE 516
             E
Sbjct: 361 EEE 363

>TDEL0C02600 Chr3 complement(450202..451590) [1389 bp, 462 aa] {ON}
           Anc_1.479 YEL036C
          Length = 462

 Score =  382 bits (981), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 191/364 (52%), Positives = 240/364 (65%), Gaps = 51/364 (14%)

Query: 154 SVDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVS 213
            V+ YDL  ++G  +G +    +L+L PLRDA   LP  F H+  L+YPH LID++FLVS
Sbjct: 56  GVEYYDLRNYQGDRDGWQRGNRILFLVPLRDAAQHLPRFFGHMSELSYPHNLIDMSFLVS 115

Query: 214 DCSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKM 273
           D S+     DT+     HLQ              IA+S+K                    
Sbjct: 116 DSSD-----DTMGELLHHLQ--------------IAQSQK-------------------- 136

Query: 274 ADASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTA 333
                      + NK F +++IF+KDFGQ IGQ FSDRH    QG RRKLM RARNWL +
Sbjct: 137 -----------DRNKRFGNIEIFEKDFGQAIGQSFSDRHGFAAQGPRRKLMARARNWLGS 185

Query: 334 NALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKEQPYDLNSWM 393
             LKPYHSWVYWRD DVE+ P S+++DLM  + DVIVPNVWRPLP++L   QPYDLNSW 
Sbjct: 186 VTLKPYHSWVYWRDVDVEIAPISIMEDLMHHDRDVIVPNVWRPLPDWLGNIQPYDLNSWK 245

Query: 394 ESGEALELAKTL-DEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILAK 452
           ES   ++LA TL DED VIVEGY E+ TWR HLAY+RDPNG+P   +++DG+GGVSILAK
Sbjct: 246 ESEAGIQLANTLTDEDSVIVEGYPEFATWRTHLAYMRDPNGNPEDEMELDGIGGVSILAK 305

Query: 453 AKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPSDDDLKDMAAI 512
           AK+FR G HFPAF+FE HAETEAFGK++++M Y+V GLP+Y++WHIYEPS +DLK MA +
Sbjct: 306 AKVFRTGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVIWHIYEPSTEDLKHMAWM 365

Query: 513 ERGE 516
              E
Sbjct: 366 AEEE 369

>TBLA0B02170 Chr2 complement(499391..501109) [1719 bp, 572 aa] {ON}
           Anc_1.479 YEL036C
          Length = 572

 Score =  386 bits (991), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 191/365 (52%), Positives = 241/365 (66%), Gaps = 50/365 (13%)

Query: 152 SSSVDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFL 211
           +  V  YDL+ + G ++G +  + +L+  PLRDA   LP  F HL  +TYPH LID++FL
Sbjct: 69  TPGVHFYDLNNYRGNSDGWQRNDRILFCVPLRDAAQHLPRFFNHLNTMTYPHNLIDLSFL 128

Query: 212 VSDCSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYLKFMDQNYI 271
           VSD  +     DT+     HLQ               A+S+               QN +
Sbjct: 129 VSDSKD-----DTMGVLLSHLQ--------------TAQSQ---------------QNKL 154

Query: 272 KMADASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWL 331
           K                 F +++I++KDFGQIIGQ FSDRH    QG RRKLM RARNWL
Sbjct: 155 KR----------------FGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRKLMARARNWL 198

Query: 332 TANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKEQPYDLNS 391
            + ALKPYHSWVYWRD DVE CP ++++DLM    DVIVPNVWRPLP++L   QPYDLNS
Sbjct: 199 GSVALKPYHSWVYWRDVDVETCPVTIMEDLMHHGKDVIVPNVWRPLPDWLGNIQPYDLNS 258

Query: 392 WMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILA 451
           W ES   L+LA +LDED VIVEGY EY TWR HLAY+RDPNGDP + +++DG+GGVSIL+
Sbjct: 259 WQESEGGLQLADSLDEDAVIVEGYPEYATWRPHLAYMRDPNGDPEEEMELDGIGGVSILS 318

Query: 452 KAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPSDDDLKDMAA 511
           KAK+FR G HFPAF+FE HAETEAFGK++++M Y+V GLP+Y++WHIYEPS +DLK MA 
Sbjct: 319 KAKVFRSGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVVWHIYEPSTEDLKHMAW 378

Query: 512 IERGE 516
           +   E
Sbjct: 379 MAEEE 383

>AFR357W Chr6 (1086069..1087373) [1305 bp, 434 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL036C (ANP1)
          Length = 434

 Score =  380 bits (977), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 192/364 (52%), Positives = 236/364 (64%), Gaps = 51/364 (14%)

Query: 154 SVDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVS 213
            V+ +DLS   G A+G    + +L+  PLRDA   LPM FKHL  +TYPH L+D++FLVS
Sbjct: 41  GVEYWDLSWSRGKADGWAQGDRVLFCVPLRDAAEHLPMFFKHLSEMTYPHNLVDLSFLVS 100

Query: 214 DCSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKM 273
           D    D+T+  L    R LQ                 S+  N                  
Sbjct: 101 DSK--DETMSVLRQHVRELQ-----------------SQPDNA----------------- 124

Query: 274 ADASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTA 333
                         + F +++IFQKDFGQ IGQ FSDRH    QG RRKLM RARNWL +
Sbjct: 125 --------------RQFGNIEIFQKDFGQAIGQSFSDRHGFAAQGPRRKLMARARNWLGS 170

Query: 334 NALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKEQPYDLNSWM 393
            ALKPYHSWVYWRD DVE  P ++I+DLM  + DVIVPNVWRPLP++L   QPYDLNSW+
Sbjct: 171 VALKPYHSWVYWRDVDVETVPQTIIEDLMHHDKDVIVPNVWRPLPDWLGDIQPYDLNSWV 230

Query: 394 ESGEALELAK-TLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILAK 452
           ES   L+LA  T DED VIVEGY EY TWRVHLAY+RDPNGDP   +++DG+GGVSIL++
Sbjct: 231 ESEGGLQLAADTPDEDAVIVEGYPEYATWRVHLAYMRDPNGDPETEMELDGIGGVSILSR 290

Query: 453 AKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPSDDDLKDMAAI 512
           A++FR G HFPAF+F+ HAETE FGK+++ MGYSV GLP+Y++WHIYEPS DDLK MA +
Sbjct: 291 ARVFRSGSHFPAFSFQKHAETEGFGKLSRAMGYSVVGLPHYVIWHIYEPSSDDLKHMAWM 350

Query: 513 ERGE 516
              E
Sbjct: 351 AEEE 354

>NDAI0B01250 Chr2 complement(293756..295096) [1341 bp, 446 aa] {ON}
           Anc_1.479
          Length = 446

 Score =  381 bits (978), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 186/363 (51%), Positives = 238/363 (65%), Gaps = 50/363 (13%)

Query: 154 SVDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVS 213
           SV+ YD+S ++G  +G      +L   PL+DA + LP+ FK L  +TYPHELID++FLVS
Sbjct: 54  SVEFYDMSNYQGHKDGWNQNNRILICVPLKDASNALPLFFKTLEKMTYPHELIDLSFLVS 113

Query: 214 DCSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKM 273
           D S  D T+  L+   + LQ                                        
Sbjct: 114 DSS--DNTMYNLLNMLKRLQ---------------------------------------- 131

Query: 274 ADASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTA 333
            D   +G         F +++I++KDFGQ+IGQGFSDRH    QG RRKLMG+ARNWL  
Sbjct: 132 IDGGTSGK--------FGNIEIYEKDFGQVIGQGFSDRHGFAAQGPRRKLMGKARNWLNT 183

Query: 334 NALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKEQPYDLNSWM 393
            A+KPYHSWVYWRD DVE+ P ++++DLM  + DVIVPNVWRPLP++L   QPYDLNSW 
Sbjct: 184 VAIKPYHSWVYWRDVDVEIIPETILEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWK 243

Query: 394 ESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILAKA 453
           ES   L L+ +L ED VIVEGY EY TWR HLAY+RDPNGDP + +++DGVGGVSIL+KA
Sbjct: 244 ESEAGLALSNSLGEDAVIVEGYPEYATWRSHLAYMRDPNGDPEREMELDGVGGVSILSKA 303

Query: 454 KLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPSDDDLKDMAAIE 513
            +FR G HFPAF+F+ HAETEAFGK++K M ++V GLPNY++WHIYEPS +DL+ MA +E
Sbjct: 304 NVFRSGSHFPAFSFKKHAETEAFGKLSKHMNFTVIGLPNYVVWHIYEPSKEDLQYMAKLE 363

Query: 514 RGE 516
             E
Sbjct: 364 EKE 366

>NCAS0G04110 Chr7 (766896..768380) [1485 bp, 494 aa] {ON} Anc_1.479
          Length = 494

 Score =  382 bits (982), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 190/374 (50%), Positives = 249/374 (66%), Gaps = 52/374 (13%)

Query: 143 YIQEMENLLSSSVDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYP 202
           Y+    N+    V+ YDL  ++G  +G +  + +L+  PLRDA   LPM F HL  +TYP
Sbjct: 72  YVPNFRNV--PGVEFYDLGNYQGNKDGWQRNDRILFCVPLRDAAEHLPMFFDHLNKMTYP 129

Query: 203 HELIDIAFLVSDCSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHY 262
           H LID++FLVSD S  D T+  L++   +LQ+              A+S++         
Sbjct: 130 HNLIDLSFLVSDSS--DNTMGVLLS---NLQN--------------AQSQQ--------- 161

Query: 263 LKFMDQNYIKMADASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRK 322
                                 + +K F +++IF+KDFGQIIGQ FSDRH  K QG RRK
Sbjct: 162 ----------------------DRSKRFGNIEIFEKDFGQIIGQSFSDRHGFKAQGPRRK 199

Query: 323 LMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLN 382
           LM RARNWL + A+KPYHSWVYWRD DVE  P ++++DLM  + DVIVPNVWRPLP++L 
Sbjct: 200 LMARARNWLGSVAIKPYHSWVYWRDVDVETIPRTIMEDLMHHDKDVIVPNVWRPLPDWLG 259

Query: 383 KEQPYDLNSWMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDID 442
             QPYDLNSW ES   L+LA +LDED VIVEGY EY TWR HLAY+RDPNG+P   ++++
Sbjct: 260 NIQPYDLNSWQESEGGLQLANSLDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELN 319

