Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0B032608.841ON32632616400.0
NCAS0D049408.841ON3273259231e-124
SAKL0D01452g8.841ON3273218931e-119
KLLA0D01551g8.841ON3313238771e-117
TPHA0G03760singletonON3313218721e-116
YPL273W (SAM4)8.841ON3253218671e-115
KAFR0B00210singletonON3263218671e-115
Kwal_27.102558.841ON3293238661e-115
Suva_13.515na 1ON3253218611e-114
KLTH0C03850g8.841ON3293238561e-114
YLL062C (MHT1)na 2ON3243258541e-113
NDAI0F00250singletonON3293268521e-113
Suva_16.17singletonON3243118481e-112
KNAG0B06970singletonON3323218481e-112
Ecym_46128.841ON3263228461e-112
Smik_6.4848.841ON3253218451e-112
TDEL0E05690singletonON3283078451e-112
TPHA0I002608.841ON3233248401e-111
Kpol_1068.78.841ON3233228371e-111
KAFR0L00150singletonON3263278281e-109
ZYRO0G14212g8.841ON3253258211e-108
Smik_12.1na 2ON3243158171e-108
Skud_12.4na 2ON3253218161e-108
TDEL0E00240singletonON3283168041e-106
ABL125W8.841ON3363208021e-105
KAFR0F04420singletonON3263217951e-104
Suva_64.1singletonON2732717241e-94
Suva_16.328.841ON2592476613e-85
SAKL0D09306gna 3ON3263346361e-80
Kwal_0.322na 3ON3323405944e-74
AFR410WsingletonON3703175452e-66
Skud_101.1singletonON2001955233e-65
KLTH0H12716gna 3ON3483345269e-64
Skud_100.1singletonON2001955077e-63
YMR321Cna 1ON105942682e-28
Skud_47.2singletonON96962506e-26
KAFR0L005607.154ON125684731.7
KAFR0H023208.696ON38282694.1
Kwal_23.43735.60ON43552685.6
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= TBLA0B03260
         (981 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0B03260 Chr2 (760392..761372) [981 bp, 326 aa] {ON} Anc_8.84...   636   0.0  
NCAS0D04940 Chr4 (948608..949591) [984 bp, 327 aa] {ON}               360   e-124
SAKL0D01452g Chr4 complement(115954..116937) [984 bp, 327 aa] {O...   348   e-119
KLLA0D01551g Chr4 complement(137965..138960) [996 bp, 331 aa] {O...   342   e-117
TPHA0G03760 Chr7 complement(795934..796929) [996 bp, 331 aa] {ON}     340   e-116
YPL273W Chr16 (25087..26064) [978 bp, 325 aa] {ON}  SAM4S-adenos...   338   e-115
KAFR0B00210 Chr2 complement(50980..51960) [981 bp, 326 aa] {ON}       338   e-115
Kwal_27.10255 s27 complement(264291..265280) [990 bp, 329 aa] {O...   338   e-115
Suva_13.515 Chr13 complement(901226..902203) [978 bp, 325 aa] {O...   336   e-114
KLTH0C03850g Chr3 complement(336417..337406) [990 bp, 329 aa] {O...   334   e-114
YLL062C Chr12 complement(16639..17613) [975 bp, 324 aa] {ON}  MH...   333   e-113
NDAI0F00250 Chr6 complement(47567..48556) [990 bp, 329 aa] {ON}       332   e-113
Suva_16.17 Chr16 complement(15787..16761) [975 bp, 324 aa] {ON} ...   331   e-112
KNAG0B06970 Chr2 (1387382..1388380) [999 bp, 332 aa] {ON}             331   e-112
Ecym_4612 Chr4 (1193587..1194567) [981 bp, 326 aa] {ON} similar ...   330   e-112
Smik_6.484 Chr6 (800680..801657) [978 bp, 325 aa] {ON} YPL273W (...   330   e-112
TDEL0E05690 Chr5 complement(1057559..1058545) [987 bp, 328 aa] {...   330   e-112
TPHA0I00260 Chr9 (49179..50150) [972 bp, 323 aa] {ON} Anc_8.841 ...   328   e-111
Kpol_1068.7 s1068 complement(11996..12967) [972 bp, 323 aa] {ON}...   327   e-111
KAFR0L00150 Chr12 complement(16662..17642) [981 bp, 326 aa] {ON}      323   e-109
ZYRO0G14212g Chr7 (1133202..1134179) [978 bp, 325 aa] {ON} simil...   320   e-108
Smik_12.1 Chr12 complement(885..1859) [975 bp, 324 aa] {ON} YLL0...   319   e-108
Skud_12.4 Chr12 complement(4676..5653) [978 bp, 325 aa] {ON} YLL...   318   e-108
TDEL0E00240 Chr5 complement(38804..39790) [987 bp, 328 aa] {ON}       314   e-106
ABL125W Chr2 (161358..162368) [1011 bp, 336 aa] {ON} Non-synteni...   313   e-105
KAFR0F04420 Chr6 (867176..868156) [981 bp, 326 aa] {ON}               310   e-104
Suva_64.1 Chr64 (76..894) [819 bp, 273 aa] {ON} YPL273W (REAL)        283   1e-94
Suva_16.32 Chr16 (40969..41748) [780 bp, 259 aa] {ON} YPL273W (R...   259   3e-85
SAKL0D09306g Chr4 (771565..772545) [981 bp, 326 aa] {ON} similar...   249   1e-80
Kwal_0.322 s0 (152442..153440) [999 bp, 332 aa] {ON} YLL062C (MH...   233   4e-74
AFR410W Chr6 (1171334..1172446) [1113 bp, 370 aa] {ON} Non-synte...   214   2e-66
Skud_101.1 Chr101 complement(3..602) [600 bp, 200 aa] {ON} YPL27...   206   3e-65
KLTH0H12716g Chr8 (1079836..1080882) [1047 bp, 348 aa] {ON} simi...   207   9e-64
Skud_100.1 Chr100 complement(3..602) [600 bp, 200 aa] {ON} YPL27...   199   7e-63
YMR321C Chr13 complement(917579..917896) [318 bp, 105 aa] {ON} P...   107   2e-28
Skud_47.2 Chr47 (1368..1655) [288 bp, 96 aa] {ON} YPL273W (REAL)      100   6e-26
KAFR0L00560 Chr12 (102072..105842) [3771 bp, 1256 aa] {ON} Anc_7...    33   1.7  
KAFR0H02320 Chr8 (443614..444762) [1149 bp, 382 aa] {ON} Anc_8.6...    31   4.1  
Kwal_23.4373 s23 complement(691827..693134) [1308 bp, 435 aa] {O...    31   5.6  

>TBLA0B03260 Chr2 (760392..761372) [981 bp, 326 aa] {ON} Anc_8.841
           YPL273W
          Length = 326

 Score =  636 bits (1640), Expect = 0.0
 Identities = 313/326 (96%), Positives = 313/326 (96%)
 Frame = +1

Query: 1   MRQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNIS 180
           MRQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNIS
Sbjct: 1   MRQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNIS 60

Query: 181 IVKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSK 360
           IVKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSK
Sbjct: 61  IVKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSK 120

Query: 361 YLIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYE 540
           YLIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQ             AMETVPNKYE
Sbjct: 121 YLIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQLDNFNDNDDIDLIAMETVPNKYE 180

Query: 541 LKALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVKNPNLMMVGVNCVS 720
           LKALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVKNPNLMMVGVNCVS
Sbjct: 181 LKALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVKNPNLMMVGVNCVS 240

Query: 721 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV 900
           YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV
Sbjct: 241 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV 300

Query: 901 RMVGGCCRTTPDDIHKIAQAVSHLSH 978
           RMVGGCCRTTPDDIHKIAQAVSHLSH
Sbjct: 301 RMVGGCCRTTPDDIHKIAQAVSHLSH 326

>NCAS0D04940 Chr4 (948608..949591) [984 bp, 327 aa] {ON} 
          Length = 327

 Score =  360 bits (923), Expect = e-124
 Identities = 169/325 (52%), Positives = 229/325 (70%), Gaps = 1/325 (0%)
 Frame = +1

Query: 4   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISI 183
           RQS KEY   +P+ V+V+DGGQGTELE RG++V++ VWST+PF+   FW  D+ S +  I
Sbjct: 3   RQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWS-DKSSNDRQI 61

Query: 184 VKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKY 363
           VK+MF+ F+AAG++ LM+ TYQ SF ++S NT I+ L+EYNELLN+IV F R+CIG  KY
Sbjct: 62  VKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQKY 121

Query: 364 LIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYEL 543
           LIG IGP+ +HV AE+ GDYG HPEN+DY  YFKPQ               ETVPN  EL
Sbjct: 122 LIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNEL 181

Query: 544 KALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVS 720
           KA+LSWD   + KPFYI LSV ++G LRDGT+M+ I  +F++   K NPNL+++G+NCVS
Sbjct: 182 KAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCVS 241

Query: 721 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV 900
           ++ +  I++ +   +PD+PL+ YPNSGEVYD + + W   N     +WE +VK  +  G 
Sbjct: 242 FNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVKRYIEAGA 301

Query: 901 RMVGGCCRTTPDDIHKIAQAVSHLS 975
           R++GGCCRTTP DI +I++AV   S
Sbjct: 302 RIIGGCCRTTPKDILEISKAVKKFS 326

>SAKL0D01452g Chr4 complement(115954..116937) [984 bp, 327 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 327

