Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0B032608.841ON32632616820.0
NCAS0D049408.841ON3273259451e-127
SAKL0D01452g8.841ON3273219171e-123
KLLA0D01551g8.841ON3313238921e-119
Kwal_27.102558.841ON3293238921e-119
TPHA0G03760singletonON3313218881e-118
YPL273W (SAM4)8.841ON3253218871e-118
KAFR0B00210singletonON3263238871e-118
Suva_13.515na 1ON3253218831e-118
Suva_16.17singletonON3243218791e-117
KLTH0C03850g8.841ON3293238781e-117
YLL062C (MHT1)na 2ON3243258761e-117
Ecym_46128.841ON3263228701e-116
NDAI0F00250singletonON3293268661e-115
TDEL0E05690singletonON3283078611e-114
TPHA0I002608.841ON3233248581e-114
KAFR0L00150singletonON3263278581e-114
KNAG0B06970singletonON3323148551e-113
Kpol_1068.78.841ON3233248531e-113
Smik_12.1na 2ON3243158451e-112
ZYRO0G14212g8.841ON3253258421e-111
Skud_12.4na 2ON3253218411e-111
ABL125W8.841ON3363208361e-111
TDEL0E00240singletonON3283168201e-108
Smik_6.4848.841ON3253218201e-108
KAFR0F04420singletonON3263218191e-108
Suva_64.1singletonON2732717465e-98
Suva_16.328.841ON2592476725e-87
SAKL0D09306gna 3ON3263366561e-83
Kwal_0.322na 3ON3323406064e-76
AFR410WsingletonON3703175695e-70
KLTH0H12716gna 3ON3483355475e-67
Skud_101.1singletonON2001955285e-66
Skud_100.1singletonON2001955112e-63
YMR321Cna 1ON105942691e-28
Skud_47.2singletonON96962593e-27
KAFR0L005607.154ON125684685.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0B03260
         (326 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0B03260 Chr2 (760392..761372) [981 bp, 326 aa] {ON} Anc_8.84...   652   0.0  
NCAS0D04940 Chr4 (948608..949591) [984 bp, 327 aa] {ON}               368   e-127
SAKL0D01452g Chr4 complement(115954..116937) [984 bp, 327 aa] {O...   357   e-123
KLLA0D01551g Chr4 complement(137965..138960) [996 bp, 331 aa] {O...   348   e-119
Kwal_27.10255 s27 complement(264291..265280) [990 bp, 329 aa] {O...   348   e-119
TPHA0G03760 Chr7 complement(795934..796929) [996 bp, 331 aa] {ON}     346   e-118
YPL273W Chr16 (25087..26064) [978 bp, 325 aa] {ON}  SAM4S-adenos...   346   e-118
KAFR0B00210 Chr2 complement(50980..51960) [981 bp, 326 aa] {ON}       346   e-118
Suva_13.515 Chr13 complement(901226..902203) [978 bp, 325 aa] {O...   344   e-118
Suva_16.17 Chr16 complement(15787..16761) [975 bp, 324 aa] {ON} ...   343   e-117
KLTH0C03850g Chr3 complement(336417..337406) [990 bp, 329 aa] {O...   342   e-117
YLL062C Chr12 complement(16639..17613) [975 bp, 324 aa] {ON}  MH...   342   e-117
Ecym_4612 Chr4 (1193587..1194567) [981 bp, 326 aa] {ON} similar ...   339   e-116
NDAI0F00250 Chr6 complement(47567..48556) [990 bp, 329 aa] {ON}       338   e-115
TDEL0E05690 Chr5 complement(1057559..1058545) [987 bp, 328 aa] {...   336   e-114
TPHA0I00260 Chr9 (49179..50150) [972 bp, 323 aa] {ON} Anc_8.841 ...   335   e-114
KAFR0L00150 Chr12 complement(16662..17642) [981 bp, 326 aa] {ON}      335   e-114
KNAG0B06970 Chr2 (1387382..1388380) [999 bp, 332 aa] {ON}             333   e-113
Kpol_1068.7 s1068 complement(11996..12967) [972 bp, 323 aa] {ON}...   333   e-113
Smik_12.1 Chr12 complement(885..1859) [975 bp, 324 aa] {ON} YLL0...   330   e-112
ZYRO0G14212g Chr7 (1133202..1134179) [978 bp, 325 aa] {ON} simil...   328   e-111
Skud_12.4 Chr12 complement(4676..5653) [978 bp, 325 aa] {ON} YLL...   328   e-111
ABL125W Chr2 (161358..162368) [1011 bp, 336 aa] {ON} Non-synteni...   326   e-111
TDEL0E00240 Chr5 complement(38804..39790) [987 bp, 328 aa] {ON}       320   e-108
Smik_6.484 Chr6 (800680..801657) [978 bp, 325 aa] {ON} YPL273W (...   320   e-108
KAFR0F04420 Chr6 (867176..868156) [981 bp, 326 aa] {ON}               320   e-108
Suva_64.1 Chr64 (76..894) [819 bp, 273 aa] {ON} YPL273W (REAL)        291   5e-98
Suva_16.32 Chr16 (40969..41748) [780 bp, 259 aa] {ON} YPL273W (R...   263   5e-87
SAKL0D09306g Chr4 (771565..772545) [981 bp, 326 aa] {ON} similar...   257   1e-83
Kwal_0.322 s0 (152442..153440) [999 bp, 332 aa] {ON} YLL062C (MH...   238   4e-76
AFR410W Chr6 (1171334..1172446) [1113 bp, 370 aa] {ON} Non-synte...   223   5e-70
KLTH0H12716g Chr8 (1079836..1080882) [1047 bp, 348 aa] {ON} simi...   215   5e-67
Skud_101.1 Chr101 complement(3..602) [600 bp, 200 aa] {ON} YPL27...   207   5e-66
Skud_100.1 Chr100 complement(3..602) [600 bp, 200 aa] {ON} YPL27...   201   2e-63
YMR321C Chr13 complement(917579..917896) [318 bp, 105 aa] {ON} P...   108   1e-28
Skud_47.2 Chr47 (1368..1655) [288 bp, 96 aa] {ON} YPL273W (REAL)      104   3e-27
KAFR0L00560 Chr12 (102072..105842) [3771 bp, 1256 aa] {ON} Anc_7...    31   5.4  

>TBLA0B03260 Chr2 (760392..761372) [981 bp, 326 aa] {ON} Anc_8.841
           YPL273W
          Length = 326

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/326 (96%), Positives = 313/326 (96%)

Query: 1   MRQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNIS 60
           MRQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNIS
Sbjct: 1   MRQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNIS 60

Query: 61  IVKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSK 120
           IVKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSK
Sbjct: 61  IVKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSK 120

Query: 121 YLIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYE 180
           YLIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQ             AMETVPNKYE
Sbjct: 121 YLIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQLDNFNDNDDIDLIAMETVPNKYE 180

Query: 181 LKALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVKNPNLMMVGVNCVS 240
           LKALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVKNPNLMMVGVNCVS
Sbjct: 181 LKALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVKNPNLMMVGVNCVS 240

Query: 241 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV 300
           YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV
Sbjct: 241 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV 300