Query: 443 GVGGVSILAKAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPS 502
           G+GGVSIL+KAK+FR G HFPAF+FE HAETEAFGK++++M ++V GLP+Y++WHIYEPS
Sbjct: 320 GIGGVSILSKAKVFRSGSHFPAFSFEKHAETEAFGKLSRRMNFNVIGLPHYVIWHIYEPS 379

Query: 503 DDDLKDMAAIERGE 516
            +DLK MA +   E
Sbjct: 380 KEDLKHMAWMAEEE 393

>NDAI0G00340 Chr7 complement(56898..58412) [1515 bp, 504 aa] {ON}
           Anc_1.479 YEL036C
          Length = 504

 Score =  382 bits (981), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 187/357 (52%), Positives = 240/357 (67%), Gaps = 50/357 (14%)

Query: 154 SVDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVS 213
            V+ YDL+ ++G  +G +  + +L+  PLRDA   LPM F HL  ++YPH  ID++FLVS
Sbjct: 86  GVEFYDLANYQGNKDGWQKNDRILFCVPLRDAAEHLPMFFDHLNKMSYPHNSIDLSFLVS 145

Query: 214 DCSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKM 273
           D S+     DT+     +LQ+              A+S++                    
Sbjct: 146 DSSD-----DTMGVLLSNLQN--------------AQSQQ-------------------- 166

Query: 274 ADASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTA 333
                      + +K F +++IF+KDFGQ+IGQ FSDRH    QG RRKLM RARNWL +
Sbjct: 167 -----------DKSKRFGNIEIFEKDFGQVIGQSFSDRHGFAAQGPRRKLMARARNWLGS 215

Query: 334 NALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKEQPYDLNSWM 393
            A+KPYHSWVYWRD DVE  P ++++DLM  + DVIVPNVWRPLP++L   QPYDLNSW 
Sbjct: 216 VAIKPYHSWVYWRDVDVETIPRTIMEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWK 275

Query: 394 ESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILAKA 453
           ES   L+LA TL EDDVIVEGY EY TWR HLAY+RDPNG+P   +++DG+GGVSILAKA
Sbjct: 276 ESEGGLQLADTLGEDDVIVEGYPEYATWRSHLAYMRDPNGNPEDEMELDGIGGVSILAKA 335

Query: 454 KLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPSDDDLKDMA 510
           K+FR G HFPAF+FE HAETEAFGK+++KM Y+V GLP+Y++WHIYEPS +DLK MA
Sbjct: 336 KVFRTGSHFPAFSFEKHAETEAFGKLSRKMNYNVIGLPHYVIWHIYEPSKEDLKHMA 392

>Smik_5.57 Chr5 complement(85152..86627) [1476 bp, 491 aa] {ON}
           YEL036C (REAL)
          Length = 491

 Score =  381 bits (979), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 187/368 (50%), Positives = 244/368 (66%), Gaps = 52/368 (14%)

Query: 143 YIQEMENLLSSSVDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYP 202
           Y+ + +N  +  V+ YDL  ++G  +G +  + +L+  PLRDA   LPM F HL  +TYP
Sbjct: 52  YVPDFKN--TPDVEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMTYP 109

Query: 203 HELIDIAFLVSDCSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHY 262
           H LID++FLVSD S  D T+  L++                   ++ K++ + +      
Sbjct: 110 HNLIDLSFLVSDSS--DNTMGVLLS-------------------NLHKAQSQQDK----- 143

Query: 263 LKFMDQNYIKMADASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRK 322
                                   +K F +++I++KDFGQIIGQ FSDRH    QG RRK
Sbjct: 144 ------------------------SKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRK 179

Query: 323 LMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLN 382
           LM RARNWL + ALKPYHSWVYWRD DVE  P ++++DLM  + DVIVPNVWRPLP++L 
Sbjct: 180 LMARARNWLGSVALKPYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLG 239

Query: 383 KEQPYDLNSWMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDID 442
             QPYDLNSW ES   L+LA  L+ED VIVEGY EY TWR HLAY+RDPNG+P   +++D
Sbjct: 240 NIQPYDLNSWKESEGGLQLADALEEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELD 299

Query: 443 GVGGVSILAKAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPS 502
           G+GGVSILAKAK+FR G HFPAF+FE HAETEAFG+++++M Y+V GLP+Y++WHIYEPS
Sbjct: 300 GIGGVSILAKAKVFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPS 359

Query: 503 DDDLKDMA 510
            DDLK MA
Sbjct: 360 SDDLKHMA 367

>Suva_5.33 Chr5 complement(58480..59967) [1488 bp, 495 aa] {ON}
           YEL036C (REAL)
          Length = 495

 Score =  381 bits (978), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 188/368 (51%), Positives = 242/368 (65%), Gaps = 52/368 (14%)

Query: 143 YIQEMENLLSSSVDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYP 202
           Y+ + +N  +  V+ YDL  ++G  +G +  + +L+  PLRDA   LPM F HL  ++YP
Sbjct: 52  YVPDFKN--TPGVEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFDHLNAMSYP 109

Query: 203 HELIDIAFLVSDCSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHY 262
           H LID++FLVSD S  D T+  L++                                   
Sbjct: 110 HNLIDLSFLVSDSS--DNTMGVLLS----------------------------------- 132

Query: 263 LKFMDQNYIKMADASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRK 322
                   ++MA +        +  K F +++I++KDFGQIIGQ FSDRH    QG RRK
Sbjct: 133 -------KLQMAQS------QQDKTKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRK 179

Query: 323 LMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLN 382
           LM RARNWL + ALKPYHSWVYWRD DVE  P ++++DLM  + DVIVPNVWRPLP++L 
Sbjct: 180 LMARARNWLGSVALKPYHSWVYWRDVDVETIPTTIMEDLMHHDKDVIVPNVWRPLPDWLG 239

Query: 383 KEQPYDLNSWMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDID 442
             QPYDLNSW ES   L+LA  LDED VIVEGY EY TWR HLAY+RDPNG+P   +++D
Sbjct: 240 NIQPYDLNSWKESEGGLQLANALDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELD 299

Query: 443 GVGGVSILAKAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPS 502
           G+GGVSILAKAK+FR G HFPAF+FE HAETEAFG+++++M Y+V GLP+Y++WHIYEPS
Sbjct: 300 GIGGVSILAKAKVFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPS 359

Query: 503 DDDLKDMA 510
            DDLK MA
Sbjct: 360 SDDLKHMA 367

>Skud_5.54 Chr5 complement(81169..82644) [1476 bp, 491 aa] {ON}
           YEL036C (REAL)
          Length = 491

 Score =  380 bits (977), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 187/368 (50%), Positives = 243/368 (66%), Gaps = 52/368 (14%)

Query: 143 YIQEMENLLSSSVDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYP 202
           Y+ + +N  +  V+ YDL  ++G  +G +  + +L+  PLRDA   LPM F HL  ++YP
Sbjct: 52  YVPDFKN--TPDVEFYDLRNYQGNQDGWQQGDRILFCVPLRDASEHLPMFFNHLNTMSYP 109

Query: 203 HELIDIAFLVSDCSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHY 262
           H LID++FLVSD S  D T+  L++                     A+S++         
Sbjct: 110 HNLIDLSFLVSDSS--DNTMGVLLS-----------------SLQTAQSQQ--------- 141

Query: 263 LKFMDQNYIKMADASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRK 322
                                 + +K F +++I++KDFGQIIGQ FSDRH    QG RRK
Sbjct: 142 ----------------------DKSKRFGNIEIYEKDFGQIIGQSFSDRHGFGAQGPRRK 179

Query: 323 LMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLN 382
           LM RARNWL + ALKPYHSWVYWRD DV+  P ++++DLM  + DVIVPNVWRPLP++L 
Sbjct: 180 LMARARNWLGSVALKPYHSWVYWRDVDVQTIPTTIMEDLMHHDKDVIVPNVWRPLPDWLG 239

Query: 383 KEQPYDLNSWMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDID 442
             QPYDLNSW ES   L+LA  LDED VIVEGY EY TWR HLAY+RDPNG+P   +++D
Sbjct: 240 NIQPYDLNSWKESEGGLQLADALDEDAVIVEGYPEYATWRPHLAYMRDPNGNPEDEMELD 299

Query: 443 GVGGVSILAKAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPS 502
           G+GGVSILAKAK+FR G HFPAF+FE HAETEAFG+++++M Y+V GLP+Y++WHIYEPS
Sbjct: 300 GIGGVSILAKAKVFRTGSHFPAFSFEKHAETEAFGRLSRRMNYNVIGLPHYVIWHIYEPS 359

Query: 503 DDDLKDMA 510
            DDLK MA
Sbjct: 360 SDDLKHMA 367

>Kpol_370.5 s370 (7329..9266) [1938 bp, 645 aa] {ON} (7329..9266)
           [1938 nt, 646 aa]
          Length = 645

 Score =  384 bits (987), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 185/368 (50%), Positives = 243/368 (66%), Gaps = 52/368 (14%)

Query: 143 YIQEMENLLSSSVDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYP 202
           Y+ + +N  +  V+ YDLS ++G  +G +  + +L+  PLRDA   LPM F H+  +TYP
Sbjct: 56  YVPDFKN--TPGVEFYDLSNYQGNKDGWQQNDRILFCIPLRDAAQHLPMFFDHMNKMTYP 113

Query: 203 HELIDIAFLVSDCSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHY 262
           H L+D++FLVSD S+     DT+     HLQ             ++   + K+       
Sbjct: 114 HNLVDLSFLVSDSSD-----DTMGVLLSHLQ-------------TVQSQQDKS------- 148

Query: 263 LKFMDQNYIKMADASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRK 322
                                    K F +++I++KDFGQIIGQ FSDRH    QG RRK
Sbjct: 149 -------------------------KRFGNIEIYEKDFGQIIGQSFSDRHGFAAQGPRRK 183

Query: 323 LMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLN 382
           LM +ARNWL + ALKPYHSWVYWRD D+E  P ++++DLM  + D+IVPNVWRPLP++L 
Sbjct: 184 LMAKARNWLGSVALKPYHSWVYWRDVDIETAPVTIMEDLMHHDKDIIVPNVWRPLPDWLG 243