 Score =  348 bits (893), Expect = e-119
 Identities = 160/321 (49%), Positives = 226/321 (70%), Gaps = 1/321 (0%)
 Frame = +1

Query: 4   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISI 183
           RQ  K++F  HP+ ++VMDGGQGTELE RG+ V++ VWST+PFI   FW  +E S++  I
Sbjct: 3   RQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWS-NESSRDRQI 61

Query: 184 VKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKY 363
           VK+MF  F+  GS+ LM+ TYQ SF ++S NT I+ L+EYN+LL +IV F RECIG  KY
Sbjct: 62  VKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDKY 121

Query: 364 LIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYEL 543
           LIG IG + +HV  E+TGDYG +PE +D+L YF+PQ               ET+PN +EL
Sbjct: 122 LIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHEL 181

Query: 544 KALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVS 720
           KA+LSWD + I KPFYI LSV ++G LRDGT+M  ++ + ++   K NPNLM++G+NCVS
Sbjct: 182 KAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCVS 241

Query: 721 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV 900
           ++ + +I+  L   +PD+P++ YPNSGE+YD + + W  N + K+ +W+ +VK  + NG 
Sbjct: 242 FNHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWLHNENQKV-TWDDVVKSYIENGA 300

Query: 901 RMVGGCCRTTPDDIHKIAQAV 963
           R++GGCCRT+P DI  I QA+
Sbjct: 301 RIIGGCCRTSPQDIKDIVQAI 321

>KLLA0D01551g Chr4 complement(137965..138960) [996 bp, 331 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase,
          Length = 331

 Score =  342 bits (877), Expect = e-117
 Identities = 161/323 (49%), Positives = 222/323 (68%), Gaps = 1/323 (0%)
 Frame = +1

Query: 1   MRQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNIS 180
           MR   K+YF  +P+ V+VMDGGQGTELE RG++V++ VWSTVPFI   FW  D     I 
Sbjct: 1   MRVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDASKDRI- 59

Query: 181 IVKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSK 360
           IVK MF+ F+ AG+  LM+ITYQ SF ++S NT I+ LEEYN LL++IV F R CIG  +
Sbjct: 60  IVKQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDR 119

Query: 361 YLIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYE 540
           YLIG IG + +HV +E+TGDYG HP+ +DY  YF+PQ               ET+PN +E
Sbjct: 120 YLIGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHE 179

Query: 541 LKALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCV 717
           L+A+LSWD T + KPFYI LSV + G LRDGTSM  I+ +  +   K N NLM +G+NC 
Sbjct: 180 LRAILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCC 239

Query: 718 SYDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANG 897
           +++++ MI++ L  + P++PL+ YPNSGE+YD + + W   N+ +L +W+ +VK  + NG
Sbjct: 240 AFNQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIW-LKNENQLCTWDDVVKSYIENG 298

Query: 898 VRMVGGCCRTTPDDIHKIAQAVS 966
            R++GGCCRTT DDI ++  AV+
Sbjct: 299 ARIIGGCCRTTVDDIKEVRLAVN 321

>TPHA0G03760 Chr7 complement(795934..796929) [996 bp, 331 aa] {ON} 
          Length = 331

 Score =  340 bits (872), Expect = e-116
 Identities = 161/321 (50%), Positives = 219/321 (68%), Gaps = 1/321 (0%)
 Frame = +1

Query: 4   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISI 183
           RQ  K Y   +PN V+VMDGGQGTELE RG+ V++ VWST+PFI   FW  D+ S++  I
Sbjct: 3   RQCIKNYLQENPNKVLVMDGGQGTELENRGIKVANPVWSTIPFISESFWS-DQSSEDRKI 61

Query: 184 VKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKY 363
           VK+MF  F+ AG++ LM+ TYQ SF ++S NT I+  + YNELLN+I+ F R+CIG  +Y
Sbjct: 62  VKEMFNDFINAGAEILMTTTYQTSFKSVSENTPIKNTKHYNELLNRIIDFSRDCIGEERY 121

Query: 364 LIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYEL 543
           LIG IG + +H+ AE+ GDYG HPEN+D+  YFKPQ               ETVPN +EL
Sbjct: 122 LIGCIGSWGAHICAEFHGDYGEHPENIDFYEYFKPQLDNFFNNNKLDLIGFETVPNIHEL 181

Query: 544 KALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQN-REVKNPNLMMVGVNCVS 720
           KA+LSWD   + KPFYI LSV ++G LRDGTSM  ++ + +   E  NPNL ++G+NCVS
Sbjct: 182 KAILSWDEKILSKPFYIGLSVHENGLLRDGTSMQEVANLIKGFGEKLNPNLTLLGINCVS 241

Query: 721 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV 900
           Y+ +  IIK +   +P+LPL+ YPNSGE+YD   + W  N +  + +W+ +VK  +  GV
Sbjct: 242 YNHSNDIIKSIHKELPNLPLIAYPNSGEIYDTTKKIWLPNKN-PIFTWDDIVKGYIEAGV 300

Query: 901 RMVGGCCRTTPDDIHKIAQAV 963
           R++GGCCRTTP+DI  +  AV
Sbjct: 301 RIIGGCCRTTPNDIKAVTIAV 321

>YPL273W Chr16 (25087..26064) [978 bp, 325 aa] {ON}
           SAM4S-adenosylmethionine-homocysteine methyltransferase,
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 325

 Score =  338 bits (867), Expect = e-115
 Identities = 160/321 (49%), Positives = 223/321 (69%), Gaps = 1/321 (0%)
 Frame = +1

Query: 4   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISI 183
           R   K++   +P  V+V+DGGQGTELE RG+ V++ VWST+PFI   FW  DE S N  I
Sbjct: 3   RLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWS-DESSANRKI 61

Query: 184 VKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKY 363
           VK+MF  F+ AG++ LM+ TYQ S+ ++S NT I+ L EYN LLN+IV F R CIG  KY
Sbjct: 62  VKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDKY 121

Query: 364 LIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYEL 543
           LIG IGP+ +H+  E+TGDYG  PEN+D+  YFKPQ               ET+PN +EL
Sbjct: 122 LIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHEL 181

Query: 544 KALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVS 720
           KA+LSWD + + +PFYI LSV + G LRDGT+M+ I+ + ++   K NPN   +G+NCVS
Sbjct: 182 KAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCVS 241

Query: 721 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV 900
           ++++  I++ L  A+P++ L+ YPNSGEVYD   + W  N+D KL+SW+T+VK  +++G 
Sbjct: 242 FNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSD-KLNSWDTVVKQYISSGA 300

Query: 901 RMVGGCCRTTPDDIHKIAQAV 963
           R++GGCCRT+P DI +I+ AV
Sbjct: 301 RIIGGCCRTSPKDIQEISAAV 321

>KAFR0B00210 Chr2 complement(50980..51960) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  338 bits (867), Expect = e-115
 Identities = 161/321 (50%), Positives = 219/321 (68%), Gaps = 1/321 (0%)
 Frame = +1

Query: 4   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISI 183
           RQ  KEY   +P  V+V+DGGQGTELE RG+ V++ VWST+PFI   FW  +  S++  I
Sbjct: 3   RQPIKEYLEENPKKVLVLDGGQGTELENRGIHVANPVWSTIPFISESFWS-NASSKDREI 61

Query: 184 VKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKY 363
           VK MFQ F+ AG+  LM+ITYQ SF +++ NT I+ L+EYNELL +IV F R CIG+ KY
Sbjct: 62  VKGMFQDFLDAGADILMTITYQTSFKSVTENTPIKTLKEYNELLERIVSFSRSCIGDEKY 121

Query: 364 LIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYEL 543
           LIG IGP+ +HV AE+ GDYG HPEN+DY  YFKPQ               ETVPN +EL
Sbjct: 122 LIGCIGPWGAHVCAEFNGDYGGHPENIDYYAYFKPQLDNFFQNKDLDLIGFETVPNFHEL 181

Query: 544 KALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVS 720
           KA+LSWD T + KPFYI LSV ++G LRDGT+M+ I    ++   K NPN +++G+NCVS
Sbjct: 182 KAILSWDDTILSKPFYIGLSVHENGVLRDGTTMNEIGYYIKSLGSKINPNFLLLGINCVS 241

Query: 721 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV 900
           +  +  I++ +   +PD+PL+ YPNSGE+YD + + W  N+   + +W  +V   +  G 
Sbjct: 242 FSDSPDILESIHKELPDMPLIAYPNSGEIYDTVKKIWLPNHYSDI-TWNDVVNRYIKAGA 300

Query: 901 RMVGGCCRTTPDDIHKIAQAV 963
           R++GGCCRT PDDI +++ AV
Sbjct: 301 RIIGGCCRTMPDDIEQVSAAV 321

>Kwal_27.10255 s27 complement(264291..265280) [990 bp, 329 aa] {ON}
           YPL273W (SAM4) - S-adenosylmethionine:homocysteine
           S-methyltransferase [contig 37] FULL
          Length = 329

 Score =  338 bits (866), Expect = e-115
 Identities = 156/323 (48%), Positives = 226/323 (69%), Gaps = 2/323 (0%)
 Frame = +1