Query: 301 RMVGGCCRTTPDDIHKIAQAVSHLSH 326
           RMVGGCCRTTPDDIHKIAQAVSHLSH
Sbjct: 301 RMVGGCCRTTPDDIHKIAQAVSHLSH 326

>NCAS0D04940 Chr4 (948608..949591) [984 bp, 327 aa] {ON} 
          Length = 327

 Score =  368 bits (945), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 169/325 (52%), Positives = 229/325 (70%), Gaps = 2/325 (0%)

Query: 2   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISI 61
           RQS KEY   +P+ V+V+DGGQGTELE RG++V++ VWST+PF+   FW  D+ S +  I
Sbjct: 3   RQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFWS-DKSSNDRQI 61

Query: 62  VKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKY 121
           VK+MF+ F+AAG++ LM+ TYQ SF ++S NT I+ L+EYNELLN+IV F R+CIG  KY
Sbjct: 62  VKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQKY 121

Query: 122 LIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYEL 181
           LIG IGP+ +HV AE+ GDYG HPEN+DY  YFKPQ               ETVPN  EL
Sbjct: 122 LIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNEL 181

Query: 182 KALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVS 240
           KA+LSWD   + KPFYI LSV ++G LRDGT+M+ I  +F++   K NPNL+++G+NCVS
Sbjct: 182 KAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCVS 241

Query: 241 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV 300
           ++ +  I++ +   +PD+PL+ YPNSGEVYD + + W   N     +WE +VK  +  G 
Sbjct: 242 FNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVKRYIEAGA 301

Query: 301 RMVGGCCRTTPDDIHKIAQAVSHLS 325
           R++GGCCRTTP DI +I++AV   S
Sbjct: 302 RIIGGCCRTTPKDILEISKAVKKFS 326

>SAKL0D01452g Chr4 complement(115954..116937) [984 bp, 327 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 327

 Score =  357 bits (917), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 160/321 (49%), Positives = 226/321 (70%), Gaps = 3/321 (0%)

Query: 2   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISI 61
           RQ  K++F  HP+ ++VMDGGQGTELE RG+ V++ VWST+PFI   FW  +E S++  I
Sbjct: 3   RQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWS-NESSRDRQI 61

Query: 62  VKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKY 121
           VK+MF  F+  GS+ LM+ TYQ SF ++S NT I+ L+EYN+LL +IV F RECIG  KY
Sbjct: 62  VKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDKY 121

Query: 122 LIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYEL 181
           LIG IG + +HV  E+TGDYG +PE +D+L YF+PQ               ET+PN +EL
Sbjct: 122 LIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHEL 181

Query: 182 KALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVS 240
           KA+LSWD + I KPFYI LSV ++G LRDGT+M  ++ + ++   K NPNLM++G+NCVS
Sbjct: 182 KAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCVS 241

Query: 241 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV 300
           ++ + +I+  L   +PD+P++ YPNSGE+YD + + W  N + K+ +W+ +VK  + NG 
Sbjct: 242 FNHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWLHNENQKV-TWDDVVKSYIENGA 300

Query: 301 RMVGGCCRTTPDDIHKIAQAV 321
           R++GGCCRT+P DI  I QA+
Sbjct: 301 RIIGGCCRTSPQDIKDIVQAI 321

>KLLA0D01551g Chr4 complement(137965..138960) [996 bp, 331 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase,
          Length = 331

 Score =  348 bits (892), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 161/323 (49%), Positives = 222/323 (68%), Gaps = 3/323 (0%)

Query: 1   MRQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNIS 60
           MR   K+YF  +P+ V+VMDGGQGTELE RG++V++ VWSTVPFI   FW  D     I 
Sbjct: 1   MRVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDASKDRI- 59

Query: 61  IVKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSK 120
           IVK MF+ F+ AG+  LM+ITYQ SF ++S NT I+ LEEYN LL++IV F R CIG  +
Sbjct: 60  IVKQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDR 119

Query: 121 YLIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYE 180
           YLIG IG + +HV +E+TGDYG HP+ +DY  YF+PQ               ET+PN +E
Sbjct: 120 YLIGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHE 179

Query: 181 LKALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCV 239
           L+A+LSWD T + KPFYI LSV + G LRDGTSM  I+ +  +   K N NLM +G+NC 
Sbjct: 180 LRAILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCC 239

Query: 240 SYDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANG 299
           +++++ MI++ L  + P++PL+ YPNSGE+YD + + W  N + +L +W+ +VK  + NG
Sbjct: 240 AFNQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWLKNEN-QLCTWDDVVKSYIENG 298

Query: 300 VRMVGGCCRTTPDDIHKIAQAVS 322
            R++GGCCRTT DDI ++  AV+
Sbjct: 299 ARIIGGCCRTTVDDIKEVRLAVN 321

>Kwal_27.10255 s27 complement(264291..265280) [990 bp, 329 aa] {ON}
           YPL273W (SAM4) - S-adenosylmethionine:homocysteine
           S-methyltransferase [contig 37] FULL
          Length = 329

 Score =  348 bits (892), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 156/323 (48%), Positives = 226/323 (69%), Gaps = 3/323 (0%)

Query: 1   MRQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQ-KDEKSQNI 59
           +R S KE+   +P  V+V+DGGQGTELE RG+ V++ VWST+PFI   FW  +D+ S++ 
Sbjct: 2   VRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKDR 61

Query: 60  SIVKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNS 119
            IVK+M+  F+ AG++ LM++TYQ SF ++S NT+I+ LEEY+ LLN+IV F RECIG+ 
Sbjct: 62  QIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGDD 121

Query: 120 KYLIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKY 179
           K+L+G IG + +H  +E+TGDYG  PE +D+L YFKPQ               ET+PN +
Sbjct: 122 KFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNIH 181

Query: 180 ELKALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQN-REVKNPNLMMVGVNC 238
           EL+A+LSWD + I KPFYI LSV ++G LRDGT+M  ++ + ++  +  NPN  ++G+NC
Sbjct: 182 ELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGINC 241

Query: 239 VSYDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVAN 298
           VSY+++  I++ L   +P++PL+ YPNSGEVYD + + W   N   L SWE +VK  + +
Sbjct: 242 VSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQTL-SWEQIVKSYIDS 300

Query: 299 GVRMVGGCCRTTPDDIHKIAQAV 321
           G R++GGCCRT+P DI  I +AV
Sbjct: 301 GARIIGGCCRTSPKDIEAIHEAV 323

>TPHA0G03760 Chr7 complement(795934..796929) [996 bp, 331 aa] {ON} 
          Length = 331

 Score =  346 bits (888), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 161/321 (50%), Positives = 219/321 (68%), Gaps = 3/321 (0%)

Query: 2   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISI 61
           RQ  K Y   +PN V+VMDGGQGTELE RG+ V++ VWST+PFI   FW  D+ S++  I
Sbjct: 3   RQCIKNYLQENPNKVLVMDGGQGTELENRGIKVANPVWSTIPFISESFWS-DQSSEDRKI 61

Query: 62  VKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKY 121
           VK+MF  F+ AG++ LM+ TYQ SF ++S NT I+  + YNELLN+I+ F R+CIG  +Y
Sbjct: 62  VKEMFNDFINAGAEILMTTTYQTSFKSVSENTPIKNTKHYNELLNRIIDFSRDCIGEERY 121