Query: 383 KEQPYDLNSWMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDID 442
             QPYDLNSW ES   L+LA  LDE+ VIVEGY EY TWR HLAY+RDPNGDP   +++D
Sbjct: 244 NIQPYDLNSWQESEGGLQLANQLDENAVIVEGYPEYATWRPHLAYMRDPNGDPEDEMELD 303

Query: 443 GVGGVSILAKAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPS 502
           G+GGVSIL+KAK+FR G HFPAF+FE HAETEAFGK++++M Y+V GLP+Y++WHIYEPS
Sbjct: 304 GIGGVSILSKAKVFRSGSHFPAFSFEKHAETEAFGKLSRRMNYNVVGLPHYVVWHIYEPS 363

Query: 503 DDDLKDMA 510
            +DLK MA
Sbjct: 364 TEDLKHMA 371

>KLLA0E22155g Chr5 complement(1976362..1977714) [1353 bp, 450 aa]
           {ON} similar to uniprot|P32629 Saccharomyces cerevisiae
           YEL036C ANP1 Mannan 8 Protein of the endoplasmic
           reticulum with a role in retention of
           glycosyltransferases in the Golgi also involved in
           osmotic sensitivity and resistance to aminonitrophenyl
           propanediol subunit of mannosyltransferase complex
          Length = 450

 Score =  373 bits (957), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 184/363 (50%), Positives = 236/363 (65%), Gaps = 50/363 (13%)

Query: 154 SVDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVS 213
            V+ YDL  ++G ANG +  + +++  PLRDA   L M F  L  LTYPH LID++FLVS
Sbjct: 56  GVEYYDLINYQGNANGWQTGDRVVFCVPLRDAAAHLDMFFDTLDKLTYPHNLIDLSFLVS 115

Query: 214 DCSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKM 273
           D S  D T+ TL++  R  Q                                        
Sbjct: 116 DSS--DDTMKTLLSHLRRAQS--------------------------------------- 134

Query: 274 ADASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTA 333
                    + + ++ F +++IF+KDFGQ +GQ FSDRH    QG RRK M RARNWL +
Sbjct: 135 ---------NQDKSRRFANIEIFEKDFGQSVGQSFSDRHGFAAQGPRRKSMARARNWLGS 185

Query: 334 NALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKEQPYDLNSWM 393
            ALKPYHS+VYWRD DV+  P ++++DLM  + DVIVPNVWRPLP++L   QPYDLNSW+
Sbjct: 186 AALKPYHSYVYWRDVDVQTIPNTILEDLMHHDKDVIVPNVWRPLPDWLGNIQPYDLNSWV 245

Query: 394 ESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILAKA 453
           ES   L+LA +LDED  IVEGY EY TWR HLAY+RDP+GDP   +++DG+GGVSIL+KA
Sbjct: 246 ESEGGLQLADSLDEDACIVEGYPEYATWRTHLAYMRDPSGDPEVEMELDGIGGVSILSKA 305

Query: 454 KLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPSDDDLKDMAAIE 513
           K+FR G HFPAF+FE HAETEAFGK++++M YSV GLP+Y++WHIYEPS DDLK MA + 
Sbjct: 306 KVFRTGSHFPAFSFEKHAETEAFGKLSRRMQYSVVGLPHYVIWHIYEPSSDDLKHMAWMA 365

Query: 514 RGE 516
             E
Sbjct: 366 EEE 368

>TPHA0O00430 Chr15 (76318..77964) [1647 bp, 548 aa] {ON} Anc_1.479
           YEL036C
          Length = 548

 Score =  376 bits (965), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 180/358 (50%), Positives = 238/358 (66%), Gaps = 50/358 (13%)

Query: 152 SSSVDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFL 211
           + +V+ YDL  ++G  +G +  + +++  PLRDA   LP  F HL  ++YPH LID++FL
Sbjct: 62  TPNVEFYDLRNYKGNKDGWQRNDRIVFCVPLRDAAQHLPRFFDHLDKMSYPHNLIDLSFL 121

Query: 212 VSDCSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYLKFMDQNYI 271
           VSD S+     DT+     +LQ               A+S++                  
Sbjct: 122 VSDSSD-----DTMGVLLSNLQ--------------TAQSQR------------------ 144

Query: 272 KMADASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWL 331
                        + +K F +++I++KDFGQ+IGQ FSDRH    QG RRKLM RARNWL
Sbjct: 145 -------------DKSKRFGNIEIYEKDFGQVIGQSFSDRHGFAGQGPRRKLMARARNWL 191

Query: 332 TANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKEQPYDLNS 391
            + ALKPYHSWVYWRD D+E  P ++++DLM  + D+IVPNVWRPLP++L   QPYDLNS
Sbjct: 192 GSVALKPYHSWVYWRDVDIETAPRTIMEDLMHHDKDIIVPNVWRPLPDWLGNIQPYDLNS 251

Query: 392 WMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILA 451
           W ES   L+LA  L+ED VIVEGY EY TWR HLAY+RDPNGDP   +++DG+GGVSIL+
Sbjct: 252 WQESEGGLQLANQLNEDAVIVEGYPEYATWRPHLAYMRDPNGDPEVEMELDGIGGVSILS 311

Query: 452 KAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPSDDDLKDM 509
           KA +FR G HFPAF+FE HAETEAFGK++++MGY+V GLP+Y++WHIYEPS +DLK M
Sbjct: 312 KANVFRSGSHFPAFSFEKHAETEAFGKLSRRMGYNVIGLPHYVVWHIYEPSTEDLKHM 369

>ZYRO0F05170g Chr6 (432802..434628) [1827 bp, 608 aa] {ON} similar
           to uniprot|P32629 Saccharomyces cerevisiae YEL036C ANP1
           Mannan 8 Protein of the endoplasmic reticulum with a
           role in retention of glycosyltransferases in the Golgi
           also involved in osmotic sensitivity and resistance to
           aminonitrophenyl propanediol subunit of
           mannosyltransferase complex
          Length = 608

 Score =  373 bits (957), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 187/369 (50%), Positives = 238/369 (64%), Gaps = 53/369 (14%)

Query: 143 YIQEMENLLSSSVDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYP 202
           Y+    N+   +V+ YDL  ++G  +G +    +L+L PLRDA   LP  F H+  +TYP
Sbjct: 53  YVPNFRNV--PNVEYYDLRNYQGDPDGWQRDNRILFLVPLRDAAEHLPRFFNHMDKMTYP 110

Query: 203 HELIDIAFLVSDCSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHY 262
           H LID +FLVSD S+     DT+     HL                   EK   N +K  
Sbjct: 111 HNLIDFSFLVSDSSD-----DTMGALLSHL-------------------EKAQSNKDK-- 144

Query: 263 LKFMDQNYIKMADASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRK 322
                                    + F +++I++KDFGQ IGQ FSDRH    QG RRK
Sbjct: 145 ------------------------TRRFGNIEIYEKDFGQAIGQSFSDRHGFDAQGPRRK 180

Query: 323 LMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLN 382
           LM RARNWL   ALK YHSWVYWRD DVELCP S+++DLM  + DVIVPNVWRPLP++L 
Sbjct: 181 LMARARNWLGTVALKAYHSWVYWRDVDVELCPQSIMEDLMHHDRDVIVPNVWRPLPDWLG 240

Query: 383 KEQPYDLNSWMESGEALELAKTLDEDD-VIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDI 441
             QPYDLNSW ES   ++LA +L +DD VIVEGY +Y TWR HLAY+RDPNG+P   L++
Sbjct: 241 NIQPYDLNSWKESEVGVQLADSLPDDDAVIVEGYPDYSTWRTHLAYMRDPNGNPEDELEL 300

Query: 442 DGVGGVSILAKAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEP 501
           DG+GGVSIL+K K+FR G HFPAF+FE HAETEAFGK++++MGY+V GLP+Y++WHIYEP
Sbjct: 301 DGIGGVSILSKGKVFRTGSHFPAFSFEKHAETEAFGKLSRRMGYNVVGLPHYVIWHIYEP 360

Query: 502 SDDDLKDMA 510
           S +DL+ MA
Sbjct: 361 STEDLQHMA 369

>KLLA0E12849g Chr5 complement(1138282..1139460) [1179 bp, 392 aa]
           {ON} highly similar to uniprot|P39107 Saccharomyces
           cerevisiae YPL050C MNN9 Subunit of Golgi
           mannosyltransferase complex also containing Anp1p Mnn10p
           Mnn11p and Hoc1p that mediates elongation of the
           polysaccharide mannan backbone forms a separate complex
           with Van1p that is also involved in backbone elongation
          Length = 392

 Score =  208 bits (529), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 122/352 (34%), Positives = 183/352 (51%), Gaps = 61/352 (17%)

Query: 155 VDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSD 214
           +  YDL++ + T+N   N+E +L LTP++         + +L++LTYP  LI++ F++  
Sbjct: 96  IAHYDLNKLKSTSNALVNKERVLILTPMQTFHQ---QYWNNLLSLTYPRALIELGFIIPR 152

Query: 215 CSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKMA 274
            + GD  L  L +  R +Q G                                       
Sbjct: 153 TASGDAALQKLESAVREVQTG--------------------------------------- 173

Query: 275 DASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 334
                     + +K F  + I ++        G  DRHA++VQ  RR  M  ARN L  +
Sbjct: 174 ----------KQDKRFAKITILRQASQSFDRLGEKDRHALEVQKERRAAMALARNELLFS 223

Query: 335 ALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKEQ------PYD 388
            + P+ SW+ W DAD+   P +VIQDL S N  V+  NV++   +F +K+Q      PYD
Sbjct: 224 TIGPHTSWILWLDADIVETPVTVIQDLTSHNKPVLAANVYQ---KFYDKDQKKESIRPYD 280

Query: 389 LNSWMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVS 448
            N+W ES   L+LA+ L ++++IVEGY+E  T+R  +A+  D NG  N  +++DGVGG  
Sbjct: 281 FNNWAESEIGLKLAQQLGDNEIIVEGYSEIATYRPLMAHFYDANGATNSLMELDGVGGGC 340

Query: 449 ILAKAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYE 500
            L KA++ R G  F  F F +  ETEAF KMAK++GYSV GLPNY+++HI E
Sbjct: 341 TLVKAEVHRDGAMFTNFPFYHLIETEAFAKMAKRLGYSVFGLPNYLVYHIEE 392