Query: 1   MRQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQ-KDEKSQNI 177
           +R S KE+   +P  V+V+DGGQGTELE RG+ V++ VWST+PFI   FW  +D+ S++ 
Sbjct: 2   VRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKDR 61

Query: 178 SIVKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNS 357
            IVK+M+  F+ AG++ LM++TYQ SF ++S NT+I+ LEEY+ LLN+IV F RECIG+ 
Sbjct: 62  QIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGDD 121

Query: 358 KYLIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKY 537
           K+L+G IG + +H  +E+TGDYG  PE +D+L YFKPQ               ET+PN +
Sbjct: 122 KFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNIH 181

Query: 538 ELKALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQN-REVKNPNLMMVGVNC 714
           EL+A+LSWD + I KPFYI LSV ++G LRDGT+M  ++ + ++  +  NPN  ++G+NC
Sbjct: 182 ELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGINC 241

Query: 715 VSYDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVAN 894
           VSY+++  I++ L   +P++PL+ YPNSGEVYD + + W   N   L SWE +VK  + +
Sbjct: 242 VSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQTL-SWEQIVKSYIDS 300

Query: 895 GVRMVGGCCRTTPDDIHKIAQAV 963
           G R++GGCCRT+P DI  I +AV
Sbjct: 301 GARIIGGCCRTSPKDIEAIHEAV 323

>Suva_13.515 Chr13 complement(901226..902203) [978 bp, 325 aa] {ON}
           YPL273W (REAL)
          Length = 325

 Score =  336 bits (861), Expect = e-114
 Identities = 159/321 (49%), Positives = 225/321 (70%), Gaps = 1/321 (0%)
 Frame = +1

Query: 4   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISI 183
           R   K+     P  V+V+DGGQGTELE RG+ V++ VWST+PFI   FW  DE S N  I
Sbjct: 3   RIPLKQLLADDPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWS-DESSANRKI 61

Query: 184 VKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKY 363
           VK+MF  F+AAG++ LM+ITYQ SF ++S NT I+ L  Y+ LL +IV F R+CIG  K+
Sbjct: 62  VKEMFNDFLAAGAEILMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKH 121

Query: 364 LIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYEL 543
           LIG IGP+ +HV  E+TG+YG +PE++D+  YFKPQ               ET+PN +EL
Sbjct: 122 LIGCIGPWGAHVCCEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHEL 181

Query: 544 KALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVS 720
           KA+LSWD + + KPFYI LSV + G LRDGT+M+ ++ + ++   K NPN +++G+NCVS
Sbjct: 182 KAILSWDESILSKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVS 241

Query: 721 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV 900
           ++++  I++ L  A+P++PL+ YPNSGEVYD   + W  N+D KL+SW+T+VK  + +G 
Sbjct: 242 FNQSPDILESLHRALPNMPLLAYPNSGEVYDTEKKIWMPNSD-KLNSWDTVVKQYIGSGA 300

Query: 901 RMVGGCCRTTPDDIHKIAQAV 963
           R++GGCCRTTP DI +++ AV
Sbjct: 301 RIIGGCCRTTPKDIQEVSAAV 321

>KLTH0C03850g Chr3 complement(336417..337406) [990 bp, 329 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 329

 Score =  334 bits (856), Expect = e-114
 Identities = 157/323 (48%), Positives = 222/323 (68%), Gaps = 2/323 (0%)
 Frame = +1

Query: 4   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQ-KDEKSQNIS 180
           R S KEY  ++P  V+V+DGGQGTELE RG+ V++ VWST+PFI   FW   D  S++  
Sbjct: 3   RPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKDRQ 62

Query: 181 IVKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSK 360
           IVK+M++ F+ AG++ LM++TYQ SF ++S NT I  LEEY+ LL++IV F R CIG+ K
Sbjct: 63  IVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGDDK 122

Query: 361 YLIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYE 540
           +L+G IGP+ +H  +E+TGDYG  PE +DYL YFKPQ               ET+PN +E
Sbjct: 123 WLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNIHE 182

Query: 541 LKALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCV 717
           L+A+LSWD T + KPFYI LSV + G LRDGT+M  ++ + ++   K NPN +++G+NCV
Sbjct: 183 LRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGINCV 242

Query: 718 SYDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANG 897
           SY+ +  I++ L   +P+LPL+ YPNSGEVYD + + W    D  L +W+ +VK  + +G
Sbjct: 243 SYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDHTL-TWDQVVKSYIDSG 301

Query: 898 VRMVGGCCRTTPDDIHKIAQAVS 966
            R++GGCCRT+P DI  I  AV+
Sbjct: 302 ARIIGGCCRTSPKDIAAINAAVN 324

>YLL062C Chr12 complement(16639..17613) [975 bp, 324 aa] {ON}
           MHT1S-methylmethionine-homocysteine methyltransferase,
           functions along with Sam4p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 324

 Score =  333 bits (854), Expect = e-113
 Identities = 163/325 (50%), Positives = 217/325 (66%), Gaps = 1/325 (0%)
 Frame = +1

Query: 4   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISI 183
           R   KE    HP  V+++DGGQGTELE RG++++S VWS  PF    FW+    SQ   +
Sbjct: 3   RIPIKELIVEHPGKVLILDGGQGTELENRGININSPVWSAAPFTSESFWEPS--SQERKV 60

Query: 184 VKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKY 363
           V++M++ F+ AG+  LM+ITYQ +F +IS NT I+ L  Y   L+KIV F RE IG  +Y
Sbjct: 61  VEEMYRDFMIAGANILMTITYQANFQSISENTSIKTLAAYKRFLDKIVSFTREFIGEERY 120

Query: 364 LIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYEL 543
           LIGSIGP+A+HVS EYTGDYG HPEN+DY  +FKPQ               ET+PN +EL
Sbjct: 121 LIGSIGPWAAHVSCEYTGDYGPHPENIDYYGFFKPQLENFNQNRDIDLIGFETIPNFHEL 180

Query: 544 KALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVS 720
           KA+LSWD   I KPFYI LSV D+  LRDGT+++ IS   +    K N NL+++GVNCVS
Sbjct: 181 KAILSWDEDIISKPFYIGLSVDDNSLLRDGTTLEEISVHIKGLGNKINKNLLLMGVNCVS 240

Query: 721 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV 900
           ++++ +I+K L   +P +PL+ YPNSGE+Y+   ++W    + KLD WET VK  V NG 
Sbjct: 241 FNQSALILKMLHEHLPGMPLLVYPNSGEIYNPKEKTWHRPTN-KLDDWETTVKKFVDNGA 299

Query: 901 RMVGGCCRTTPDDIHKIAQAVSHLS 975
           R++GGCCRT+P DI +IA AV   S
Sbjct: 300 RIIGGCCRTSPKDIAEIASAVDKYS 324

>NDAI0F00250 Chr6 complement(47567..48556) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  332 bits (852), Expect = e-113
 Identities = 155/326 (47%), Positives = 221/326 (67%), Gaps = 1/326 (0%)
 Frame = +1

Query: 4   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISI 183
           RQ  K+Y + +P  ++++DGGQGTELE RG++V++ VWST+PF+   FW   + S++  I
Sbjct: 3   RQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWS-GQSSKDREI 61

Query: 184 VKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKY 363
           VK MF  F+ AG++ LM+ TYQ SF ++S NT I+ L+EY+ELL +IV F R+CIG +KY
Sbjct: 62  VKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENKY 121

Query: 364 LIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYEL 543
           LIG IGP+ +H+ +E+TG+YG HPE +DY  YFKPQ               ET+PN YEL
Sbjct: 122 LIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYEL 181

Query: 544 KALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVS 720
           K +LSW    + KPFYI LSV ++G LRDGT+M  ++ +  +   K NPNL+++G+NCVS
Sbjct: 182 KTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCVS 241

Query: 721 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV 900
              +  I+  +   +PDLPL+ YPNSGEVYD + + W   ND    SW+ +V+  +  G 
Sbjct: 242 LAHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETYMSWDEVVERYLKAGA 301

Query: 901 RMVGGCCRTTPDDIHKIAQAVSHLSH 978
           R++GGCCRTTP+DI +I+ AV   S+
Sbjct: 302 RIIGGCCRTTPNDIKQISDAVHKYSN 327

>Suva_16.17 Chr16 complement(15787..16761) [975 bp, 324 aa] {ON}
           YLL062C (REAL)
          Length = 324

 Score =  331 bits (848), Expect = e-112
 Identities = 156/311 (50%), Positives = 220/311 (70%), Gaps = 1/311 (0%)
 Frame = +1

Query: 34  HPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISIVKDMFQAFVA 213
           HP  V+V+DGGQGTELE RG+D++S VWS  PFI   FW+    S + ++V++M++ F+ 
Sbjct: 13  HPQKVLVLDGGQGTELENRGIDINSPVWSAAPFISDSFWEST--SSDRTLVEEMYRDFMD 70

Query: 214 AGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKYLIGSIGPYAS 393
           AG+  LM++TYQ +FS+IS NT I+ L +YN  L+++V F R  IG  +YLIGSIGP+A+
Sbjct: 71  AGANVLMTVTYQANFSSISENTSIKTLSDYNRFLDRVVSFTRRVIGEDRYLIGSIGPWAA 130