Query: 122 LIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYEL 181
           LIG IG + +H+ AE+ GDYG HPEN+D+  YFKPQ               ETVPN +EL
Sbjct: 122 LIGCIGSWGAHICAEFHGDYGEHPENIDFYEYFKPQLDNFFNNNKLDLIGFETVPNIHEL 181

Query: 182 KALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQN-REVKNPNLMMVGVNCVS 240
           KA+LSWD   + KPFYI LSV ++G LRDGTSM  ++ + +   E  NPNL ++G+NCVS
Sbjct: 182 KAILSWDEKILSKPFYIGLSVHENGLLRDGTSMQEVANLIKGFGEKLNPNLTLLGINCVS 241

Query: 241 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV 300
           Y+ +  IIK +   +P+LPL+ YPNSGE+YD   + W  N +  + +W+ +VK  +  GV
Sbjct: 242 YNHSNDIIKSIHKELPNLPLIAYPNSGEIYDTTKKIWLPNKN-PIFTWDDIVKGYIEAGV 300

Query: 301 RMVGGCCRTTPDDIHKIAQAV 321
           R++GGCCRTTP+DI  +  AV
Sbjct: 301 RIIGGCCRTTPNDIKAVTIAV 321

>YPL273W Chr16 (25087..26064) [978 bp, 325 aa] {ON}
           SAM4S-adenosylmethionine-homocysteine methyltransferase,
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 325

 Score =  346 bits (887), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 160/321 (49%), Positives = 223/321 (69%), Gaps = 3/321 (0%)

Query: 2   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISI 61
           R   K++   +P  V+V+DGGQGTELE RG+ V++ VWST+PFI   FW  DE S N  I
Sbjct: 3   RLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWS-DESSANRKI 61

Query: 62  VKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKY 121
           VK+MF  F+ AG++ LM+ TYQ S+ ++S NT I+ L EYN LLN+IV F R CIG  KY
Sbjct: 62  VKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDKY 121

Query: 122 LIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYEL 181
           LIG IGP+ +H+  E+TGDYG  PEN+D+  YFKPQ               ET+PN +EL
Sbjct: 122 LIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHEL 181

Query: 182 KALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVS 240
           KA+LSWD + + +PFYI LSV + G LRDGT+M+ I+ + ++   K NPN   +G+NCVS
Sbjct: 182 KAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCVS 241

Query: 241 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV 300
           ++++  I++ L  A+P++ L+ YPNSGEVYD   + W  N+D KL+SW+T+VK  +++G 
Sbjct: 242 FNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSD-KLNSWDTVVKQYISSGA 300

Query: 301 RMVGGCCRTTPDDIHKIAQAV 321
           R++GGCCRT+P DI +I+ AV
Sbjct: 301 RIIGGCCRTSPKDIQEISAAV 321

>KAFR0B00210 Chr2 complement(50980..51960) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  346 bits (887), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 163/323 (50%), Positives = 220/323 (68%), Gaps = 7/323 (2%)

Query: 2   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISI 61
           RQ  KEY   +P  V+V+DGGQGTELE RG+ V++ VWST+PFI   FW  +  S++  I
Sbjct: 3   RQPIKEYLEENPKKVLVLDGGQGTELENRGIHVANPVWSTIPFISESFWS-NASSKDREI 61

Query: 62  VKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKY 121
           VK MFQ F+ AG+  LM+ITYQ SF +++ NT I+ L+EYNELL +IV F R CIG+ KY
Sbjct: 62  VKGMFQDFLDAGADILMTITYQTSFKSVTENTPIKTLKEYNELLERIVSFSRSCIGDEKY 121

Query: 122 LIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYEL 181
           LIG IGP+ +HV AE+ GDYG HPEN+DY  YFKPQ               ETVPN +EL
Sbjct: 122 LIGCIGPWGAHVCAEFNGDYGGHPENIDYYAYFKPQLDNFFQNKDLDLIGFETVPNFHEL 181

Query: 182 KALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVS 240
           KA+LSWD T + KPFYI LSV ++G LRDGT+M+ I    ++   K NPN +++G+NCVS
Sbjct: 182 KAILSWDDTILSKPFYIGLSVHENGVLRDGTTMNEIGYYIKSLGSKINPNFLLLGINCVS 241

Query: 241 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNN--DIKLDSWETLVKDLVAN 298
           +  +  I++ +   +PD+PL+ YPNSGE+YD + + W  N+  DI   +W  +V   +  
Sbjct: 242 FSDSPDILESIHKELPDMPLIAYPNSGEIYDTVKKIWLPNHYSDI---TWNDVVNRYIKA 298

Query: 299 GVRMVGGCCRTTPDDIHKIAQAV 321
           G R++GGCCRT PDDI +++ AV
Sbjct: 299 GARIIGGCCRTMPDDIEQVSAAV 321

>Suva_13.515 Chr13 complement(901226..902203) [978 bp, 325 aa] {ON}
           YPL273W (REAL)
          Length = 325

 Score =  344 bits (883), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 159/321 (49%), Positives = 225/321 (70%), Gaps = 3/321 (0%)

Query: 2   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISI 61
           R   K+     P  V+V+DGGQGTELE RG+ V++ VWST+PFI   FW  DE S N  I
Sbjct: 3   RIPLKQLLADDPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWS-DESSANRKI 61

Query: 62  VKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKY 121
           VK+MF  F+AAG++ LM+ITYQ SF ++S NT I+ L  Y+ LL +IV F R+CIG  K+
Sbjct: 62  VKEMFNDFLAAGAEILMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKH 121

Query: 122 LIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYEL 181
           LIG IGP+ +HV  E+TG+YG +PE++D+  YFKPQ               ET+PN +EL
Sbjct: 122 LIGCIGPWGAHVCCEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHEL 181

Query: 182 KALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVS 240
           KA+LSWD + + KPFYI LSV + G LRDGT+M+ ++ + ++   K NPN +++G+NCVS
Sbjct: 182 KAILSWDESILSKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVS 241

Query: 241 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV 300
           ++++  I++ L  A+P++PL+ YPNSGEVYD   + W  N+D KL+SW+T+VK  + +G 
Sbjct: 242 FNQSPDILESLHRALPNMPLLAYPNSGEVYDTEKKIWMPNSD-KLNSWDTVVKQYIGSGA 300

Query: 301 RMVGGCCRTTPDDIHKIAQAV 321
           R++GGCCRTTP DI +++ AV
Sbjct: 301 RIIGGCCRTTPKDIQEVSAAV 321

>Suva_16.17 Chr16 complement(15787..16761) [975 bp, 324 aa] {ON}
           YLL062C (REAL)
          Length = 324

 Score =  343 bits (879), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 157/321 (48%), Positives = 224/321 (69%), Gaps = 4/321 (1%)

Query: 2   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISI 61
           R + ++    HP  V+V+DGGQGTELE RG+D++S VWS  PFI   FW+    S + ++
Sbjct: 3   RIAIEKLILEHPQKVLVLDGGQGTELENRGIDINSPVWSAAPFISDSFWES--TSSDRTL 60

Query: 62  VKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKY 121
           V++M++ F+ AG+  LM++TYQ +FS+IS NT I+ L +YN  L+++V F R  IG  +Y
Sbjct: 61  VEEMYRDFMDAGANVLMTVTYQANFSSISENTSIKTLSDYNRFLDRVVSFTRRVIGEDRY 120