>CAGL0L12804g Chr12 (1371568..1372749) [1182 bp, 393 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050c required for complex N-glycosylation
          Length = 393

 Score =  199 bits (506), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 122/357 (34%), Positives = 186/357 (52%), Gaps = 65/357 (18%)

Query: 155 VDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSD 214
           V KYDL++   T++ A N+E +L LTP++         + +L+ LTYP +L+++ F++  
Sbjct: 94  VAKYDLNKLHSTSDAAVNKEQVLILTPMQTFHQA---YWDNLLQLTYPRDLLELGFIIPK 150

Query: 215 CSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKMA 274
            + GD  L                   K ++A++ +++   +N                 
Sbjct: 151 SASGDAAL-------------------KQLEAAVKRAQTDKKN----------------- 174

Query: 275 DASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGF-----SDRHAVKVQGIRRKLMGRARN 329
                    N + K    V I ++D      +GF      +RHA+ VQ  RR  M  ARN
Sbjct: 175 ---------NRFGK----VTILRQD-----SKGFDKLQEKERHALAVQKERRSAMALARN 216

Query: 330 WLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVW-RPLPEFLNKE--QP 386
            L  + + P+ SWV W DAD+     S+IQD+ + N  V+  NV+ R   E  NK   +P
Sbjct: 217 ELLFSTIGPHTSWVLWLDADIIETKPSLIQDMTALNKPVLAANVYQRYFDEAENKPSIRP 276

Query: 387 YDLNSWMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGG 446
           YD N+W +S  A EL   + +D++IVEGYAE  T+R  +A+   P+G PN+ + +DGVGG
Sbjct: 277 YDFNNWADSQIAQELGDKMGDDEIIVEGYAEIATYRPLMAHFYTPDGPPNELMSLDGVGG 336

Query: 447 VSILAKAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPSD 503
              L KA++ R G  FP F F +  ETE F KMAK++ Y V GLPNY+++HI E +D
Sbjct: 337 GCTLVKAEVHRDGAMFPTFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVFHIEERND 393

>KNAG0A02150 Chr1 complement(187175..188365) [1191 bp, 396 aa] {ON}
           Anc_8.500 YPL050C
          Length = 396

 Score =  199 bits (505), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 135/422 (31%), Positives = 197/422 (46%), Gaps = 81/422 (19%)

Query: 86  SSNKNYKNAKELEDVEYYDYDFRSIDEMSFHNFDQGEQH-YLITQYGGDVVTSKDKERYI 144
           SS  N+K A ELE   Y+ +            +   EQH +L   +  D++         
Sbjct: 46  SSLVNHKWAHELEKTWYFPFT----KNFKMPKYSYKEQHNWLFNDHVDDIIPE------- 94

Query: 145 QEMENLLSSSVDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHE 204
                   + +  YDL++   T   A N+E +L LTP++         + +++++TYP E
Sbjct: 95  --------NHIAHYDLNKLHSTKQAAVNKERVLILTPMQTFHE---QYWDNILHMTYPRE 143

Query: 205 LIDIAFLVSDCSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYLK 264
           LI++ F+      GD  L  L    + +Q G                 KKNE        
Sbjct: 144 LIELGFIAPRTPTGDAALKKLEAAIKKIQSG-----------------KKNER------- 179

Query: 265 FMDQNYIKMADASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLM 324
                                    F  + I +++          DRHA+ VQ  RR  M
Sbjct: 180 -------------------------FAKIIILRQESQSFDMLAEKDRHALAVQKQRRSAM 214

Query: 325 GRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKE 384
             ARN L  + L P+ SWV W DAD+   P +VIQDL + +  V+  NV++    F N E
Sbjct: 215 ALARNELLFSTLGPHTSWVLWLDADIVETPPTVIQDLAAHDKPVLAANVYQ---RFFNDE 271

Query: 385 ------QPYDLNSWMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQT 438
                 +PYD N+W ES   LELA +L  D++IVEGYAE  T+R  +A+  D +   ++ 
Sbjct: 272 LSKADIRPYDFNNWQESETGLELANSLPADEIIVEGYAEMATFRPLMAHFFDESKPVSEE 331

Query: 439 LDIDGVGGVSILAKAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHI 498
           + +DGVGG   L KA++ R G  FP F F +  ETE F KMAK++GY V GLPNY+++HI
Sbjct: 332 MALDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLGYEVFGLPNYLVYHI 391

Query: 499 YE 500
            E
Sbjct: 392 EE 393

>TPHA0L01370 Chr12 (286001..287179) [1179 bp, 392 aa] {ON} Anc_8.500
           YPL050C
          Length = 392

 Score =  198 bits (503), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 129/434 (29%), Positives = 211/434 (48%), Gaps = 82/434 (18%)

Query: 73  NNYNSYGSYPLSRSSNKNYKNAKELEDVEYYDYDFRSIDEMSFHNFDQGEQHYLITQYGG 132
           NN +  G   + +S+ KN+K A E+E   Y+   F S  +M  +++ + + ++L   +  
Sbjct: 35  NNVSILG---IDQSAIKNHKWAHEIEGTWYFP--FSSKFKMPKYSYKK-KSNWLSNDFVE 88

Query: 133 DVVTSKDKERYIQEMENLLSSSVDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMM 192
           D++                   +  YDL++   T +  + +EH+L  TP++         
Sbjct: 89  DIIPE---------------GHIAHYDLNKLHSTKDAMKLKEHVLIATPMQTFHDAY--- 130

Query: 193 FKHLMNLTYPHELIDIAFLVSDCSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSE 252
           + +L+ ++YP  L+++ F++     GD+TL  L    +++Q G + D             
Sbjct: 131 WSNLLKMSYPRSLLELGFIIPRTPTGDETLKKLEAAVKNVQTGKVED------------- 177

Query: 253 KKNENPNKHYLKFMDQNYIKMADASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRH 312
                                                F  + I ++D       G  +RH
Sbjct: 178 ------------------------------------RFAKITILRQDSQSFDKLGEKERH 201

Query: 313 AVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPN 372
           ++ VQ  RR  M  ARN L  +++ P  SWV W DAD+   P +VIQD+ + N  V+  N
Sbjct: 202 SLAVQKERRSAMALARNELLFSSIGPSTSWVLWLDADIVETPATVIQDMTNHNKPVLAAN 261

Query: 373 VWRPLPEFLNKEQ------PYDLNSWMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLA 426
           V++    F +KE+      PYD N+W ES + LE+AK ++ED++IVEGYAE  T+R  +A
Sbjct: 262 VYQ---RFFDKEKNENSIRPYDFNNWAESEKGLEIAKNMNEDEIIVEGYAEIATYRPLMA 318

Query: 427 YLRDPNGDPNQTLDIDGVGGVSILAKAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYS 486
           +  D  G  +  + +DGVGG   L KA++ R G  FP F F +  ETE F KMAK++ Y 
Sbjct: 319 HFYDKAGKIDALMALDGVGGGCTLVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYE 378

Query: 487 VGGLPNYMLWHIYE 500
           + GLPNY+++HI E
Sbjct: 379 IFGLPNYLVYHIEE 392

>KAFR0H01390 Chr8 complement(258984..260180) [1197 bp, 398 aa] {ON}
           Anc_8.500 YPL050C
          Length = 398

 Score =  197 bits (502), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 138/472 (29%), Positives = 223/472 (47%), Gaps = 95/472 (20%)

Query: 36  RRSPAFYWTCILATCLAIYLLCKATLGDSSFDPLSAINNYNSYGSYPLSRSSNKNYKNAK 95
           R++P       + + LA++L+       +   P+  I N            S  N+K A 
Sbjct: 12  RKNPFLLVILPIISILAVFLI----FIRNGEHPMLGIENL-----------SISNHKWAH 56

Query: 96  ELEDVEYYDYDFRSIDEMSFHNFDQGEQHYLITQYGGDVVTSKDKERYIQEMENLLSSSV 155
           E+E+  Y+   F +  +M  +++ + + ++L   +  D++                   +
Sbjct: 57  EVENTWYFP--FTNKFKMPKYSYKRKQSNWLFNDHVDDIIPE---------------GHI 99

Query: 156 DKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSDC 215
             YDL++   TA  A N+E +L LTP++         +++L+ LTYP ELI++ F++   
Sbjct: 100 AHYDLNKLRSTAYAAVNKERVLILTPMQTFHK---QYWENLLQLTYPRELIELGFIIPRT 156

Query: 216 SEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAK--SEKKNENPNKHYLKFMDQNYIKM 273
             G+  L                   K+++ +I K  S+KKN+                 
Sbjct: 157 KTGENAL-------------------KELEIAIKKVQSDKKNQR---------------- 181

Query: 274 ADASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTA 333
                           F  + I ++D          DRH++ VQ  RR  M  ARN L  
Sbjct: 182 ----------------FAKITILRQDSQSFDQLAEKDRHSILVQKERRAAMALARNELLF 225

Query: 334 NALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKEQ-----PYD 388
           + L P+ +WV W DAD+   P +VIQD+ S +  V+  NV++    F N E+     PYD
Sbjct: 226 STLGPHTAWVLWLDADIIETPPTVIQDMTSHDKSVLAANVYQKY--FDNDEKKMAIRPYD 283

Query: 389 LNSWMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVS 448
            N+W ES   LE+A  +DE+++IVEGY+E  T+R  +A+  + +G     +++DGVGG  
Sbjct: 284 FNNWRESDIGLEIAANMDENEIIVEGYSEIATYRPLMAHFYNADGQVTDEMELDGVGGGC 343

Query: 449 ILAKAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYE 500
            L KA + R G  FP F F +  ETE F KMAK++ Y V GLPNY+++HI E
Sbjct: 344 TLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYGVFGLPNYLVYHIEE 395

>ZYRO0F08492g Chr6 (684329..685519) [1191 bp, 396 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050C MNN9 Subunit of Golgi mannosyltransferase
           complex also containing Anp1p Mnn10p Mnn11p and Hoc1p
           that mediates elongation of the polysaccharide mannan
           backbone forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 396

 Score =  197 bits (502), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 117/349 (33%), Positives = 176/349 (50%), Gaps = 55/349 (15%)

Query: 155 VDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSD 214
           +  YDL++   TA  A N+EH+L LTP++         + +L+ LTYP E  ++ F++  
Sbjct: 97  IAHYDLNKLHSTAEAALNKEHVLILTPMQTFHQ---EYWDNLLQLTYPREFTELGFILPR 153