Query: 394 HVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYELKALLSWDGTT 573
           HVS+EYTGDYG HPE++DYL +FK Q               ETVPN +ELKA+LSWD   
Sbjct: 131 HVSSEYTGDYGSHPEDIDYLQHFKAQLDNFNKHTEIDLIGFETVPNFHELKAILSWDENI 190

Query: 574 IKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVSYDKTLMIIKK 750
           I KPFY+ LSV D+G LRDGT+M+ I+   ++   K N + +++GVNC+S++++  I+K 
Sbjct: 191 ISKPFYVGLSVHDNGLLRDGTTMEEIAAYVKSLGRKINRHFLLLGVNCISFNQSTSILKS 250

Query: 751 LQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGVRMVGGCCRTT 930
           L  A+PD+PL+ YPNSGEVYD  T++W      K +SWE +V++ + NG R++GGCCRT+
Sbjct: 251 LHQALPDMPLLAYPNSGEVYDTKTKTWHQAKG-KQNSWEVVVEEFIDNGARIIGGCCRTS 309

Query: 931 PDDIHKIAQAV 963
             DI +IA AV
Sbjct: 310 AKDISEIASAV 320

>KNAG0B06970 Chr2 (1387382..1388380) [999 bp, 332 aa] {ON} 
          Length = 332

 Score =  331 bits (848), Expect = e-112
 Identities = 159/321 (49%), Positives = 223/321 (69%), Gaps = 1/321 (0%)
 Frame = +1

Query: 4   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISI 183
           RQ  +EY   +P  V+V+DGGQGTELE RG++V++ VWSTVPFI   FW  ++ S++  I
Sbjct: 3   RQPIQEYLKVNPRKVLVLDGGQGTELENRGINVANPVWSTVPFIDSSFWS-NKSSKDRVI 61

Query: 184 VKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKY 363
           VK MF AF+ AG++ LM+ TYQ SF ++S NT IQ LEEY+ LL++IV+F R+CIG  KY
Sbjct: 62  VKGMFDAFLDAGAEILMTTTYQTSFKSVSENTPIQNLEEYSSLLDRIVQFSRDCIGPDKY 121

Query: 364 LIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYEL 543
           LIG IGP+ +HV AE+ GDYG +P  +DYL+YFKPQ               ET+PN +EL
Sbjct: 122 LIGCIGPWGAHVCAEFNGDYGPNPAEIDYLSYFKPQLDNFFHNDNLDLIGFETIPNIHEL 181

Query: 544 KALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVS 720
           +A+LSWD T + KPFYI LSV ++G LRDG++M  ++ + ++   K N NL ++G+NCVS
Sbjct: 182 RAILSWDETILSKPFYIGLSVHNNGLLRDGSTMKDVADLIKSFGGKLNKNLTLLGINCVS 241

Query: 721 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV 900
           +  +  I++ +   +PD+PL+ YPNSGEVYD + + W  N D+ + +WE +V   +  G 
Sbjct: 242 FSDSPDILESIHKELPDMPLIAYPNSGEVYDTVKKIWLPNRDMVM-TWEEVVDRYIKAGA 300

Query: 901 RMVGGCCRTTPDDIHKIAQAV 963
           R+VGGCCRT+P DI  +A AV
Sbjct: 301 RIVGGCCRTSPKDIRAVAAAV 321

>Ecym_4612 Chr4 (1193587..1194567) [981 bp, 326 aa] {ON} similar to
           Ashbya gossypii ABL125W
          Length = 326

 Score =  330 bits (846), Expect = e-112
 Identities = 152/322 (47%), Positives = 223/322 (69%), Gaps = 1/322 (0%)
 Frame = +1

Query: 1   MRQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNIS 180
           +R S K+   ++P+ +++MDGGQGTELE RG++V++ VWST+PFI   FW  D  S++  
Sbjct: 2   VRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINDSFWS-DRSSRDRQ 60

Query: 181 IVKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSK 360
           IV  MF+ ++AAG+  LM+ITYQ SF ++S NT I+ LEEYN+LL++IV F R CIG   
Sbjct: 61  IVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADN 120

Query: 361 YLIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYE 540
           YL+G IG + +H+ AE++GDYG HPE + YL+YF+PQ               ET+PN +E
Sbjct: 121 YLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHE 180

Query: 541 LKALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCV 717
           L A+LSWD + IKKPFYI +SV + G LRDGT+M  ++ +F++   K NPN + +G+NC 
Sbjct: 181 LTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCC 240

Query: 718 SYDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANG 897
           S+  + MI++ L   +P +PL+ YPNSGE+YD + + W  N +  + +W+ +VK  + +G
Sbjct: 241 SFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWLKNENC-IVTWDEIVKSYLQSG 299

Query: 898 VRMVGGCCRTTPDDIHKIAQAV 963
            R++GGCCRTTP+DI +I  AV
Sbjct: 300 ARIIGGCCRTTPNDIRQIVTAV 321

>Smik_6.484 Chr6 (800680..801657) [978 bp, 325 aa] {ON} YPL273W
           (REAL)
          Length = 325

 Score =  330 bits (845), Expect = e-112
 Identities = 157/321 (48%), Positives = 220/321 (68%), Gaps = 1/321 (0%)
 Frame = +1

Query: 4   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISI 183
           R   K+    +P  V+V+DGGQGTELE RG+ V++ VWST+PFI   FW  DE S +  I
Sbjct: 3   RLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWS-DESSSSRKI 61

Query: 184 VKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKY 363
           VK+MF  F+ AG++ LM+ TYQ S+ ++S NT I+ L EYN LL +IV F R CIG  KY
Sbjct: 62  VKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDKY 121

Query: 364 LIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYEL 543
           LIG IGP+ +H+  E+TGDYG +PE++D+  YFKPQ               ET+PN +EL
Sbjct: 122 LIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQLDNFNKNDNLDLIGFETIPNIHEL 181

Query: 544 KALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVS 720
           KA+LSWD + + KPFYI LSV + G LRDGT+M  ++ + ++   K NPN  ++G+NCVS
Sbjct: 182 KAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCVS 241

Query: 721 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV 900
           ++++  I++ L  A+PD+ L+ YPNSGEVYD   + W  N+D KL+SW+ +VK  +++G 
Sbjct: 242 FNQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWLPNSD-KLNSWDAVVKRYISSGA 300

Query: 901 RMVGGCCRTTPDDIHKIAQAV 963
           R++GGCCRT+P DI +I  AV
Sbjct: 301 RIIGGCCRTSPKDIQEIFTAV 321

>TDEL0E05690 Chr5 complement(1057559..1058545) [987 bp, 328 aa] {ON}
           
          Length = 328

 Score =  330 bits (845), Expect = e-112
 Identities = 156/307 (50%), Positives = 217/307 (70%), Gaps = 1/307 (0%)
 Frame = +1

Query: 46  VIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISIVKDMFQAFVAAGSQ 225
           ++V+DGGQGTELE RG++V++ VWST+PF+   FW  D  S+   IV+ +F  F  +GS 
Sbjct: 16  ILVLDGGQGTELENRGIEVANPVWSTIPFLSESFWT-DSSSKERKIVESVFDDFKKSGSN 74

Query: 226 ALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKYLIGSIGPYASHVSA 405
            LM+ITYQ SF++I  NT+ + L EYN LL++IVKF R CIG+ +YLIGS+GP+ +HV  
Sbjct: 75  ILMTITYQTSFTSIVENTQFKTLAEYNTLLDRIVKFSRSCIGDERYLIGSVGPWGAHVCC 134

Query: 406 EYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYELKALLSWDGTTIKKP 585
           E+TG+YGLHPE++DY  YFKPQ               ETVPN +ELKA+LSWD T I KP
Sbjct: 135 EFTGNYGLHPESIDYYEYFKPQLDNFNGQDEIDLIGFETVPNFHELKAILSWDETKIAKP 194

Query: 586 FYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVSYDKTLMIIKKLQIA 762
           FYI LSV ++G LRDGT+M+ I    +    K + N +++GVNCVS++ +  ++K +  A
Sbjct: 195 FYIGLSVHNNGVLRDGTTMEEIGEYIKGLGEKISSNFLLLGVNCVSFNDSSDMVKSIHKA 254

Query: 763 VPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGVRMVGGCCRTTPDDI 942
           +PD+PL+ YPNSGEVYD   + W  N D KLDSW+++V+  + NG R++GGCCRT+P DI
Sbjct: 255 LPDMPLLAYPNSGEVYDTEKKIWFDNKD-KLDSWDSVVRSYIDNGARIIGGCCRTSPRDI 313

Query: 943 HKIAQAV 963
            +++ AV
Sbjct: 314 AEVSAAV 320

>TPHA0I00260 Chr9 (49179..50150) [972 bp, 323 aa] {ON} Anc_8.841
           YPL273W
          Length = 323

 Score =  328 bits (840), Expect = e-111
 Identities = 151/324 (46%), Positives = 219/324 (67%)
 Frame = +1

Query: 1   MRQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNIS 180
           MR  F+++ + HPN ++V+DGGQGTELE RGV+++S +WST+ F+  +FW ++ ++    
Sbjct: 1   MRVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENTERK 60