Query: 122 LIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYEL 181
           LIGSIGP+A+HVS+EYTGDYG HPE++DYL +FK Q               ETVPN +EL
Sbjct: 121 LIGSIGPWAAHVSSEYTGDYGSHPEDIDYLQHFKAQLDNFNKHTEIDLIGFETVPNFHEL 180

Query: 182 KALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVS 240
           KA+LSWD   I KPFY+ LSV D+G LRDGT+M+ I+   ++   K N + +++GVNC+S
Sbjct: 181 KAILSWDENIISKPFYVGLSVHDNGLLRDGTTMEEIAAYVKSLGRKINRHFLLLGVNCIS 240

Query: 241 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV 300
           ++++  I+K L  A+PD+PL+ YPNSGEVYD  T++W      K +SWE +V++ + NG 
Sbjct: 241 FNQSTSILKSLHQALPDMPLLAYPNSGEVYDTKTKTWHQAKG-KQNSWEVVVEEFIDNGA 299

Query: 301 RMVGGCCRTTPDDIHKIAQAV 321
           R++GGCCRT+  DI +IA AV
Sbjct: 300 RIIGGCCRTSAKDISEIASAV 320

>KLTH0C03850g Chr3 complement(336417..337406) [990 bp, 329 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 329

 Score =  342 bits (878), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 157/323 (48%), Positives = 222/323 (68%), Gaps = 3/323 (0%)

Query: 2   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFW-QKDEKSQNIS 60
           R S KEY  ++P  V+V+DGGQGTELE RG+ V++ VWST+PFI   FW   D  S++  
Sbjct: 3   RPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKDRQ 62

Query: 61  IVKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSK 120
           IVK+M++ F+ AG++ LM++TYQ SF ++S NT I  LEEY+ LL++IV F R CIG+ K
Sbjct: 63  IVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGDDK 122

Query: 121 YLIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYE 180
           +L+G IGP+ +H  +E+TGDYG  PE +DYL YFKPQ               ET+PN +E
Sbjct: 123 WLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNIHE 182

Query: 181 LKALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCV 239
           L+A+LSWD T + KPFYI LSV + G LRDGT+M  ++ + ++   K NPN +++G+NCV
Sbjct: 183 LRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGINCV 242

Query: 240 SYDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANG 299
           SY+ +  I++ L   +P+LPL+ YPNSGEVYD + + W    D  L +W+ +VK  + +G
Sbjct: 243 SYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDHTL-TWDQVVKSYIDSG 301

Query: 300 VRMVGGCCRTTPDDIHKIAQAVS 322
            R++GGCCRT+P DI  I  AV+
Sbjct: 302 ARIIGGCCRTSPKDIAAINAAVN 324

>YLL062C Chr12 complement(16639..17613) [975 bp, 324 aa] {ON}
           MHT1S-methylmethionine-homocysteine methyltransferase,
           functions along with Sam4p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 324

 Score =  342 bits (876), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 163/325 (50%), Positives = 217/325 (66%), Gaps = 4/325 (1%)

Query: 2   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISI 61
           R   KE    HP  V+++DGGQGTELE RG++++S VWS  PF    FW+    SQ   +
Sbjct: 3   RIPIKELIVEHPGKVLILDGGQGTELENRGININSPVWSAAPFTSESFWEP--SSQERKV 60

Query: 62  VKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKY 121
           V++M++ F+ AG+  LM+ITYQ +F +IS NT I+ L  Y   L+KIV F RE IG  +Y
Sbjct: 61  VEEMYRDFMIAGANILMTITYQANFQSISENTSIKTLAAYKRFLDKIVSFTREFIGEERY 120

Query: 122 LIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYEL 181
           LIGSIGP+A+HVS EYTGDYG HPEN+DY  +FKPQ               ET+PN +EL
Sbjct: 121 LIGSIGPWAAHVSCEYTGDYGPHPENIDYYGFFKPQLENFNQNRDIDLIGFETIPNFHEL 180

Query: 182 KALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVS 240
           KA+LSWD   I KPFYI LSV D+  LRDGT+++ IS   +    K N NL+++GVNCVS
Sbjct: 181 KAILSWDEDIISKPFYIGLSVDDNSLLRDGTTLEEISVHIKGLGNKINKNLLLMGVNCVS 240

Query: 241 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV 300
           ++++ +I+K L   +P +PL+ YPNSGE+Y+   ++W    + KLD WET VK  V NG 
Sbjct: 241 FNQSALILKMLHEHLPGMPLLVYPNSGEIYNPKEKTWHRPTN-KLDDWETTVKKFVDNGA 299

Query: 301 RMVGGCCRTTPDDIHKIAQAVSHLS 325
           R++GGCCRT+P DI +IA AV   S
Sbjct: 300 RIIGGCCRTSPKDIAEIASAVDKYS 324

>Ecym_4612 Chr4 (1193587..1194567) [981 bp, 326 aa] {ON} similar to
           Ashbya gossypii ABL125W
          Length = 326

 Score =  339 bits (870), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 152/322 (47%), Positives = 223/322 (69%), Gaps = 3/322 (0%)

Query: 1   MRQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNIS 60
           +R S K+   ++P+ +++MDGGQGTELE RG++V++ VWST+PFI   FW  D  S++  
Sbjct: 2   VRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINDSFW-SDRSSRDRQ 60

Query: 61  IVKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSK 120
           IV  MF+ ++AAG+  LM+ITYQ SF ++S NT I+ LEEYN+LL++IV F R CIG   
Sbjct: 61  IVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADN 120

Query: 121 YLIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYE 180
           YL+G IG + +H+ AE++GDYG HPE + YL+YF+PQ               ET+PN +E
Sbjct: 121 YLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHE 180

Query: 181 LKALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCV 239
           L A+LSWD + IKKPFYI +SV + G LRDGT+M  ++ +F++   K NPN + +G+NC 
Sbjct: 181 LTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCC 240

Query: 240 SYDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANG 299
           S+  + MI++ L   +P +PL+ YPNSGE+YD + + W  N +  + +W+ +VK  + +G
Sbjct: 241 SFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWLKNENC-IVTWDEIVKSYLQSG 299

Query: 300 VRMVGGCCRTTPDDIHKIAQAV 321
            R++GGCCRTTP+DI +I  AV
Sbjct: 300 ARIIGGCCRTTPNDIRQIVTAV 321

>NDAI0F00250 Chr6 complement(47567..48556) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  338 bits (866), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 155/326 (47%), Positives = 221/326 (67%), Gaps = 2/326 (0%)

Query: 2   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISI 61
           RQ  K+Y + +P  ++++DGGQGTELE RG++V++ VWST+PF+   FW   + S++  I
Sbjct: 3   RQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSG-QSSKDREI 61

Query: 62  VKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKY 121
           VK MF  F+ AG++ LM+ TYQ SF ++S NT I+ L+EY+ELL +IV F R+CIG +KY
Sbjct: 62  VKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENKY 121

Query: 122 LIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYEL 181
           LIG IGP+ +H+ +E+TG+YG HPE +DY  YFKPQ               ET+PN YEL
Sbjct: 122 LIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYEL 181