Query: 215 CSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKMA 274
            S GD  L  L    + +Q                 ++KKN+                  
Sbjct: 154 TSSGDIALSKLEAAVKKVQ-----------------TDKKNQR----------------- 179

Query: 275 DASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 334
                          F  + I +++          +RHA++VQ  RR  M  ARN L  +
Sbjct: 180 ---------------FSKITILRQNSAGFDKLMEKERHALEVQKERRSAMASARNELLFS 224

Query: 335 ALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKE---QPYDLNS 391
           +L P  SWV W DAD+   P ++IQD+ S N  V+  NV++   +   K+   +PYD N+
Sbjct: 225 SLGPKTSWVLWLDADIVETPPNLIQDMTSHNKAVLSANVYQKYYDDQAKKVQIRPYDFNN 284

Query: 392 WMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILA 451
           W ES  ALELAK + +D+++VEGY +  T+R  +AY  D  G  N  +++DGVGG   L 
Sbjct: 285 WQESDTALELAKQMGDDEILVEGYGDLATYRALMAYFYDATGATNAEMNLDGVGGGCTLV 344

Query: 452 KAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYE 500
           KA + R G  FP F F +  ETE F KMA+++ Y + GLPNY+++HI E
Sbjct: 345 KADVHRDGAMFPTFPFYHLIETEGFAKMAQRLNYDIFGLPNYLVYHIEE 393

>TBLA0H03340 Chr8 (820028..821209) [1182 bp, 393 aa] {ON} Anc_8.500
           YPL050C
          Length = 393

 Score =  197 bits (501), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 131/424 (30%), Positives = 212/424 (50%), Gaps = 79/424 (18%)

Query: 83  LSRSSNKNYKNAKELEDVEYYDYDFRSIDEMSFHNFDQGEQHYLITQYGGDVVTSKDKER 142
           L+  S  NYK A ELE+  Y+   F S  +M  +++ + + ++L  ++  D++       
Sbjct: 40  LTGGSIVNYKWAHELENTFYFP--FTSKYKMPKYSYKK-KTNWLFNRHVEDIIPE----- 91

Query: 143 YIQEMENLLSSSVDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYP 202
                     + +  YDL++   T++ A N+E +L LTP++         +++L+ LTYP
Sbjct: 92  ----------NHIAHYDLNKLHSTSDAAVNKEQVLILTPMQTFHDEF---WQNLLQLTYP 138

Query: 203 HELIDIAFLVSDCSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHY 262
            ELI++ F++     GD  L  L    + +Q                 ++KKN+      
Sbjct: 139 RELIELGFILPRSDSGDAALKALEAAVKKVQ-----------------TDKKNQR----- 176

Query: 263 LKFMDQNYIKMADASFAGPHHNEYNKPFRSVQIFQKD---FGQIIGQGFSDRHAVKVQGI 319
                                      F  + I ++D   FGQ++ +   +RHA+ VQ  
Sbjct: 177 ---------------------------FSKITILRQDSQGFGQLMEK---ERHALHVQKE 206

Query: 320 RRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPE 379
           RR  M  ARN L  + + P+ SWV W DAD+   P +VIQD+ + +  V+  NV++   +
Sbjct: 207 RRAAMALARNELLFSTIGPHTSWVLWLDADIVETPPTVIQDMTAHDKAVLAANVYQRYFD 266

Query: 380 FLNKEQ---PYDLNSWMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPN 436
              KE+    YD N+W ES   L++A  +++D++IVEGY+E  T+R  +A+  DP    N
Sbjct: 267 EEKKEKSIRAYDFNNWQESDTGLQIAAGMNDDEIIVEGYSEIATYRPLMAHFYDPTASVN 326

Query: 437 QTLDIDGVGGVSILAKAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLW 496
             + +DGVGG   L KA + R G  FP F F +  ETE F KMAK++ Y V GLPNY+++
Sbjct: 327 SEMMLDGVGGGCTLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVY 386

Query: 497 HIYE 500
           H+ E
Sbjct: 387 HMEE 390

>TDEL0B01370 Chr2 complement(242546..243736) [1191 bp, 396 aa] {ON}
           Anc_8.500 YPL050C
          Length = 396

 Score =  196 bits (498), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 121/352 (34%), Positives = 175/352 (49%), Gaps = 55/352 (15%)

Query: 155 VDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSD 214
           +  YDL++   TA  A N+E +L LTP++         + +L+ LTYP ELI++ F+V  
Sbjct: 97  IAHYDLNKLHSTAKAALNKEQVLILTPMQTFHE---QYWDNLLQLTYPRELIELGFIVPR 153

Query: 215 CSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKMA 274
              GD  L  L    + +Q                 ++KKN+                  
Sbjct: 154 TQSGDVALAKLEEAVKKVQ-----------------TDKKNQR----------------- 179

Query: 275 DASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 334
                          F  V I ++D          +RHA+ VQ  RR  M  ARN L  +
Sbjct: 180 ---------------FVKVTILRQDSKSFDKLQEKERHALAVQKERRAAMALARNELLFS 224

Query: 335 ALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKE---QPYDLNS 391
            + P+ SWV W DAD+   P ++IQD+ + N  V+  NV++   +   KE   + YD N+
Sbjct: 225 TIGPHTSWVLWLDADIVEAPPNLIQDMTAHNKPVLAANVYQRYYDEEKKESSIRAYDFNN 284

Query: 392 WMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILA 451
           W ES   LELA  + ED++IVEGY+E  T+R  +AY  D NG P   + +DGVGG   L 
Sbjct: 285 WAESETGLELASQMAEDEIIVEGYSELATYRPLMAYYYDANGSPGAEMALDGVGGGCTLV 344

Query: 452 KAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYEPSD 503
           +A + R G  FP F F +  ETE F KMAK++ + V GLPNY+++HI E +D
Sbjct: 345 QADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNHEVFGLPNYLVYHIEEWND 396

>NCAS0C02330 Chr3 complement(437234..438415) [1182 bp, 393 aa] {ON}
           Anc_8.500
          Length = 393

 Score =  196 bits (497), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 120/351 (34%), Positives = 180/351 (51%), Gaps = 59/351 (16%)

Query: 155 VDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSD 214
           +  YDL++   T++ A N+E +L LTP++         +++L+ LTYP ELI++ F+   
Sbjct: 94  IAHYDLNKLHSTSDAAINKEKILILTPIQKFHQ---EYWENLLQLTYPRELIELGFIAPR 150

Query: 215 CSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAK--SEKKNENPNKHYLKFMDQNYIK 272
              GD+ L  L                   +A++ K  S+KKN+                
Sbjct: 151 TPTGDQALAAL-------------------EAAVDKVQSDKKNQR--------------- 176

Query: 273 MADASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLT 332
                            F  V I ++D          +RHA++VQ  RR  M  ARN L 
Sbjct: 177 -----------------FSKVTILRQDSVGFNKLTEKERHALEVQKERRASMALARNELL 219

Query: 333 ANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKEQ---PYDL 389
            + + P+ SWV W DAD+   P S+IQD+ + +  V+  NV++   +   K++   PYD 
Sbjct: 220 FSTIGPHTSWVLWLDADIIETPASLIQDMTAHDRAVLSANVFQRYYDEEKKQKAIRPYDF 279

Query: 390 NSWMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSI 449
           N+W ES   LELA  + +D++IVEGYAE  T+R  +AY  DP+    + + +DGVGG   
Sbjct: 280 NNWQESDTGLELASKMKDDEIIVEGYAEIATYRPLMAYFHDPDNSVAEEMRLDGVGGGCT 339

Query: 450 LAKAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYE 500
           L KA++ R G  FP F F +  ETE F KMAK++ Y V GLPNY+++HI E
Sbjct: 340 LVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHIEE 390

>KLTH0E11616g Chr5 (1035396..1036580) [1185 bp, 394 aa] {ON} highly
           similar to uniprot|P39107 Saccharomyces cerevisiae
           YPL050C MNN9 Subunit of Golgi mannosyltransferase
           complex also containing Anp1p Mnn10p Mnn11p and Hoc1p
           that mediates elongation of the polysaccharide mannan
           backbone forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 394

 Score =  195 bits (496), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 113/359 (31%), Positives = 183/359 (50%), Gaps = 61/359 (16%)

Query: 148 ENLLSSSVDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELID 207
           +N+ +  +  YDL++   T     N+E +L LTP++         + +L+ LTYP +LI+
Sbjct: 89  DNIPAGHISHYDLNKLTSTDKAFANKEQVLILTPMQTFHD---QYWDNLLQLTYPRDLIE 145

Query: 208 IAFLVSDCSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYLKFMD 267
           + F++   + GD  L  L    +  Q G                 KK++           
Sbjct: 146 LGFIIPRTATGDTALRKLEAAVKRTQLG-----------------KKDQR---------- 178

Query: 268 QNYIKMADASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRA 327
                                 F  + I ++D          +RHA+KVQ  RR  M  A
Sbjct: 179 ----------------------FSKITILRQDSQSFDSLQEKERHALKVQKERRAAMALA 216

Query: 328 RNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKE--- 384
           RN L  + + P+ SW+ W DAD+   P S+IQD+ + N  V+  NV++   +++N+E   
Sbjct: 217 RNELLFSTIGPHTSWILWLDADIIETPPSLIQDMTAHNKPVLAANVYQ---KYMNEETKK 273

Query: 385 ---QPYDLNSWMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDI 441
              +PYD N+W +S +AL++A  + +D+V+ EGYAE PT+R  +A++ D +G     + +
Sbjct: 274 IAERPYDFNNWADSEKALQMAAGMADDEVLFEGYAELPTYRTLMAHMYDASGSQAAEMSL 333

Query: 442 DGVGGVSILAKAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYE 500
           DGVGG   L KA++ R G  FP+F F +  ETE F KMA+++ Y + GLPNY+++HI E
Sbjct: 334 DGVGGGCTLVKAEVHRDGAMFPSFPFYHLIETEGFAKMARRLEYEIFGLPNYLVYHIEE 392

>Smik_16.186 Chr16 complement(336170..337357) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  195 bits (495), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 117/349 (33%), Positives = 181/349 (51%), Gaps = 55/349 (15%)