Query: 181 IVKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSK 360
            +++MF  F  AG+    ++TYQ SFS++S NT I++L+EY+ELL KI  FCR CI +  
Sbjct: 61  CIREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDD 120

Query: 361 YLIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYE 540
           YL+G IG YA+ + AEY G+YGL    +DYL YFKPQ               ET+PNK+E
Sbjct: 121 YLLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHE 180

Query: 541 LKALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVKNPNLMMVGVNCVS 720
           L+A+LSWD   I +PF+I+LS+ D   LRDGTS + +  +F   + +N NL+ VG NC+S
Sbjct: 181 LEAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGRNKNLVYVGGNCIS 240

Query: 721 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV 900
           Y  ++  I+KL   VP L L+ YPNSGE+YDQ ++ W + + IK+ SWE +V +    GV
Sbjct: 241 YAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKI-SWEEVVNEYADAGV 299

Query: 901 RMVGGCCRTTPDDIHKIAQAVSHL 972
           +++GGCCRTTPDDI +I +AV  L
Sbjct: 300 KIIGGCCRTTPDDIKQIKKAVDAL 323

>Kpol_1068.7 s1068 complement(11996..12967) [972 bp, 323 aa] {ON}
           complement(11996..12967) [972 nt, 324 aa]
          Length = 323

 Score =  327 bits (837), Expect = e-111
 Identities = 152/322 (47%), Positives = 219/322 (68%)
 Frame = +1

Query: 1   MRQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNIS 180
           MR   +E     P+ V+V DGG GT LE RG++VSS +WSTVPF+  +FW  + K+ + +
Sbjct: 1   MRVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRN 60

Query: 181 IVKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSK 360
           I++ +++ ++ +GS+ L +ITYQ SF+ IS++T+++ +E Y +L+  I  FCR  IG   
Sbjct: 61  IIEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDN 120

Query: 361 YLIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYE 540
           YLIGSIGP+ + + AEYTG+YG  P N++YL YFKPQ               ETVPNKYE
Sbjct: 121 YLIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYE 180

Query: 541 LKALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVKNPNLMMVGVNCVS 720
           L+A+LSWD + I KP+Y+SLS+ D+G LRDGTS + I+T+F+ +   N NL++ G NC+S
Sbjct: 181 LEAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFK-KYSNNDNLILTGANCIS 239

Query: 721 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV 900
           +      I KL  A+P LPL+ YPNSGE+YD +T+ W  +    L +WE L+K+L  + V
Sbjct: 240 FKYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQTFGL-TWEDLIKELRTSNV 298

Query: 901 RMVGGCCRTTPDDIHKIAQAVS 966
           R+VGGCCRTTPDDI+KI   ++
Sbjct: 299 RIVGGCCRTTPDDINKIKDMIT 320

>KAFR0L00150 Chr12 complement(16662..17642) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  323 bits (828), Expect = e-109
 Identities = 162/327 (49%), Positives = 217/327 (66%), Gaps = 1/327 (0%)
 Frame = +1

Query: 1   MRQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNIS 180
           +R   K+Y   +P  V+V DGGQG ELERRG+D+  ++WST PF+ + FW  D  S +I 
Sbjct: 2   VRVPLKKYLKENPEKVLVSDGGQGLELERRGLDIKHRLWSTRPFLSKSFWS-DPSSNDIR 60

Query: 181 IVKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSK 360
           IVK MF+ FV AG++ LM+ TYQ SF  +S +T++++L EYNELL+KIV F R CIG+++
Sbjct: 61  IVKGMFEDFVNAGAEILMTTTYQTSFKAVSESTELKSLREYNELLDKIVGFTRACIGDNR 120

Query: 361 YLIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYE 540
           YLIGSIG Y + V  EY+GDYG  PE VD+ +YFKPQ               ET+ N  E
Sbjct: 121 YLIGSIGSYGALVGGEYSGDYGDSPETVDFYSYFKPQLDNFLNNDEIDIVGFETIANFTE 180

Query: 541 LKALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCV 717
           LK+LLSWD   + KPFYISLSV D+GNLRDGT M  I+   ++     NPNL  +GVNCV
Sbjct: 181 LKSLLSWDEKKVSKPFYISLSVHDNGNLRDGTPMHLITDYIKSLATAINPNLTFLGVNCV 240

Query: 718 SYDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANG 897
           +Y+K   II  +   +P +PL  +PNSGEV++     W  N +    SWE +VK  +++G
Sbjct: 241 NYNKATEIIDSIHNGLPTMPLSVFPNSGEVFNVEKGIWTANPEAAA-SWEAVVKRFISSG 299

Query: 898 VRMVGGCCRTTPDDIHKIAQAVSHLSH 978
           VR+VGGCCRT P DI +I++AV  LS+
Sbjct: 300 VRIVGGCCRTRPHDIEQISKAVKKLSN 326

>ZYRO0G14212g Chr7 (1133202..1134179) [978 bp, 325 aa] {ON} similar
           to uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 325

 Score =  320 bits (821), Expect = e-108
 Identities = 160/325 (49%), Positives = 212/325 (65%), Gaps = 4/325 (1%)
 Frame = +1

Query: 1   MRQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNIS 180
           MRQ   E      + V+VMDGGQGTELE RG+++S  +WSTVPF   EFW  D+   +  
Sbjct: 1   MRQQLLEVLRD-TDRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRD 59

Query: 181 IVKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSK 360
           +V  MF+A+V AG+Q L ++TYQ S+ TI ++T I    +Y++LL++IV FCR CIG+  
Sbjct: 60  VVNSMFKAYVDAGAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDH 119

Query: 361 YLIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYE 540
           YL+GSIGPYA+HV AEYTGDYG  PE +DY  YF+PQ              +ETVPN +E
Sbjct: 120 YLVGSIGPYAAHVGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHE 179

Query: 541 LKALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVKNPNLMMVGVNCVS 720
           LK++LSWD T I KPFY+SL VGDDGNLRDGT ++ +  +F NR   N NL++VG+NC S
Sbjct: 180 LKSILSWDETKISKPFYVSLCVGDDGNLRDGTPLEQLVPLFANR--SNKNLLLVGINCCS 237

Query: 721 YDKTLMIIKKLQ--IAVPDLPLVCYPNSGEVYDQITQSWK--TNNDIKLDSWETLVKDLV 888
              +   +  L   +A   + L+ YPNSGE+YD  TQ+W   T  D    SW +LV++  
Sbjct: 238 LSVSSQALSHLNEILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRLSWPSLVQEYR 297

Query: 889 ANGVRMVGGCCRTTPDDIHKIAQAV 963
             G R +GGCCRTTP DI +I + V
Sbjct: 298 KFGARAIGGCCRTTPLDIQEICKVV 322

>Smik_12.1 Chr12 complement(885..1859) [975 bp, 324 aa] {ON} YLL062C
           (REAL)
          Length = 324

 Score =  319 bits (817), Expect = e-108
 Identities = 149/315 (47%), Positives = 215/315 (68%), Gaps = 1/315 (0%)
 Frame = +1

Query: 34  HPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISIVKDMFQAFVA 213
           HP  V+V+DGGQGTELE RG++++S VWS  PF+   FW+K  + + +  V++M++ F+ 
Sbjct: 13  HPQKVLVLDGGQGTELENRGININSPVWSAAPFVSDSFWEKSSRERKV--VEEMYRDFMN 70

Query: 214 AGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKYLIGSIGPYAS 393
           AG+  LM+ITYQ +F +IS NT I+ L  Y   L++IV F R  IG  +YLIGSIGP+A+
Sbjct: 71  AGANVLMTITYQANFKSISKNTTIKTLPAYRRFLDQIVCFSRRLIGEERYLIGSIGPWAA 130

Query: 394 HVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYELKALLSWDGTT 573
           HVS+EYTG+YG HPE++DY  +F+PQ               ET+PN +ELKA+LSW    
Sbjct: 131 HVSSEYTGNYGPHPEDIDYYEFFRPQLDTFNENEDIDLIGFETIPNFHELKAILSWGEDI 190

Query: 574 IKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVSYDKTLMIIKK 750
           I +PFY+ LSV D+G LRDGT+++ IS   +    K N N +++GVNC+S++++ +I+K 
Sbjct: 191 ISRPFYVGLSVHDNGLLRDGTTLEEISAHIKGLGSKINKNFLLLGVNCISFNQSTLILKA 250

Query: 751 LQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGVRMVGGCCRTT 930
           L   +PD PL+ YPNSGE+YD   ++W    D KLDSW+  V+  + +G R++GGCCRT+
Sbjct: 251 LHEVLPDFPLLVYPNSGEIYDPKEKTWYHPTD-KLDSWDVTVRKFIDSGARIIGGCCRTS 309

Query: 931 PDDIHKIAQAVSHLS 975
           P DI +IA +V   S
Sbjct: 310 PKDIAEIAASVDTYS 324

>Skud_12.4 Chr12 complement(4676..5653) [978 bp, 325 aa] {ON}
           YLL062C (REAL)
          Length = 325

 Score =  318 bits (816), Expect = e-108
 Identities = 152/321 (47%), Positives = 218/321 (67%), Gaps = 1/321 (0%)
 Frame = +1

Query: 4   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISI 183
           R S ++    +P  V+V+DGGQGTELE RG+++   VWS  PF    FW+  + S +  +
Sbjct: 3   RISIEKLILEYPTRVLVLDGGQGTELENRGINIGGPVWSATPFTSDSFWE--QSSHDREV 60