Query: 182 KALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVS 240
           K +LSW    + KPFYI LSV ++G LRDGT+M  ++ +  +   K NPNL+++G+NCVS
Sbjct: 182 KTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCVS 241

Query: 241 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV 300
              +  I+  +   +PDLPL+ YPNSGEVYD + + W   ND    SW+ +V+  +  G 
Sbjct: 242 LAHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETYMSWDEVVERYLKAGA 301

Query: 301 RMVGGCCRTTPDDIHKIAQAVSHLSH 326
           R++GGCCRTTP+DI +I+ AV   S+
Sbjct: 302 RIIGGCCRTTPNDIKQISDAVHKYSN 327

>TDEL0E05690 Chr5 complement(1057559..1058545) [987 bp, 328 aa] {ON}
           
          Length = 328

 Score =  336 bits (861), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 156/307 (50%), Positives = 217/307 (70%), Gaps = 3/307 (0%)

Query: 16  VIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISIVKDMFQAFVAAGSQ 75
           ++V+DGGQGTELE RG++V++ VWST+PF+   FW  D  S+   IV+ +F  F  +GS 
Sbjct: 16  ILVLDGGQGTELENRGIEVANPVWSTIPFLSESFWT-DSSSKERKIVESVFDDFKKSGSN 74

Query: 76  ALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKYLIGSIGPYASHVSA 135
            LM+ITYQ SF++I  NT+ + L EYN LL++IVKF R CIG+ +YLIGS+GP+ +HV  
Sbjct: 75  ILMTITYQTSFTSIVENTQFKTLAEYNTLLDRIVKFSRSCIGDERYLIGSVGPWGAHVCC 134

Query: 136 EYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYELKALLSWDGTTIKKP 195
           E+TG+YGLHPE++DY  YFKPQ               ETVPN +ELKA+LSWD T I KP
Sbjct: 135 EFTGNYGLHPESIDYYEYFKPQLDNFNGQDEIDLIGFETVPNFHELKAILSWDETKIAKP 194

Query: 196 FYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVSYDKTLMIIKKLQIA 254
           FYI LSV ++G LRDGT+M+ I    +    K + N +++GVNCVS++ +  ++K +  A
Sbjct: 195 FYIGLSVHNNGVLRDGTTMEEIGEYIKGLGEKISSNFLLLGVNCVSFNDSSDMVKSIHKA 254

Query: 255 VPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGVRMVGGCCRTTPDDI 314
           +PD+PL+ YPNSGEVYD   + W  N D KLDSW+++V+  + NG R++GGCCRT+P DI
Sbjct: 255 LPDMPLLAYPNSGEVYDTEKKIWFDNKD-KLDSWDSVVRSYIDNGARIIGGCCRTSPRDI 313

Query: 315 HKIAQAV 321
            +++ AV
Sbjct: 314 AEVSAAV 320

>TPHA0I00260 Chr9 (49179..50150) [972 bp, 323 aa] {ON} Anc_8.841
           YPL273W
          Length = 323

 Score =  335 bits (858), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 151/324 (46%), Positives = 219/324 (67%), Gaps = 1/324 (0%)

Query: 1   MRQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNIS 60
           MR  F+++ + HPN ++V+DGGQGTELE RGV+++S +WST+ F+  +FW ++ ++    
Sbjct: 1   MRVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENTERK 60

Query: 61  IVKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSK 120
            +++MF  F  AG+    ++TYQ SFS++S NT I++L+EY+ELL KI  FCR CI +  
Sbjct: 61  CIREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDD 120

Query: 121 YLIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYE 180
           YL+G IG YA+ + AEY G+YGL    +DYL YFKPQ               ET+PNK+E
Sbjct: 121 YLLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHE 180

Query: 181 LKALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVKNPNLMMVGVNCVS 240
           L+A+LSWD   I +PF+I+LS+ D   LRDGTS + +  +F   + +N NL+ VG NC+S
Sbjct: 181 LEAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGRNKNLVYVGGNCIS 240

Query: 241 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV 300
           Y  ++  I+KL   VP L L+ YPNSGE+YDQ ++ W + + IK+ SWE +V +    GV
Sbjct: 241 YAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKI-SWEEVVNEYADAGV 299

Query: 301 RMVGGCCRTTPDDIHKIAQAVSHL 324
           +++GGCCRTTPDDI +I +AV  L
Sbjct: 300 KIIGGCCRTTPDDIKQIKKAVDAL 323

>KAFR0L00150 Chr12 complement(16662..17642) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  335 bits (858), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 162/327 (49%), Positives = 217/327 (66%), Gaps = 3/327 (0%)

Query: 1   MRQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNIS 60
           +R   K+Y   +P  V+V DGGQG ELERRG+D+  ++WST PF+ + FW  D  S +I 
Sbjct: 2   VRVPLKKYLKENPEKVLVSDGGQGLELERRGLDIKHRLWSTRPFLSKSFWS-DPSSNDIR 60

Query: 61  IVKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSK 120
           IVK MF+ FV AG++ LM+ TYQ SF  +S +T++++L EYNELL+KIV F R CIG+++
Sbjct: 61  IVKGMFEDFVNAGAEILMTTTYQTSFKAVSESTELKSLREYNELLDKIVGFTRACIGDNR 120

Query: 121 YLIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYE 180
           YLIGSIG Y + V  EY+GDYG  PE VD+ +YFKPQ               ET+ N  E
Sbjct: 121 YLIGSIGSYGALVGGEYSGDYGDSPETVDFYSYFKPQLDNFLNNDEIDIVGFETIANFTE 180

Query: 181 LKALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCV 239
           LK+LLSWD   + KPFYISLSV D+GNLRDGT M  I+   ++     NPNL  +GVNCV
Sbjct: 181 LKSLLSWDEKKVSKPFYISLSVHDNGNLRDGTPMHLITDYIKSLATAINPNLTFLGVNCV 240

Query: 240 SYDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANG 299
           +Y+K   II  +   +P +PL  +PNSGEV++     W  N +    SWE +VK  +++G
Sbjct: 241 NYNKATEIIDSIHNGLPTMPLSVFPNSGEVFNVEKGIWTANPEAAA-SWEAVVKRFISSG 299

Query: 300 VRMVGGCCRTTPDDIHKIAQAVSHLSH 326
           VR+VGGCCRT P DI +I++AV  LS+
Sbjct: 300 VRIVGGCCRTRPHDIEQISKAVKKLSN 326

>KNAG0B06970 Chr2 (1387382..1388380) [999 bp, 332 aa] {ON} 
          Length = 332

 Score =  333 bits (855), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 156/314 (49%), Positives = 219/314 (69%), Gaps = 3/314 (0%)

Query: 2   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISI 61
           RQ  +EY   +P  V+V+DGGQGTELE RG++V++ VWSTVPFI   FW  ++ S++  I
Sbjct: 3   RQPIQEYLKVNPRKVLVLDGGQGTELENRGINVANPVWSTVPFIDSSFWS-NKSSKDRVI 61

Query: 62  VKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKY 121
           VK MF AF+ AG++ LM+ TYQ SF ++S NT IQ LEEY+ LL++IV+F R+CIG  KY
Sbjct: 62  VKGMFDAFLDAGAEILMTTTYQTSFKSVSENTPIQNLEEYSSLLDRIVQFSRDCIGPDKY 121