Query: 155 VDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSD 214
           +  YDL++   T + A N+EH+L LTP++         + +L+ LTYP ELI++ F+   
Sbjct: 96  IAHYDLNKLHSTPDAAANKEHVLILTPMQTFHQ---QYWDNLLQLTYPRELIELGFITPR 152

Query: 215 CSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKMA 274
            + GD  L  L    + +Q                 ++KK +  +K  +  M QN     
Sbjct: 153 TATGDLALKKLENAVKKVQ-----------------ADKKAQRFSK--ITIMRQN----- 188

Query: 275 DASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 334
                                  + F +++ +   +RHA+ VQ  RR  M  ARN L  +
Sbjct: 189 ----------------------SQSFDKLMEK---ERHALDVQKERRAAMALARNELLFS 223

Query: 335 ALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKE---QPYDLNS 391
            + P+ SWV W DAD+   P ++IQD+   N  V+  N+++   +   K+   +PYD N+
Sbjct: 224 TIGPHTSWVLWLDADIIETPTTLIQDMTQHNKAVLAANIYQRFYDQEKKQSSIRPYDFNN 283

Query: 392 WMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILA 451
           W ES   LE+A  +D+D++IVEGYAE  T+R  +A+    N  P++ + +DGVGG   L 
Sbjct: 284 WQESDTGLEIASQMDDDEIIVEGYAEIATYRPLMAHFYSANELPSKEMVLDGVGGGCTLV 343

Query: 452 KAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYE 500
           KA++ R G  FP F F +  ETE F KMAK++ Y V GLPNY+++HI E
Sbjct: 344 KAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNYLVYHIEE 392

>YPL050C Chr16 complement(460779..461966) [1188 bp, 395 aa] {ON}
           MNN9Subunit of Golgi mannosyltransferase complex also
           containing Anp1p, Mnn10p, Mnn11p, and Hoc1p that
           mediates elongation of the polysaccharide mannan
           backbone; forms a separate complex with Van1p that is
           also involved in backbone elongation
          Length = 395

 Score =  194 bits (494), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 116/349 (33%), Positives = 180/349 (51%), Gaps = 55/349 (15%)

Query: 155 VDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSD 214
           +  YDL++   T+  A N+EH+L LTP++         + +L+ L YP ELI++ F+   
Sbjct: 96  IAHYDLNKLHSTSEAAVNKEHILILTPMQTFHQ---QYWDNLLQLNYPRELIELGFITPR 152

Query: 215 CSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKMA 274
            + GD  L  L    + +Q                 ++KK +  +K  +  + QN     
Sbjct: 153 TATGDLALKKLENAIKKVQ-----------------TDKKTQRFSK--ITILRQN----- 188

Query: 275 DASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 334
                                  + F +++ +   +RHA+ VQ  RR  M  ARN L  +
Sbjct: 189 ----------------------SQSFDKLMEK---ERHALDVQKERRAAMALARNELLFS 223

Query: 335 ALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKE---QPYDLNS 391
            + P+ SWV W DAD+   P S+IQD+   N  ++  N+++   +   K+   +PYD N+
Sbjct: 224 TIGPHTSWVLWLDADIIETPPSLIQDMTKHNKAILAANIYQRFYDEEKKQPSIRPYDFNN 283

Query: 392 WMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILA 451
           W ES   LE+A  + +D++IVEGYAE  T+R  +A+  D NG P + + +DGVGG   L 
Sbjct: 284 WQESDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHFYDANGVPGEEMALDGVGGGCTLV 343

Query: 452 KAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYE 500
           KA++ R G  FP F F +  ETE F KMAK++ Y V GLPNY+++HI E
Sbjct: 344 KAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEE 392

>NDAI0E03020 Chr5 complement(643198..644388) [1191 bp, 396 aa] {ON}
           Anc_8.500
          Length = 396

 Score =  192 bits (488), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 112/349 (32%), Positives = 178/349 (51%), Gaps = 55/349 (15%)

Query: 155 VDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSD 214
           + ++DL++   T + + N+E +L LTPL+         +++++ L+YP ELI++ F+V  
Sbjct: 97  IAEFDLNKLHSTKDASINKEKVLILTPLQKFHQ---EYWENILQLSYPRELIELGFIVPR 153

Query: 215 CSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKMA 274
              GD  L                        S+ K+ +K +   K              
Sbjct: 154 TQTGDLALQ-----------------------SLEKAVEKTQTDKK-------------- 176

Query: 275 DASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 334
                       N+ F  V I ++D          +RHA+ VQ  RR  M  ARN L  +
Sbjct: 177 ------------NQRFAKVTILRQDSESFNKLAEKERHALNVQKERRSSMALARNELLFS 224

Query: 335 ALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPL---PEFLNKEQPYDLNS 391
            + P+ SWV W DAD+   P ++IQD+ + +  V+  NV++      +  +  +PYD N+
Sbjct: 225 TIGPHTSWVLWLDADIVETPSTLIQDMTAHDKSVLAANVFQRYYDDEKKASATRPYDFNN 284

Query: 392 WMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILA 451
           W ES   LELA  +++D++IVEGY+E  T+R  +AY  D     ++ + +DGVGG   L 
Sbjct: 285 WQESEIGLELASKMNDDEIIVEGYSEIATYRPLMAYFHDTTKPVSEEMILDGVGGGCTLV 344

Query: 452 KAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYE 500
           KA++ R G  FP+F F +  ETE F KMAK++GY + GLPNY+++HI E
Sbjct: 345 KAEVHRDGAMFPSFPFYHLIETEGFAKMAKRLGYEIFGLPNYLVYHIEE 393

>Skud_16.232 Chr16 complement(424904..426091) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  191 bits (485), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 112/349 (32%), Positives = 181/349 (51%), Gaps = 55/349 (15%)

Query: 155 VDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSD 214
           +  YDL++   T++ A N+EH+L LTP++         + +L+ L+YP ELI++ F+   
Sbjct: 96  IAHYDLNKLHSTSDAAVNKEHVLILTPMQTFHQ---QYWDNLLQLSYPRELIELGFITPR 152

Query: 215 CSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKMA 274
            + GD  L                   K+++ +I K +   +      +  + QN     
Sbjct: 153 TATGDLAL-------------------KNLENAIKKVQTDKKTQRFSKITILRQN----- 188

Query: 275 DASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 334
                                  + F +++ +   +RHA+ VQ  RR  M  ARN L  +
Sbjct: 189 ----------------------SQSFDKLMEK---ERHALDVQKERRAAMALARNELLFS 223

Query: 335 ALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKE---QPYDLNS 391
            + P+ SW+ W DAD+   P S+IQD+   +  V+  N+++   +   K+   +PYD N+
Sbjct: 224 TIGPHTSWILWLDADIIETPVSLIQDMTQHDKAVLAANIYQRFYDQEKKQPSIRPYDFNN 283

Query: 392 WMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILA 451
           W ES   LE+A  + +D++IVEGYAE  T+R  +A+  + +G PN+ + +DGVGG   L 
Sbjct: 284 WQESDTGLEIASQMGDDEIIVEGYAEIATYRPLMAHHYNADGLPNEEMALDGVGGGCTLV 343

Query: 452 KAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYE 500
           KA + R G  FP F F +  ETE F KMAK++ Y+V GLPNY+++HI E
Sbjct: 344 KADVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYNVFGLPNYLVYHIEE 392

>SAKL0H11110g Chr8 complement(957784..958965) [1182 bp, 393 aa] {ON}
           highly similar to uniprot|P39107 Saccharomyces
           cerevisiae YPL050C MNN9 Subunit of Golgi
           mannosyltransferase complex also containing Anp1p Mnn10p
           Mnn11p and Hoc1p that mediates elongation of the
           polysaccharide mannan backbone forms a separate complex
           with Van1p that is also involved in backbone elongation
          Length = 393

 Score =  191 bits (484), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 115/352 (32%), Positives = 176/352 (50%), Gaps = 61/352 (17%)

Query: 155 VDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSD 214
           +  YDL++   T N A N+E +L LTP+++        + +L+ LTYP ELI++ F+V  
Sbjct: 95  IAHYDLNKLTSTQNAALNKEQVLILTPMQNFHQ---KYWDNLLQLTYPRELIELGFIVPR 151

Query: 215 CSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKMA 274
              G+  L+ L    + +Q G   D F  +                  L+   Q++ K+ 
Sbjct: 152 TGSGNVALEQLEAAVKKVQTGKKEDRFGKITI----------------LRQASQSFDKLL 195

Query: 275 DASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 334
           +                                  +RHA++VQ  RR  M  ARN L  +
Sbjct: 196 E---------------------------------KERHALEVQKERRAAMALARNELLFS 222

Query: 335 ALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKEQ------PYD 388
            + PY SW+ W DAD+   P SVI+D+ + N  V+  NV++    + ++EQ      PYD
Sbjct: 223 TIGPYTSWILWLDADIVETPPSVIEDMTAHNKPVLAANVYQ---RYYDQEQKKESIRPYD 279

Query: 389 LNSWMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVS 448
            N+W ES   L+LA  +  D+++VEGY E  T+R  +A+  + +      +++DGVGG  
Sbjct: 280 YNNWAESDIGLQLASQMSADEILVEGYPEIATYRPLMAHFYEDSAPATVEMELDGVGGGC 339

Query: 449 ILAKAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYE 500
            L KA + R G  FP F F +  ETE F KMAK++GY V GLPNY+++HI E
Sbjct: 340 TLVKADVHRDGAMFPNFPFYHLIETEGFAKMAKRLGYEVFGLPNYLVYHIDE 391

>Suva_16.265 Chr16 complement(463836..465023) [1188 bp, 395 aa] {ON}
           YPL050C (REAL)
          Length = 395

 Score =  191 bits (484), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 112/349 (32%), Positives = 178/349 (51%), Gaps = 55/349 (15%)

Query: 155 VDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSD 214
           +  YDL++   T + A N+EH+L LTP++         + +L+ L YP ELI++ F+   
Sbjct: 96  IAHYDLNKLHSTPDAAVNKEHILILTPMQTFHQ---QYWDNLLQLNYPRELIELGFITPR 152

Query: 215 CSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKMA 274
            + GD  L                   K ++++I K +   +      +  + QN     
Sbjct: 153 TATGDSAL-------------------KKLESAIKKVQTDKKTQRFSKITILRQN----- 188