Query: 184 VKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKY 363
           V++M++ F+ AG+  LM+ITYQ +F +IS NT IQ L  YN  L++IV F R  IG  +Y
Sbjct: 61  VEEMYRDFMNAGANVLMTITYQANFKSISENTSIQTLSAYNGFLDRIVSFTRRFIGEERY 120

Query: 364 LIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYEL 543
           L+GSIGP+A+HVS+EYTG+YG HPE++DY N+FKPQ               ETVPN +EL
Sbjct: 121 LVGSIGPWAAHVSSEYTGNYGPHPEDIDYYNFFKPQLDSFNENKDIDLIGFETVPNFHEL 180

Query: 544 KALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVS 720
           KA+LSW    I KPFY+ LSV D+G LRDGT+M+ +S   +    + N +L+++GVNC+S
Sbjct: 181 KAILSWGEDIISKPFYVGLSVHDNGLLRDGTTMEEVSAHIKGLGSRINKHLLLMGVNCIS 240

Query: 721 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV 900
           ++++ +I++ L  ++PD PL+ YPNSGEVYD   ++W    D K +SW+  VK  + +G 
Sbjct: 241 FNRSTLILRTLHESLPDTPLLVYPNSGEVYDVKEKTWHWPTD-KPESWDITVKTFIDSGA 299

Query: 901 RMVGGCCRTTPDDIHKIAQAV 963
           R++GGCCRT+P DI +IA AV
Sbjct: 300 RIIGGCCRTSPKDIAEIATAV 320

>TDEL0E00240 Chr5 complement(38804..39790) [987 bp, 328 aa] {ON} 
          Length = 328

 Score =  314 bits (804), Expect = e-106
 Identities = 146/316 (46%), Positives = 219/316 (69%), Gaps = 1/316 (0%)
 Frame = +1

Query: 31  THPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISIVKDMFQAFV 210
           T    ++V+DGGQGTE+E RG++V++ VWS++PF+   FW  DE S+   IV+++++ F+
Sbjct: 11  TDSRKILVLDGGQGTEMENRGIEVANPVWSSIPFVSESFWT-DEWSKERKIVEEIYKDFM 69

Query: 211 AAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKYLIGSIGPYA 390
           ++GS  LM++TYQ SF  I+ NT++Q L EYN LL++IV F R CIG+ +YL+GS+GP+A
Sbjct: 70  SSGSDMLMTVTYQASFKAIAENTELQTLSEYNSLLDRIVAFSRRCIGDERYLVGSVGPWA 129

Query: 391 SHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYELKALLSWDGT 570
           ++ ++EYTGDYGLH +++DY  Y+KPQ              +ETVPN +ELKA+LSWD  
Sbjct: 130 AYNASEYTGDYGLHADSIDYYGYYKPQLDNFNKQEEIDMIGIETVPNFHELKAILSWDEK 189

Query: 571 TIKKPFYISLSVGDDGNLRDGTSMDTISTMFQ-NREVKNPNLMMVGVNCVSYDKTLMIIK 747
            I KPFY+SL+  D G LRDGT+M+ I+   +      NPN M++G+NCVS++ +  I++
Sbjct: 190 KIAKPFYVSLTTHDSGVLRDGTAMEDIAQYIKCLGNNLNPNFMLLGINCVSFNDSRDILE 249

Query: 748 KLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGVRMVGGCCRT 927
            L  A+P++ L+ YPNSGEVY+   + W  N   K  SW+++VK  + +G R++GGCCRT
Sbjct: 250 LLHNALPEMLLLAYPNSGEVYEPKKKIWLANK-CKTTSWDSVVKSFINSGARIIGGCCRT 308

Query: 928 TPDDIHKIAQAVSHLS 975
           +P DI  ++ AV   S
Sbjct: 309 SPQDIADVSIAVKKYS 324

>ABL125W Chr2 (161358..162368) [1011 bp, 336 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL273W (SAM4)
          Length = 336

 Score =  313 bits (802), Expect = e-105
 Identities = 147/320 (45%), Positives = 211/320 (65%)
 Frame = +1

Query: 4   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISI 183
           R   ++Y    P  V+VMDGGQGTELE RG+ V+S VWS  PF+    WQ+ + S+  +I
Sbjct: 3   RIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPD-SRERAI 61

Query: 184 VKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKY 363
           V  + + FVAAG++ +M+ITYQ SF+++++NT I  L++YN LL++IV FCRE +G+ KY
Sbjct: 62  VASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDKY 121

Query: 364 LIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYEL 543
           L+GSIG + +HV AE+TGDYG  P+++DYL YFKPQ               ET+PN +EL
Sbjct: 122 LVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHEL 181

Query: 544 KALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVKNPNLMMVGVNCVSY 723
           +A+LSWD + I KPFY++LSV D G LRDGT M  ++ +       NPN + +G+NC S 
Sbjct: 182 RAILSWDESVIAKPFYVALSVHDAGTLRDGTPMADVAAIVAAAAPLNPNFLGLGINCSSL 241

Query: 724 DKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGVR 903
            +T  I+ +L   +P LP+  YPNSGE+YD + + W  +  +    W  +V   + +G R
Sbjct: 242 SRTPAILAELHALLPALPMTIYPNSGEIYDPVKKVWNASPHVV--DWGAVVASYIRSGAR 299

Query: 904 MVGGCCRTTPDDIHKIAQAV 963
           ++GGCCRT P+DI +IA AV
Sbjct: 300 IIGGCCRTIPNDIRQIADAV 319

>KAFR0F04420 Chr6 (867176..868156) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  310 bits (795), Expect = e-104
 Identities = 149/321 (46%), Positives = 214/321 (66%), Gaps = 1/321 (0%)
 Frame = +1

Query: 4   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISI 183
           R   KEY   + + ++V+DGGQGTELE+RG+++SS VWST+PFI   FW  +  S +  I
Sbjct: 3   RVPIKEYLLRNSDKILVLDGGQGTELEKRGINISSPVWSTLPFINESFWS-NSSSNDRKI 61

Query: 184 VKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKY 363
           +KDM+  F++AG+  L + TYQ SF++IS NT IQ L++Y+ELLN+I KF RECIG+SKY
Sbjct: 62  IKDMYSDFISAGADVLSTTTYQTSFASISENTNIQTLKDYHELLNRITKFTRECIGDSKY 121

Query: 364 LIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYEL 543
           L+GSIG YA+++SAEYTGD+G   + +DY  YFKPQ               ET+PN +EL
Sbjct: 122 LVGSIGTYAAYLSAEYTGDFGDAADTIDYHGYFKPQLDNFNRSTEIDIIGFETIPNIHEL 181

Query: 544 KALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNRE-VKNPNLMMVGVNCVS 720
           +A+LS +   + KPFYISLS      LRDGTS+  +  + ++ E   NPNL+++G+NC+ 
Sbjct: 182 RAILSLNKKDLSKPFYISLSTNSKAQLRDGTSLKGVVDVIKSFESTLNPNLILLGINCIG 241

Query: 721 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV 900
            + + + ++ L   +P  PL+ YPNSGE YD + + W  + D    +WE +V   +  G 
Sbjct: 242 LNSSHLTMEYLNNHLPQFPLIVYPNSGEKYDPVRKIWLADEDPAF-TWEYIVHRYLDAGA 300

Query: 901 RMVGGCCRTTPDDIHKIAQAV 963
           R+VGGCCRTTP DI  I++A+
Sbjct: 301 RIVGGCCRTTPSDIRSISEAI 321

>Suva_64.1 Chr64 (76..894) [819 bp, 273 aa] {ON} YPL273W (REAL)
          Length = 273

 Score =  283 bits (724), Expect = 1e-94
 Identities = 135/271 (49%), Positives = 189/271 (69%), Gaps = 1/271 (0%)
 Frame = +1

Query: 4   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISI 183
           R   K+     P  V+V+DGGQGTELE RG+ V++ VWST+PFI   FW  DE S N  I
Sbjct: 3   RIPLKQLLADDPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWS-DESSANRKI 61

Query: 184 VKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKY 363
           VK+MF  F+AAG++ LM+ITYQ SF ++S NT I+ L  Y+ LL +IV F R+CIG  K+
Sbjct: 62  VKEMFNDFLAAGAEILMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKH 121

Query: 364 LIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYEL 543
           LIG IGP+ +HV  E+TG+YG +PE++D+  YFKPQ               ET+PN +EL
Sbjct: 122 LIGCIGPWGAHVCCEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHEL 181

Query: 544 KALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVS 720
           KA+LSWD + + KPFYI LSV + G LRDGT+M+ ++ + ++   K NPN +++G+NCVS
Sbjct: 182 KAILSWDESILSKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVS 241

Query: 721 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYD 813
           ++++  I++ L  A+P++PL+ YPNSGEVYD
Sbjct: 242 FNQSPDILESLHRALPNMPLLAYPNSGEVYD 272

>Suva_16.32 Chr16 (40969..41748) [780 bp, 259 aa] {ON} YPL273W
           (REAL)
          Length = 259

 Score =  259 bits (661), Expect = 3e-85
 Identities = 120/247 (48%), Positives = 176/247 (71%), Gaps = 1/247 (0%)
 Frame = +1