Query: 122 LIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYEL 181
           LIG IGP+ +HV AE+ GDYG +P  +DYL+YFKPQ               ET+PN +EL
Sbjct: 122 LIGCIGPWGAHVCAEFNGDYGPNPAEIDYLSYFKPQLDNFFHNDNLDLIGFETIPNIHEL 181

Query: 182 KALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVS 240
           +A+LSWD T + KPFYI LSV ++G LRDG++M  ++ + ++   K N NL ++G+NCVS
Sbjct: 182 RAILSWDETILSKPFYIGLSVHNNGLLRDGSTMKDVADLIKSFGGKLNKNLTLLGINCVS 241

Query: 241 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV 300
           +  +  I++ +   +PD+PL+ YPNSGEVYD + + W  N D+ + +WE +V   +  G 
Sbjct: 242 FSDSPDILESIHKELPDMPLIAYPNSGEVYDTVKKIWLPNRDMVM-TWEEVVDRYIKAGA 300

Query: 301 RMVGGCCRTTPDDI 314
           R+VGGCCRT+P DI
Sbjct: 301 RIVGGCCRTSPKDI 314

>Kpol_1068.7 s1068 complement(11996..12967) [972 bp, 323 aa] {ON}
           complement(11996..12967) [972 nt, 324 aa]
          Length = 323

 Score =  333 bits (853), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 152/324 (46%), Positives = 220/324 (67%), Gaps = 2/324 (0%)

Query: 1   MRQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNIS 60
           MR   +E     P+ V+V DGG GT LE RG++VSS +WSTVPF+  +FW  + K+ + +
Sbjct: 1   MRVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRN 60

Query: 61  IVKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSK 120
           I++ +++ ++ +GS+ L +ITYQ SF+ IS++T+++ +E Y +L+  I  FCR  IG   
Sbjct: 61  IIEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDN 120

Query: 121 YLIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYE 180
           YLIGSIGP+ + + AEYTG+YG  P N++YL YFKPQ               ETVPNKYE
Sbjct: 121 YLIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYE 180

Query: 181 LKALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVKNPNLMMVGVNCVS 240
           L+A+LSWD + I KP+Y+SLS+ D+G LRDGTS + I+T+F+ +   N NL++ G NC+S
Sbjct: 181 LEAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFK-KYSNNDNLILTGANCIS 239

Query: 241 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV 300
           +      I KL  A+P LPL+ YPNSGE+YD +T+ W  +    L +WE L+K+L  + V
Sbjct: 240 FKYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQTFGL-TWEDLIKELRTSNV 298

Query: 301 RMVGGCCRTTPDDIHKIAQAVSHL 324
           R+VGGCCRTTPDDI+KI   ++ +
Sbjct: 299 RIVGGCCRTTPDDINKIKDMITKV 322

>Smik_12.1 Chr12 complement(885..1859) [975 bp, 324 aa] {ON} YLL062C
           (REAL)
          Length = 324

 Score =  330 bits (845), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 149/315 (47%), Positives = 215/315 (68%), Gaps = 4/315 (1%)

Query: 12  HPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISIVKDMFQAFVA 71
           HP  V+V+DGGQGTELE RG++++S VWS  PF+   FW+K  + + +  V++M++ F+ 
Sbjct: 13  HPQKVLVLDGGQGTELENRGININSPVWSAAPFVSDSFWEKSSRERKV--VEEMYRDFMN 70

Query: 72  AGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKYLIGSIGPYAS 131
           AG+  LM+ITYQ +F +IS NT I+ L  Y   L++IV F R  IG  +YLIGSIGP+A+
Sbjct: 71  AGANVLMTITYQANFKSISKNTTIKTLPAYRRFLDQIVCFSRRLIGEERYLIGSIGPWAA 130

Query: 132 HVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYELKALLSWDGTT 191
           HVS+EYTG+YG HPE++DY  +F+PQ               ET+PN +ELKA+LSW    
Sbjct: 131 HVSSEYTGNYGPHPEDIDYYEFFRPQLDTFNENEDIDLIGFETIPNFHELKAILSWGEDI 190

Query: 192 IKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVSYDKTLMIIKK 250
           I +PFY+ LSV D+G LRDGT+++ IS   +    K N N +++GVNC+S++++ +I+K 
Sbjct: 191 ISRPFYVGLSVHDNGLLRDGTTLEEISAHIKGLGSKINKNFLLLGVNCISFNQSTLILKA 250

Query: 251 LQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGVRMVGGCCRTT 310
           L   +PD PL+ YPNSGE+YD   ++W    D KLDSW+  V+  + +G R++GGCCRT+
Sbjct: 251 LHEVLPDFPLLVYPNSGEIYDPKEKTWYHPTD-KLDSWDVTVRKFIDSGARIIGGCCRTS 309

Query: 311 PDDIHKIAQAVSHLS 325
           P DI +IA +V   S
Sbjct: 310 PKDIAEIAASVDTYS 324

>ZYRO0G14212g Chr7 (1133202..1134179) [978 bp, 325 aa] {ON} similar
           to uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 325

 Score =  328 bits (842), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 160/325 (49%), Positives = 211/325 (64%), Gaps = 7/325 (2%)

Query: 1   MRQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNIS 60
           MRQ   E      + V+VMDGGQGTELE RG+++S  +WSTVPF   EFW  D+   +  
Sbjct: 1   MRQQLLEVLR-DTDRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRD 59

Query: 61  IVKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSK 120
           +V  MF+A+V AG+Q L ++TYQ S+ TI ++T I    +Y++LL++IV FCR CIG+  
Sbjct: 60  VVNSMFKAYVDAGAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDH 119

Query: 121 YLIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYE 180
           YL+GSIGPYA+HV AEYTGDYG  PE +DY  YF+PQ              +ETVPN +E
Sbjct: 120 YLVGSIGPYAAHVGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHE 179

Query: 181 LKALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVKNPNLMMVGVNCVS 240
           LK++LSWD T I KPFY+SL VGDDGNLRDGT ++ +  +F NR   N NL++VG+NC S
Sbjct: 180 LKSILSWDETKISKPFYVSLCVGDDGNLRDGTPLEQLVPLFANR--SNKNLLLVGINCCS 237

Query: 241 YDKTLMIIKKLQIAVPDLP--LVCYPNSGEVYDQITQSWK--TNNDIKLDSWETLVKDLV 296
              +   +  L   +   P  L+ YPNSGE+YD  TQ+W   T  D    SW +LV++  
Sbjct: 238 LSVSSQALSHLNEILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRLSWPSLVQEYR 297

Query: 297 ANGVRMVGGCCRTTPDDIHKIAQAV 321
             G R +GGCCRTTP DI +I + V
Sbjct: 298 KFGARAIGGCCRTTPLDIQEICKVV 322

>Skud_12.4 Chr12 complement(4676..5653) [978 bp, 325 aa] {ON}
           YLL062C (REAL)
          Length = 325

 Score =  328 bits (841), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 152/321 (47%), Positives = 218/321 (67%), Gaps = 4/321 (1%)