Query: 275 DASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 334
                                  + F +++ +   +RHA++VQ  RR  M  ARN L  +
Sbjct: 189 ----------------------SQSFDKLMEK---ERHALEVQKERRAAMALARNELLFS 223

Query: 335 ALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKE---QPYDLNS 391
            + P+ SWV W DAD+   P S+IQD+   N  V+  N+++   +   K+   +PYD N+
Sbjct: 224 TIGPHTSWVLWLDADIIETPTSLIQDMTQHNKAVLAANIYQRFYDQEKKQASIRPYDFNN 283

Query: 392 WMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILA 451
           W ES   L++A  + +D++IVEGYAE  T+R  +A+  D +   N+ + +DGVGG   L 
Sbjct: 284 WQESDIGLDIASQMGDDEIIVEGYAEIATYRPLMAHFFDASKPQNEEMALDGVGGGCTLV 343

Query: 452 KAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYE 500
           KA++ R G  FP F F +  ETE F KMAK++ Y V GLPNY+++HI E
Sbjct: 344 KAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYDVFGLPNYLVYHIEE 392

>Kpol_1031.78 s1031 (197094..198272) [1179 bp, 392 aa] {ON}
           (197094..198272) [1179 nt, 393 aa]
          Length = 392

 Score =  189 bits (480), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 115/351 (32%), Positives = 178/351 (50%), Gaps = 59/351 (16%)

Query: 155 VDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSD 214
           +  YDL++   T++   ++EH+L LTP++         +++L+ L+YP ELI++ F++  
Sbjct: 96  IAHYDLNKLHSTSDSISDKEHVLVLTPMQTFHE---KYWENLLKLSYPRELIELGFIIPR 152

Query: 215 CSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKMA 274
              GD  L  L T  +++Q                 S+KKN        +F     ++  
Sbjct: 153 SDAGDAALKKLETAVKNVQ-----------------SDKKNN-------RFSKITILRQE 188

Query: 275 DASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 334
             SF      E                         RH++ VQ  RR  M  ARN L  +
Sbjct: 189 SQSFDKLEEKE-------------------------RHSLAVQKERRAAMALARNELLFS 223

Query: 335 ALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKEQ-----PYDL 389
            L P+ SWV W D+D+   P +VI+ +   +  V+  NV++    F N +Q     PYD 
Sbjct: 224 TLGPHTSWVLWLDSDIVETPTTVIESMTKHDKPVLAANVYQRF--FDNDKQQDSIRPYDF 281

Query: 390 NSWMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSI 449
           N+W ES   L+LA  + +D++IVEGYAE  T+R  +A+  +P+GD  + + +DGVGG   
Sbjct: 282 NNWAESDIGLQLASKMGDDEIIVEGYAEIATYRPLMAHFYNPSGDVGEEMALDGVGGGCT 341

Query: 450 LAKAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYE 500
           L KA++ R G  FP F F +  ETE F KMAK++ Y V GLPN++++HI E
Sbjct: 342 LVKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEVFGLPNFLVYHIEE 392

>Kwal_27.11864 s27 (981923..983284) [1362 bp, 453 aa] {ON} YPL050C
           (MNN9) - Protein required for complex glycosylation
           [contig 27] FULL
          Length = 453

 Score =  189 bits (480), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 111/356 (31%), Positives = 182/356 (51%), Gaps = 55/356 (15%)

Query: 148 ENLLSSSVDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELID 207
           +N+    +  YDL++   TAN A N+E +L LTP++         + +L+ LTYP EL++
Sbjct: 148 DNIPPEQITHYDLNKLTSTANAALNKEQVLILTPMQTFHE---EYWNNLLQLTYPRELLE 204

Query: 208 IAFLVSDCSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYLKFMD 267
           + F++   + GD  L                   + ++A++ K++          L   D
Sbjct: 205 LGFIIPRTTSGDNAL-------------------RKLEAAVKKTQ----------LSKKD 235

Query: 268 QNYIKMADASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRA 327
           Q ++K                    + I ++D          DRHA++VQ  RR  M  A
Sbjct: 236 QRFLK--------------------ITILRQDSQSFDLLKEKDRHALEVQKKRRSAMALA 275

Query: 328 RNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKEQ-- 385
           RN L  + + PY SWV W DAD+   P ++IQD+ + +  V+  NV++   +    ++  
Sbjct: 276 RNELLFSTIGPYTSWVLWLDADIIETPPTLIQDMTAHDKAVLAANVYQHSIDKKTGQKTK 335

Query: 386 -PYDLNSWMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGV 444
            PYD N+W +S  AL++A ++ +D V+ EGY E  T+R  +A+       P+  + +DGV
Sbjct: 336 GPYDFNNWADSDTALQMAASMPDDGVLFEGYGEMATYRTLMAHFYKEGESPSAEMVLDGV 395

Query: 445 GGVSILAKAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYE 500
           GG   L KA++ R G  FP+F F +  ETE F KMA+++ Y + GLPNY+++HI E
Sbjct: 396 GGGCTLVKAEVHRDGAMFPSFPFYHLIETEGFAKMAQRLDYEIYGLPNYLVYHIEE 451

>Ecym_2550 Chr2 (1066925..1068097) [1173 bp, 390 aa] {ON} similar to
           Ashbya gossypii AGL259C
          Length = 390

 Score =  186 bits (471), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 109/348 (31%), Positives = 171/348 (49%), Gaps = 54/348 (15%)

Query: 155 VDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSD 214
           + KYD++    T++   N+E +L LTP++         +++L++LTYP +L  + F++  
Sbjct: 95  IMKYDMNTLTTTSSPLANKEIVLILTPMQKFHD---KYWENLLSLTYPRKLTQLGFIIPR 151

Query: 215 CSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKMA 274
              GD  +  L    + +Q G                                       
Sbjct: 152 TPTGDVAMKRLEDAVKKVQSG--------------------------------------- 172

Query: 275 DASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 334
                     + N+ F  + I ++D          +RHA  VQ  RR  M  ARN L  +
Sbjct: 173 ----------KENQRFLKITILRQDSQSFNKLDEKERHAFNVQKERRAAMALARNELVFS 222

Query: 335 ALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKE--QPYDLNSW 392
            + P  SW+ W DAD+   P +VIQD+ + +  ++  NV++   +  N+E  +PYD N+W
Sbjct: 223 TIGPSTSWILWLDADIVETPATVIQDMAAHDKAILAANVFQRYIDDQNQENIRPYDFNNW 282

Query: 393 MESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILAK 452
            ES   LE+A ++ +D++IVE Y E  T+R  +A L DPNG P+  + +DGVGG   L K
Sbjct: 283 QESQTGLEIAASMKDDEIIVESYHEIVTYRPLMAKLYDPNGSPSAEMSLDGVGGGCTLVK 342

Query: 453 AKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWHIYE 500
           A++ R G  FP F F +  ETE F  MAK++ Y V GLPNY+++H  E
Sbjct: 343 AQVHRDGAMFPNFPFYHLIETEGFAHMAKRLNYEVFGLPNYLVYHFNE 390

>AGL259C Chr7 complement(221445..222614) [1170 bp, 389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL050C
           (MNN9)
          Length = 389

 Score =  175 bits (444), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 112/347 (32%), Positives = 166/347 (47%), Gaps = 58/347 (16%)

Query: 155 VDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSD 214
           + +YDL+  + TA  A N E +L LTP++         + +L+ LTYP + I + FL+  
Sbjct: 94  LREYDLNTLQSTAMAAANGEQVLILTPMQIFHQ---QYWDNLLLLTYPRKYIHLGFLLPR 150

Query: 215 CSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKMA 274
            S G+  L  L    R +Q                                         
Sbjct: 151 TSSGNTALRKLEKAVRKVQ----------------------------------------- 169

Query: 275 DASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 334
                GP    + K    + I ++DF        S RH   VQ  RR  M  ARN L  +
Sbjct: 170 ----TGPKDQRFGK----ITILRQDFASFNKLSQSARHRFHVQKERRSAMALARNELLFS 221

Query: 335 ALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKE---QPYDLNS 391
            + PY SWV W D+D+   P ++I+D+ S N  ++  NV++   E  N E   + YDLN+
Sbjct: 222 TIGPYTSWVLWLDSDIVETPNTLIEDMTSHNKPILAANVYQRYVE--NGEPAIRAYDLNN 279

Query: 392 WMESGEALELAKTLDEDDVIVEGYA-EYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSIL 450
           W ES   L++A  L ED +IVEGY  E+ T+R  +A++       ++ + +DGVGG   L
Sbjct: 280 WAESELGLKIASELPEDQIIVEGYGDEFATYRPLMAHMYSDKRPKDELMALDGVGGGCTL 339

Query: 451 AKAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWH 497
            KA++ R G  FP F F +  ETE F KMAK++ Y + GLPNY+++H
Sbjct: 340 VKAEVHRDGAMFPNFPFYHLIETEGFAKMAKRLNYEIYGLPNYLVYH 386

>NCAS0B02440 Chr2 complement(408198..409400) [1203 bp, 400 aa] {ON}
           Anc_8.500
          Length = 400

 Score =  174 bits (440), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 106/346 (30%), Positives = 169/346 (48%), Gaps = 54/346 (15%)

Query: 155 VDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSD 214
           +  YDL++ + +AN AEN+EH+L LTPL+  E      + +L+ L+YP + I++ F++  
Sbjct: 103 IAHYDLNKLQSSANAAENKEHVLILTPLKSFEQ---GYWDNLLKLSYPRDAIELGFIIPR 159

Query: 215 CSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKMA 274
             +GD +L  L +  + +Q     D F  +      S+     P K  +  +        
Sbjct: 160 TKKGDHSLKKLESAIKKVQTAKQGDKFSKITILRQNSKGFETVPEKKEVSEI-------- 211

Query: 275 DASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 334
                     EY K  R+                               M  ARN L A+
Sbjct: 212 ----------EYEKQIRAE------------------------------MALARNELLAS 231

Query: 335 ALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKE---QPYDLNS 391
            L P  +W+ W D+D+   P S+IQD+   +  V+  NV+    +  + E   +PYD  +
Sbjct: 232 TLGPQTAWILWLDSDIVETPPSLIQDMTHHDKPVLAANVYERYKDRESGELSIRPYDFRN 291

Query: 392 WMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILA 451
           W+ES EAL+LA  + ED++IVEG A   T R  + +    +G P+  + +DGVG   +L 
Sbjct: 292 WIESTEALQLASGMQEDEIIVEGLAGISTNRQLMTHFYQQDGSPSSEISLDGVGASCLLV 351