Query: 226 ALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKYLIGSIGPYASHVSA 405
           +LM+ITYQ SF ++S NT I+ L  Y+ LL +IV F R+CIG  K+LIG IGP+ +HV  
Sbjct: 10  SLMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVCC 69

Query: 406 EYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYELKALLSWDGTTIKKP 585
           E+TG+YG +PE++D+  YFKPQ               ET+PN +ELKA+LSWD + + KP
Sbjct: 70  EFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSKP 129

Query: 586 FYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVSYDKTLMIIKKLQIA 762
           FYI LSV + G LRDGT+M+ ++ + ++   K NPN +++G+NCVS++++  I++ L  A
Sbjct: 130 FYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHRA 189

Query: 763 VPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGVRMVGGCCRTTPDDI 942
           +P++PL+ YPNSGEVYD   + W  N+D KL+SW+T+VK  + +G R++GGCCRTTP DI
Sbjct: 190 LPNMPLLAYPNSGEVYDTEKKIWLPNSD-KLNSWDTVVKQYIGSGARIIGGCCRTTPKDI 248

Query: 943 HKIAQAV 963
            +++ AV
Sbjct: 249 QEVSAAV 255

>SAKL0D09306g Chr4 (771565..772545) [981 bp, 326 aa] {ON} similar to
           uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 326

 Score =  249 bits (636), Expect = 1e-80
 Identities = 139/334 (41%), Positives = 204/334 (61%), Gaps = 13/334 (3%)
 Frame = +1

Query: 4   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISI 183
           RQ   EY  +   +++V+DGGQGTE+ERRG+DV   +WST+PFI        +   +++ 
Sbjct: 3   RQPIAEYLES---SILVLDGGQGTEMERRGIDVIHPLWSTLPFI-------KKNPTHLNH 52

Query: 184 VKDMFQAFVAAGSQALMSITYQCSFSTIS--SNTKIQALEEYNELLNKIVKFCR-ECIGN 354
           +K M+  F  +G++AL +ITYQ SF+T+   S+ ++   ++Y + LN I+ F R +CI +
Sbjct: 53  IKGMYHDFSTSGARALSTITYQASFATLKQYSDGQVVTEQQYQQFLNDIIGFTRDQCISD 112

Query: 355 SKYLIGSIGPYASHV--SAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVP 528
           S+YLIG +GPYA+++   AEY+GDYG   E +D+  YFKPQ               ET+P
Sbjct: 113 SQYLIGCVGPYAAYLCNGAEYSGDYG--SEKIDFKQYFKPQLDVFSRDDRIDMVGFETIP 170

Query: 529 NKYELKALLSWDGTTI--KKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVKN-PNLMM 699
           N  ELK LLS D T++   KPFYIS+S   +GNLRDGT +  I    ++ +    PNL+ 
Sbjct: 171 NIEELKTLLSKDFTSMLGTKPFYISISTDSNGNLRDGTPVAKICETIKDADKSTPPNLLF 230

Query: 700 VGVNCVSYDKTLMIIKKLQIAVPD----LPLVCYPNSGEVYDQITQSWKTNNDIKLD-SW 864
           +G+NCV Y  +  I+ +L   + D    L    YPNSGE+YD  T +W TN++I  + +W
Sbjct: 231 LGINCVDYHHSYNILSRLNGGLGDDCSLLFKAVYPNSGEIYDGNTHTWHTNSEIAPELTW 290

Query: 865 ETLVKDLVANGVRMVGGCCRTTPDDIHKIAQAVS 966
             LV        +++GGCCRTTPDDI +IA AV+
Sbjct: 291 NYLVSKFAEQKCQLIGGCCRTTPDDIKQIADAVN 324

>Kwal_0.322 s0 (152442..153440) [999 bp, 332 aa] {ON} YLL062C (MHT1)
           - S-methylmethionine:homocysteine S-methyltransferase
           [contig 86] FULL
          Length = 332

 Score =  233 bits (594), Expect = 4e-74
 Identities = 130/340 (38%), Positives = 208/340 (61%), Gaps = 16/340 (4%)
 Frame = +1

Query: 1   MRQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNIS 180
           MR   +EY     + ++++DGGQGTELE+RG++++  +WST+P++      KD+K  ++ 
Sbjct: 1   MRLQLEEYLK---HEILLLDGGQGTELEKRGINIAHPLWSTLPYV-----TKDKK--HLK 50

Query: 181 IVKDMFQAFVAAGSQALMSITYQCSFSTISSNTK--IQALEEYNELLNKIVKFCR-ECIG 351
           I+K+M+ AF +AG  ALM+ITYQ SF ++ +++   I   +EY   L+ ++ +   +CI 
Sbjct: 51  IIKEMYSAFESAGCNALMTITYQASFLSMKNHSDGLINNEKEYTRFLDYVIDYTENQCIS 110

Query: 352 NSKYLIGSIGPYASHVS--AEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETV 525
            + YL+GS+GPYA+++S  AEY+G Y    +N+D++ +F+PQ              +ET+
Sbjct: 111 PNSYLVGSVGPYAAYLSNGAEYSGHY--IEDNIDFIEFFRPQVQHFAVSSRIDLIGIETI 168

Query: 526 PNKYELKALLSWDGTTI--KKPFYISLSVGDDGNLRDGTS-MDTISTMFQNREVKNPNLM 696
           PN  E KALL  + + +   KP+YIS++  ++GNLRDGT+  D   T+ ++ +   PNL+
Sbjct: 169 PNFEEFKALLRPEFSRLCALKPYYISITTDNEGNLRDGTARQDICETIKRSAQDLPPNLV 228

Query: 697 MVGVNCVSYDKTLMIIKKLQIAVPDLPL-------VCYPNSGEVYDQITQSWKTNNDI-K 852
             G+NCVS+     I+K L  ++ D+ +         YPNSGEVY   T SW  N +I  
Sbjct: 229 FFGINCVSFAHCADILKLLNDSLDDIGVENRLRFRAVYPNSGEVYHGDTHSWGPNPEIGP 288

Query: 853 LDSWETLVKDLVANGVRMVGGCCRTTPDDIHKIAQAVSHL 972
            D+WE L   +V  G  M+GGCCRT+P D+ +IA  VS +
Sbjct: 289 ADTWENLASKVVQQGCLMIGGCCRTSPADLRQIASVVSDI 328

>AFR410W Chr6 (1171334..1172446) [1113 bp, 370 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL273W (SAM4)
          Length = 370

 Score =  214 bits (545), Expect = 2e-66
 Identities = 118/317 (37%), Positives = 185/317 (58%), Gaps = 11/317 (3%)
 Frame = +1

Query: 46  VIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISIVKDMFQAFVAAGSQ 225
           V+VMDGG G ELERRG+DV S +WST PF+  +          +  ++ +++ F AAGS+
Sbjct: 59  VLVMDGGMGVELERRGMDVKSPLWSTAPFLRGD-------RAALDTIRGLYREFRAAGSR 111

Query: 226 ALMSITYQCSF-STISSNTKIQALEEYNELLNKIVKFC-RECIGNSK-YLIGSIGPYASH 396
            + ++TYQ SF S +  +  + +  +Y + L ++V F  REC+  ++ Y+IGS+GPYA+ 
Sbjct: 112 GISTLTYQASFHSMVKYSGSVSSRADYEKFLEQVVDFTYRECVDPARDYIIGSVGPYAAF 171

Query: 397 V--SAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYELKALLSWDGT 570
           +   AEYTGDYG   E +++ NYF+PQ             A ETVPN  EL A+L  +  
Sbjct: 172 LCNGAEYTGDYGF--ETINFFNYFEPQVSKFATDPRIDAIAFETVPNVVELMAMLQPEFH 229

Query: 571 TI--KKPFYISLSVGDDGNLRDGTSMDTISTMFQNR-EVKNPNLMMVGVNCVSYDKTLMI 741
            +   KPFYIS+S  D+  LRDGT +  +  + + R +   PNL+  G+NCV   ++  +
Sbjct: 230 ALLKNKPFYISISAKDEHVLRDGTPLAVVGQLIRERMDDLPPNLLCFGLNCVDLTRSAAM 289

Query: 742 IKKLQIAVPDLPL---VCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGVRMVG 912
           + +L + + D P+     YPN   V+D+   +W+ + D +  +W   VK  +    RM+G
Sbjct: 290 LAELNMQLQDCPIKFQAIYPNGTSVFDESLSAWRPSKDAESLTWAEAVKLYLNQDCRMIG 349

Query: 913 GCCRTTPDDIHKIAQAV 963
           GCC TTP D+ +IA+A+
Sbjct: 350 GCCGTTPQDMRQIAEAL 366

>Skud_101.1 Chr101 complement(3..602) [600 bp, 200 aa] {ON} YPL273W
           (REAL)
          Length = 200

 Score =  206 bits (523), Expect = 3e-65
 Identities = 95/195 (48%), Positives = 135/195 (69%), Gaps = 1/195 (0%)
 Frame = +1

Query: 232 MSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKYLIGSIGPYASHVSAEY 411
           M+ TYQ S+ ++S NT I+ L EYN LL +IV F R+CIG +KYLIG IGP+ +H+  E+
Sbjct: 1   MTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRDCIGENKYLIGCIGPWGAHICREF 60