Query: 2   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISI 61
           R S ++    +P  V+V+DGGQGTELE RG+++   VWS  PF    FW+  + S +  +
Sbjct: 3   RISIEKLILEYPTRVLVLDGGQGTELENRGINIGGPVWSATPFTSDSFWE--QSSHDREV 60

Query: 62  VKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKY 121
           V++M++ F+ AG+  LM+ITYQ +F +IS NT IQ L  YN  L++IV F R  IG  +Y
Sbjct: 61  VEEMYRDFMNAGANVLMTITYQANFKSISENTSIQTLSAYNGFLDRIVSFTRRFIGEERY 120

Query: 122 LIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYEL 181
           L+GSIGP+A+HVS+EYTG+YG HPE++DY N+FKPQ               ETVPN +EL
Sbjct: 121 LVGSIGPWAAHVSSEYTGNYGPHPEDIDYYNFFKPQLDSFNENKDIDLIGFETVPNFHEL 180

Query: 182 KALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVS 240
           KA+LSW    I KPFY+ LSV D+G LRDGT+M+ +S   +    + N +L+++GVNC+S
Sbjct: 181 KAILSWGEDIISKPFYVGLSVHDNGLLRDGTTMEEVSAHIKGLGSRINKHLLLMGVNCIS 240

Query: 241 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV 300
           ++++ +I++ L  ++PD PL+ YPNSGEVYD   ++W    D K +SW+  VK  + +G 
Sbjct: 241 FNRSTLILRTLHESLPDTPLLVYPNSGEVYDVKEKTWHWPTD-KPESWDITVKTFIDSGA 299

Query: 301 RMVGGCCRTTPDDIHKIAQAV 321
           R++GGCCRT+P DI +IA AV
Sbjct: 300 RIIGGCCRTSPKDIAEIATAV 320

>ABL125W Chr2 (161358..162368) [1011 bp, 336 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL273W (SAM4)
          Length = 336

 Score =  326 bits (836), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 148/320 (46%), Positives = 211/320 (65%), Gaps = 3/320 (0%)

Query: 2   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISI 61
           R   ++Y    P  V+VMDGGQGTELE RG+ V+S VWS  PF+    WQ+ + S+  +I
Sbjct: 3   RIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAWQQPD-SRERAI 61

Query: 62  VKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKY 121
           V  + + FVAAG++ +M+ITYQ SF+++++NT I  L++YN LL++IV FCRE +G+ KY
Sbjct: 62  VASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDKY 121

Query: 122 LIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYEL 181
           L+GSIG + +HV AE+TGDYG  P+++DYL YFKPQ               ET+PN +EL
Sbjct: 122 LVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHEL 181

Query: 182 KALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVKNPNLMMVGVNCVSY 241
           +A+LSWD + I KPFY++LSV D G LRDGT M  ++ +       NPN + +G+NC S 
Sbjct: 182 RAILSWDESVIAKPFYVALSVHDAGTLRDGTPMADVAAIVAAAAPLNPNFLGLGINCSSL 241

Query: 242 DKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGVR 301
            +T  I+ +L   +P LP+  YPNSGE+YD + + W  N    +  W  +V   + +G R
Sbjct: 242 SRTPAILAELHALLPALPMTIYPNSGEIYDPVKKVW--NASPHVVDWGAVVASYIRSGAR 299

Query: 302 MVGGCCRTTPDDIHKIAQAV 321
           ++GGCCRT P+DI +IA AV
Sbjct: 300 IIGGCCRTIPNDIRQIADAV 319

>TDEL0E00240 Chr5 complement(38804..39790) [987 bp, 328 aa] {ON} 
          Length = 328

 Score =  320 bits (820), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 146/316 (46%), Positives = 219/316 (69%), Gaps = 3/316 (0%)

Query: 11  THPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISIVKDMFQAFV 70
           T    ++V+DGGQGTE+E RG++V++ VWS++PF+   FW  DE S+   IV+++++ F+
Sbjct: 11  TDSRKILVLDGGQGTEMENRGIEVANPVWSSIPFVSESFWT-DEWSKERKIVEEIYKDFM 69

Query: 71  AAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKYLIGSIGPYA 130
           ++GS  LM++TYQ SF  I+ NT++Q L EYN LL++IV F R CIG+ +YL+GS+GP+A
Sbjct: 70  SSGSDMLMTVTYQASFKAIAENTELQTLSEYNSLLDRIVAFSRRCIGDERYLVGSVGPWA 129

Query: 131 SHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYELKALLSWDGT 190
           ++ ++EYTGDYGLH +++DY  Y+KPQ              +ETVPN +ELKA+LSWD  
Sbjct: 130 AYNASEYTGDYGLHADSIDYYGYYKPQLDNFNKQEEIDMIGIETVPNFHELKAILSWDEK 189

Query: 191 TIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVSYDKTLMIIK 249
            I KPFY+SL+  D G LRDGT+M+ I+   +      NPN M++G+NCVS++ +  I++
Sbjct: 190 KIAKPFYVSLTTHDSGVLRDGTAMEDIAQYIKCLGNNLNPNFMLLGINCVSFNDSRDILE 249

Query: 250 KLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGVRMVGGCCRT 309
            L  A+P++ L+ YPNSGEVY+   + W  N   K  SW+++VK  + +G R++GGCCRT
Sbjct: 250 LLHNALPEMLLLAYPNSGEVYEPKKKIWLANK-CKTTSWDSVVKSFINSGARIIGGCCRT 308

Query: 310 TPDDIHKIAQAVSHLS 325
           +P DI  ++ AV   S
Sbjct: 309 SPQDIADVSIAVKKYS 324

>Smik_6.484 Chr6 (800680..801657) [978 bp, 325 aa] {ON} YPL273W
           (REAL)
          Length = 325

 Score =  320 bits (820), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 155/321 (48%), Positives = 218/321 (67%), Gaps = 3/321 (0%)

Query: 2   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISI 61
           R   K+    +P  V+V+DGGQGTELE RG+ V++ VWST+PFI   FW  +  S    I
Sbjct: 3   RLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSSSR-KI 61

Query: 62  VKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKY 121
           VK+MF  F+ AG++ LM+ TYQ S+ ++S NT I+ L EYN LL +IV F R CIG  KY
Sbjct: 62  VKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDKY 121

Query: 122 LIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYEL 181
           LIG IGP+ +H+  E+TGDYG +PE++D+  YFKPQ               ET+PN +EL
Sbjct: 122 LIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQLDNFNKNDNLDLIGFETIPNIHEL 181

Query: 182 KALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVS 240
           KA+LSWD + + KPFYI LSV + G LRDGT+M  ++ + ++   K NPN  ++G+NCVS
Sbjct: 182 KAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCVS 241

Query: 241 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV 300
           ++++  I++ L  A+PD+ L+ YPNSGEVYD   + W  N+D KL+SW+ +VK  +++G 
Sbjct: 242 FNQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWLPNSD-KLNSWDAVVKRYISSGA 300

Query: 301 RMVGGCCRTTPDDIHKIAQAV 321
           R++GGCCRT+P DI +I  AV
Sbjct: 301 RIIGGCCRTSPKDIQEIFTAV 321

>KAFR0F04420 Chr6 (867176..868156) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  320 bits (819), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 149/321 (46%), Positives = 214/321 (66%), Gaps = 3/321 (0%)