Query: 452 KAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLWH 497
           K+++ R G  FP F F +  E+E F KMAK++ Y V GLPNY+++H
Sbjct: 352 KSEVHRDGAMFPNFPFYHLIESEGFAKMAKRLTYEVYGLPNYLVYH 397

>NDAI0C05250 Chr3 (1217841..1219049) [1209 bp, 402 aa] {ON}
           Anc_8.500
          Length = 402

 Score =  164 bits (415), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 102/344 (29%), Positives = 179/344 (52%), Gaps = 47/344 (13%)

Query: 155 VDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFLVSD 214
           +  YDL++   +AN  EN+EH+L LTPL+  +      +++L+NL+YP +LI++ F+V +
Sbjct: 102 IAHYDLNKLVSSANALENKEHVLILTPLQSFDE---KYWENLLNLSYPRDLIELGFMVPN 158

Query: 215 CSEGDKTLDTLITFARHLQDGTLVDIFKDMDASIAKSEKKNENPNKHYLKFMDQNYIKMA 274
             +GD+ L  L    +++Q          +D  +  +            KF     ++  
Sbjct: 159 TKKGDQILKQLENAVKNVQG---------IDKKLGSN------------KFAKITILRQK 197

Query: 275 DASFAGPHHNEYNKPFRSVQIFQKDFGQIIGQGFSDRHAVKVQGIRRKLMGRARNWLTAN 334
           D+ F     +++N         +KD  ++        + ++++  +R  M  ARN L ++
Sbjct: 198 DSGF-----HKFND--------RKDKKEM--------NDIELEKEKRAEMALARNELLSS 236

Query: 335 ALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEFLNKE--QPYDLNSW 392
            L    +W+ W D++V   P ++IQD+   +  V+  NV+       +K   +PYD  +W
Sbjct: 237 TLSHSTAWILWLDSNVIETPNTLIQDMTQHDKPVLATNVYMKDSNDKDKANIRPYDFRNW 296

Query: 393 MESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQTLDIDGVGGVSILAK 452
           +ES  AL+LA  + ED++IVEG A   T R  +    + +G P + L +DG+G    L K
Sbjct: 297 IESDTALQLASEMPEDEIIVEGMAGLATNRQLMTNFYESDGSPTEELALDGIGAACTLVK 356

Query: 453 AKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYMLW 496
           +++ R G  FP F F +  E+E F KMAK++ Y V GLPNY+++
Sbjct: 357 SEVHRDGAMFPNFPFYHLIESEGFAKMAKRLTYEVVGLPNYLVF 400

>KNAG0A03990 Chr1 complement(535490..536563) [1074 bp, 357 aa] {ON} 
          Length = 357

 Score = 92.8 bits (229), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 53/178 (29%), Positives = 86/178 (48%), Gaps = 9/178 (5%)

Query: 321 RKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVIVPNVWRPLPEF 380
           RK +   +N L  + L PY SWV W D+ +   P +++QDL +    ++  ++      F
Sbjct: 183 RKQLAALKNQLLFSTLPPYCSWVLWLDSQITGTPTTLVQDLANHGKAILTTHI------F 236

Query: 381 LNKEQPYD---LNSWMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLRDPNGDPNQ 437
            N +   D   LN+W+ S     LA  +    V++EG +   T R  +    D       
Sbjct: 237 NNSDGSPDSETLNNWVASDTWRSLATGMPHSRVVIEGVSHVYTDRPLMGQFYDAAASVLT 296

Query: 438 TLDIDGVGGVSILAKAKLFRHGVHFPAFTFENHAETEAFGKMAKKMGYSVGGLPNYML 495
            +++D V     L KA++ R G  FP F F +  ETE F +MA+ + +   GLPNY++
Sbjct: 297 EMELDSVSTACTLVKAEVHRDGAMFPNFAFHHLVETEGFARMARLLKHQAFGLPNYVV 354

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 36/74 (48%), Gaps = 3/74 (4%)

Query: 152 SSSVDKYDLSQFEGTANGAENREHLLYLTPLRDAEHVLPMMFKHLMNLTYPHELIDIAFL 211
           +  +  Y+L++   + +   + EH+L L PL +        F++L  LTYP +LID+  +
Sbjct: 76  TGGISYYNLNELAASPDAEGHSEHILVLIPLINFNS---RFFENLFALTYPKQLIDLGVI 132

Query: 212 VSDCSEGDKTLDTL 225
           V D       L  L
Sbjct: 133 VPDSKNATGILQAL 146

>SAKL0H20438g Chr8 (1793911..1793929,1794594..1796272) [1698 bp, 565
           aa] {ON} weakly similar to gnl|GLV|DEHA0C12881g
           Debaryomyces hansenii DEHA0C12881g
          Length = 565

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 89/208 (42%), Gaps = 31/208 (14%)

Query: 310 DRHAVKVQGIRRKLMGRARNWLTANALKPYHSWVYWRDADVELCPGSVIQDLMSKNYDVI 369
           DRH   VQ  RRK + + RN+L  N       +    D+D+ + P  +++  +    ++I
Sbjct: 368 DRHKDSVQRARRKTIAKVRNFL-YNRSHMDEKYTLTIDSDMMVIPSDMLEKFVKMGKELI 426

Query: 370 VPNVWRPLPEFLNKEQPYDLNSWMESGEALELAKTLDEDDVIVEGYAEYPTWRVHLAYLR 429
           VP + R     +  ++ YD N+W+  GE  +   T  +++   E Y   P       +L+
Sbjct: 427 VPRILR-----VGSDREYDKNTWI--GERTKPEDTSKQNNY--ESYVPRPV-NGKTKFLQ 476

Query: 430 D----------PNGDPNQTLDIDGVGGVSILAKAKLFRHGVHFPAFTF----------EN 469
           D          P    +  +++D VGG  +    K+F  G+ FP F             +
Sbjct: 477 DCVDEKITLNSPEAYTDNVVELDSVGGAILFWDNKIFDQGIQFPVFYLIGSDWDHSEGYD 536

Query: 470 HAETEAFGKMAKKMGYSVGGLPNYMLWH 497
             ETE     AK +GY   G+PN +  H
Sbjct: 537 GVETEGLCYQAKTLGYKCYGVPNVICRH 564

>YCR019W Chr3 (152837..153928) [1092 bp, 363 aa] {ON}  MAK32Protein
           necessary for structural stability of L-A
           double-stranded RNA-containing particles
          Length = 363

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 61/136 (44%), Gaps = 16/136 (11%)

Query: 352 LCPGS----VIQDLM----SKNYDVIVPNVWRPLPEFLNKEQPYDLNSWMESGEA-LELA 402
           LC GS    +I DL+    SK    IV  +W P P+  + +   D+ S M+  +  + L+
Sbjct: 145 LCSGSRCLDIINDLLRVKSSKGTKPIV--IWEPFPDLCDFDHQNDIKSVMQRNDVTVILS 202

Query: 403 KTLDEDDVIVEGYAEYPTWR---VHLAYLRDPNGDPNQ--TLDIDGVGGVSILAKAKLFR 457
              +E   +    ++ PT     + LA+  D   D N    L    +G +S+  K K  R
Sbjct: 203 PNAEESSRLFGLSSKEPTSLEECLALAHRFDDFMDENNMCILRCGALGSISVSEKFKNGR 262

Query: 458 HGVHFPAFTFENHAET 473
              HFPA+ F+  ++ 
Sbjct: 263 TYDHFPAYHFKTQSKV 278

>KLLA0E05413g Chr5 (485919..488183) [2265 bp, 754 aa] {ON}
           uniprot|P39679 Kluyveromyces lactis MBP1 Transcription
           factor MBP1
          Length = 754

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 44/109 (40%), Gaps = 18/109 (16%)

Query: 40  AFYWTCILATCLAIYLLCKATLGDSSFDPLSAINNYNSYGSYPLSRSS-------NKNYK 92
           AF+W C + T   +  L KA          S+I + N+ G  PL RSS        + Y 
Sbjct: 379 AFHWACAMGTLPIVEALLKAG---------SSIRSLNNVGETPLIRSSIFHNCYTKRTYP 429

Query: 93  NAKELEDVEYYDYDFRSIDEMSFHNFDQGEQHYLITQYGGDVVTSKDKE 141
              E+     +D D +S +    H     + H     Y  DVV SK K+
Sbjct: 430 QIFEILKDTVFDLDAKSRN--VIHRIVSRKSHTPSAVYYLDVVLSKIKD 476

>TBLA0A01880 Chr1 (458462..462460) [3999 bp, 1332 aa] {ON} Anc_6.180
           YGL092W
          Length = 1332

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 26/41 (63%)

Query: 79  GSYPLSRSSNKNYKNAKELEDVEYYDYDFRSIDEMSFHNFD 119
           G YP+ + + K  KNA ++ +V+Y+    RS+ +M F +++
Sbjct: 576 GIYPIDKVTKKPIKNASDILEVQYFGKKLRSMKDMEFISYN 616

>ZYRO0E09790g Chr5 complement(776416..777264) [849 bp, 282 aa] {ON}
           similar to uniprot|P53060 Saccharomyces cerevisiae
           YGL250W Hypothetical ORF
          Length = 282

 Score = 30.8 bits (68), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 45/90 (50%), Gaps = 17/90 (18%)

Query: 139 DKERYIQEMENLLSSSVDKYDLSQFE---GTANGAENREHLLYLTPLRDA-----EHVLP 190
           D+E  + E +N +SSS ++    + E   G ANG+E++ H++    +R A     +H LP
Sbjct: 13  DEEEDLLEYDNSMSSSGEQEGSDREEAGNGNANGSEDKVHVVSDNEIRQAAEQLLQHKLP 72

Query: 191 MMFKHLMNLTYPHELIDIAFLVSDCSEGDK 220
            +F     + Y        FL+ DC E D+
Sbjct: 73  QVF-----IEYNGH----GFLLFDCEEKDQ 93

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,783,930
Number of extensions: 2880276
Number of successful extensions: 9098
Number of sequences better than 10.0: 91
Number of HSP's gapped: 9293
Number of HSP's successfully gapped: 134
Length of query: 520
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 406
Effective length of database: 40,409,475
Effective search space: 16406246850
Effective search space used: 16406246850
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)