Query: 412 TGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYELKALLSWDGTTIKKPFY 591
           TGDYG  PE++D+  YFKPQ               ET+PN +EL+A+LSWD + + KPFY
Sbjct: 61  TGDYGPDPESIDFYEYFKPQLDNFNKNDKLDLIGFETIPNVHELRAILSWDESILSKPFY 120

Query: 592 ISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVSYDKTLMIIKKLQIAVP 768
           I LSV + G LRDGT+M+ ++ + +    K NPN  ++G+NCVS++++  I++ L  A+P
Sbjct: 121 IGLSVHEHGVLRDGTTMEEVAKVIKGLGDKINPNFSLLGINCVSFNQSPDILESLHQALP 180

Query: 769 DLPLVCYPNSGEVYD 813
           D+ L+ YPNSGEVYD
Sbjct: 181 DMALLAYPNSGEVYD 195

>KLTH0H12716g Chr8 (1079836..1080882) [1047 bp, 348 aa] {ON} similar
           to uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 348

 Score =  207 bits (526), Expect = 9e-64
 Identities = 124/334 (37%), Positives = 192/334 (57%), Gaps = 16/334 (4%)
 Frame = +1

Query: 1   MRQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNIS 180
           MR+  KE+F    N ++++DGGQGTELE++GV +S  +WST+PFI        +   ++ 
Sbjct: 1   MRKPLKEFFK---NNILLLDGGQGTELEKKGVSISHPLWSTLPFI-------IKNKTHLE 50

Query: 181 IVKDMFQAFVAAGSQALMSITYQCSFSTIS--SNTKIQALEEYNELLNKIVKFC-RECIG 351
            +K+M++ F  AGS ALM+ITYQ SFS++   S   + + E+Y   L+ ++ F  RECI 
Sbjct: 51  AIKEMYRDFAEAGSNALMTITYQASFSSMKKYSEGLVNSEEDYAAFLDYVIGFTDRECIT 110

Query: 352 NSKYLIGSIGPYASHVS--AEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETV 525
             KYL+GS+GPYA  +S  AEY+G YG     +D+++Y+ PQ              +ET+
Sbjct: 111 PDKYLVGSVGPYAGLLSNGAEYSGYYG--EGKIDFIDYYSPQVKHFALSPRIDLIGIETI 168

Query: 526 PNKYELKALLS--WDGTTIKKPFYISLSVGDDGNLRDGTSMDTI-STMFQNREVKNPNLM 696
           PN  E KALLS  +   +  KP+YIS++  ++G LRDGTS++ I   + Q+  +   N +
Sbjct: 169 PNIDEFKALLSPEFSRLSFSKPYYISVTTDNNGCLRDGTSLNEICRAIKQSASLLPDNFV 228

Query: 697 MVGVNCVSYDKTLMIIKKLQIAVPDLPL-------VCYPNSGEVYDQITQSWKTNNDI-K 852
              +NCV +   + I++ L   +    +         YPNSGE+Y   T SW +N     
Sbjct: 229 FFAINCVEFLHCVEILQSLNDCLEMQGVDRRFRFRGAYPNSGEIYHGGTHSWSSNPYAGP 288

Query: 853 LDSWETLVKDLVANGVRMVGGCCRTTPDDIHKIA 954
            D+WE L   L++    M+GGCCRT  ++I ++A
Sbjct: 289 EDTWENLTLGLLSQECLMLGGCCRTGSEEIRQMA 322

>Skud_100.1 Chr100 complement(3..602) [600 bp, 200 aa] {ON} YPL273W
           (REAL)
          Length = 200

 Score =  199 bits (507), Expect = 7e-63
 Identities = 92/195 (47%), Positives = 132/195 (67%), Gaps = 1/195 (0%)
 Frame = +1

Query: 232 MSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKYLIGSIGPYASHVSAEY 411
           M+ TYQ S+ ++S NT I+ L EYN LL +IV F R CIG  KYLIG IGP+ +H+  E+
Sbjct: 1   MTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRVCIGEDKYLIGCIGPWGAHICCEF 60

Query: 412 TGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYELKALLSWDGTTIKKPFY 591
           TGDYG  P+++D+  YFKPQ               ET+PN +EL+A+LSWD + + KPFY
Sbjct: 61  TGDYGPDPQSIDFYKYFKPQLDNFNKSDKLDLIGFETIPNVHELRAILSWDESILSKPFY 120

Query: 592 ISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVSYDKTLMIIKKLQIAVP 768
           I LSV + G LRDGT+M+ ++ + +    K NPN  ++G+NCVS++++  I++ L   +P
Sbjct: 121 IGLSVHEHGVLRDGTTMEEVAKVIKGLGDKINPNFSLLGINCVSFNQSPDILESLHQVLP 180

Query: 769 DLPLVCYPNSGEVYD 813
           ++ L+ YPNSGEVYD
Sbjct: 181 NMALLAYPNSGEVYD 195

>YMR321C Chr13 complement(917579..917896) [318 bp, 105 aa] {ON}
           Putative protein of unknown function; proposed to be a
           palmitoylated membrane protein
          Length = 105

 Score =  107 bits (268), Expect = 2e-28
 Identities = 47/94 (50%), Positives = 72/94 (76%)
 Frame = +1

Query: 682 NPNLMMVGVNCVSYDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDS 861
           NPNL  +G+NCVS++++  I++ L  A+P++ L+ YPNSGEVYD   + W  N+D KL+S
Sbjct: 9   NPNLSFLGINCVSFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSD-KLNS 67

Query: 862 WETLVKDLVANGVRMVGGCCRTTPDDIHKIAQAV 963
           W+T+VK  +++G R++GGCCRT+P DI +I+ AV
Sbjct: 68  WDTVVKQYISSGARIIGGCCRTSPKDIQEISAAV 101

>Skud_47.2 Chr47 (1368..1655) [288 bp, 96 aa] {ON} YPL273W (REAL)
          Length = 96

 Score =  100 bits (250), Expect = 6e-26
 Identities = 48/96 (50%), Positives = 65/96 (67%)
 Frame = +1

Query: 1   MRQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNIS 180
           +R   K+    +P  V+V+DGGQGTELE RG+ V++ VWST+PFI   FW  DE S N  
Sbjct: 2   VRLPLKQLLEDNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFW-SDESSANRK 60

Query: 181 IVKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQ 288
           IVK MF  F+ AG++ LM+ TYQ S+ ++S NT I+
Sbjct: 61  IVKGMFNDFLNAGAEILMTTTYQTSYKSVSENTPIK 96

>KAFR0L00560 Chr12 (102072..105842) [3771 bp, 1256 aa] {ON}
           Anc_7.154 YER008C
          Length = 1256

 Score = 32.7 bits (73), Expect = 1.7
 Identities = 22/84 (26%), Positives = 38/84 (45%), Gaps = 3/84 (3%)
 Frame = +1

Query: 643 DTISTMFQNREVKNPNLMMVGV--NCVSYDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQ 816
           + ++ +F NR V     M   +  +  S D+   I+ +L +    L L C   S E Y  
Sbjct: 722 EKVTELFLNRVVDELGTMFAYIKNDSTSKDQLTSILSRL-LVFSSLVLFCKEASNESYRS 780

Query: 817 ITQSWKTNND-IKLDSWETLVKDL 885
           I + W  N+  I  + W  ++KD+
Sbjct: 781 IIEQWNKNSQLIYTNIWSKILKDM 804

>KAFR0H02320 Chr8 (443614..444762) [1149 bp, 382 aa] {ON} Anc_8.696
           YPL168W
          Length = 382

 Score = 31.2 bits (69), Expect = 4.1
 Identities = 26/82 (31%), Positives = 37/82 (45%), Gaps = 7/82 (8%)
 Frame = +1

Query: 247 QCSFSTISSNTKIQALEEY---NELLNKIVKFCRECIGNSKYLIGSIGPYASHVSAEYTG 417
           Q S STI+      A++      ++ + ++K   E I N   LI  + P  +  S   T 
Sbjct: 98  QASMSTIARKLYTLAVQRRISDEDIYSALLKVLDEDIIN--VLIPKVPPTGTTTSTNKTR 155

Query: 418 ----DYGLHPENVDYLNYFKPQ 471
               D GLHPEN DYL+    Q
Sbjct: 156 KPVFDIGLHPENTDYLDVILEQ 177

>Kwal_23.4373 s23 complement(691827..693134) [1308 bp, 435 aa] {ON}
           YHR176W - 1:1 [contig 1] FULL
          Length = 435

 Score = 30.8 bits (68), Expect = 5.6
 Identities = 11/52 (21%), Positives = 29/52 (55%)
 Frame = +1

Query: 40  NAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISIVKDM 195
           N V+V +G  G+++  +   V+  V+ +VP +G+  W ++     + ++ ++
Sbjct: 187 NVVVVGNGSSGSDIANQVSSVAKHVYHSVPDVGKTQWNENPVVTAVPVISNL 238

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 91,128,244
Number of extensions: 2058485
Number of successful extensions: 5681
Number of sequences better than 10.0: 39
Number of HSP's gapped: 5576
Number of HSP's successfully gapped: 39
Length of query: 327
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 217
Effective length of database: 40,868,139
Effective search space: 8868386163
Effective search space used: 8868386163
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 34 (17.7 bits)