Query: 2   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISI 61
           R   KEY   + + ++V+DGGQGTELE+RG+++SS VWST+PFI   FW  +  S +  I
Sbjct: 3   RVPIKEYLLRNSDKILVLDGGQGTELEKRGINISSPVWSTLPFINESFWS-NSSSNDRKI 61

Query: 62  VKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKY 121
           +KDM+  F++AG+  L + TYQ SF++IS NT IQ L++Y+ELLN+I KF RECIG+SKY
Sbjct: 62  IKDMYSDFISAGADVLSTTTYQTSFASISENTNIQTLKDYHELLNRITKFTRECIGDSKY 121

Query: 122 LIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYEL 181
           L+GSIG YA+++SAEYTGD+G   + +DY  YFKPQ               ET+PN +EL
Sbjct: 122 LVGSIGTYAAYLSAEYTGDFGDAADTIDYHGYFKPQLDNFNRSTEIDIIGFETIPNIHEL 181

Query: 182 KALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNRE-VKNPNLMMVGVNCVS 240
           +A+LS +   + KPFYISLS      LRDGTS+  +  + ++ E   NPNL+++G+NC+ 
Sbjct: 182 RAILSLNKKDLSKPFYISLSTNSKAQLRDGTSLKGVVDVIKSFESTLNPNLILLGINCIG 241

Query: 241 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV 300
            + + + ++ L   +P  PL+ YPNSGE YD + + W  + D    +WE +V   +  G 
Sbjct: 242 LNSSHLTMEYLNNHLPQFPLIVYPNSGEKYDPVRKIWLADEDPAF-TWEYIVHRYLDAGA 300

Query: 301 RMVGGCCRTTPDDIHKIAQAV 321
           R+VGGCCRTTP DI  I++A+
Sbjct: 301 RIVGGCCRTTPSDIRSISEAI 321

>Suva_64.1 Chr64 (76..894) [819 bp, 273 aa] {ON} YPL273W (REAL)
          Length = 273

 Score =  291 bits (746), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 135/271 (49%), Positives = 189/271 (69%), Gaps = 2/271 (0%)

Query: 2   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISI 61
           R   K+     P  V+V+DGGQGTELE RG+ V++ VWST+PFI   FW  DE S N  I
Sbjct: 3   RIPLKQLLADDPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWS-DESSANRKI 61

Query: 62  VKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKY 121
           VK+MF  F+AAG++ LM+ITYQ SF ++S NT I+ L  Y+ LL +IV F R+CIG  K+
Sbjct: 62  VKEMFNDFLAAGAEILMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKH 121

Query: 122 LIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYEL 181
           LIG IGP+ +HV  E+TG+YG +PE++D+  YFKPQ               ET+PN +EL
Sbjct: 122 LIGCIGPWGAHVCCEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHEL 181

Query: 182 KALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVS 240
           KA+LSWD + + KPFYI LSV + G LRDGT+M+ ++ + ++   K NPN +++G+NCVS
Sbjct: 182 KAILSWDESILSKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVS 241

Query: 241 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYD 271
           ++++  I++ L  A+P++PL+ YPNSGEVYD
Sbjct: 242 FNQSPDILESLHRALPNMPLLAYPNSGEVYD 272

>Suva_16.32 Chr16 (40969..41748) [780 bp, 259 aa] {ON} YPL273W
           (REAL)
          Length = 259

 Score =  263 bits (672), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 120/247 (48%), Positives = 176/247 (71%), Gaps = 2/247 (0%)

Query: 76  ALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKYLIGSIGPYASHVSA 135
           +LM+ITYQ SF ++S NT I+ L  Y+ LL +IV F R+CIG  K+LIG IGP+ +HV  
Sbjct: 10  SLMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVCC 69

Query: 136 EYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYELKALLSWDGTTIKKP 195
           E+TG+YG +PE++D+  YFKPQ               ET+PN +ELKA+LSWD + + KP
Sbjct: 70  EFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSKP 129

Query: 196 FYISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVSYDKTLMIIKKLQIA 254
           FYI LSV + G LRDGT+M+ ++ + ++   K NPN +++G+NCVS++++  I++ L  A
Sbjct: 130 FYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHRA 189

Query: 255 VPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGVRMVGGCCRTTPDDI 314
           +P++PL+ YPNSGEVYD   + W  N+D KL+SW+T+VK  + +G R++GGCCRTTP DI
Sbjct: 190 LPNMPLLAYPNSGEVYDTEKKIWLPNSD-KLNSWDTVVKQYIGSGARIIGGCCRTTPKDI 248

Query: 315 HKIAQAV 321
            +++ AV
Sbjct: 249 QEVSAAV 255

>SAKL0D09306g Chr4 (771565..772545) [981 bp, 326 aa] {ON} similar to
           uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 326

 Score =  257 bits (656), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 139/336 (41%), Positives = 205/336 (61%), Gaps = 25/336 (7%)

Query: 2   RQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISI 61
           RQ   EY  +   +++V+DGGQGTE+ERRG+DV   +WST+PFI +          +++ 
Sbjct: 3   RQPIAEYLES---SILVLDGGQGTEMERRGIDVIHPLWSTLPFIKK-------NPTHLNH 52

Query: 62  VKDMFQAFVAAGSQALMSITYQCSFSTIS--SNTKIQALEEYNELLNKIVKFCR-ECIGN 118
           +K M+  F  +G++AL +ITYQ SF+T+   S+ ++   ++Y + LN I+ F R +CI +
Sbjct: 53  IKGMYHDFSTSGARALSTITYQASFATLKQYSDGQVVTEQQYQQFLNDIIGFTRDQCISD 112

Query: 119 SKYLIGSIGPYASHV--SAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVP 176
           S+YLIG +GPYA+++   AEY+GDYG   E +D+  YFKPQ               ET+P
Sbjct: 113 SQYLIGCVGPYAAYLCNGAEYSGDYG--SEKIDFKQYFKPQLDVFSRDDRIDMVGFETIP 170

Query: 177 NKYELKALLSWDGTTI--KKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVKN-PNLMM 233
           N  ELK LLS D T++   KPFYIS+S   +GNLRDGT +  I    ++ +    PNL+ 
Sbjct: 171 NIEELKTLLSKDFTSMLGTKPFYISISTDSNGNLRDGTPVAKICETIKDADKSTPPNLLF 230

Query: 234 VGVNCVSYDKTLMIIKKLQIAVPD----LPLVCYPNSGEVYDQITQSWKTNNDIKLD-SW 288
           +G+NCV Y  +  I+ +L   + D    L    YPNSGE+YD  T +W TN++I  + +W
Sbjct: 231 LGINCVDYHHSYNILSRLNGGLGDDCSLLFKAVYPNSGEIYDGNTHTWHTNSEIAPELTW 290

Query: 289 ETLVKDLVANGVRMVGGCCRTTPDDIHKIAQAVSHL 324
             LV        +++GGCCRTTPDDI +IA AV+ +
Sbjct: 291 NYLVSKFAEQKCQLIGGCCRTTPDDIKQIADAVNKV 326

>Kwal_0.322 s0 (152442..153440) [999 bp, 332 aa] {ON} YLL062C (MHT1)
           - S-methylmethionine:homocysteine S-methyltransferase
           [contig 86] FULL
          Length = 332

 Score =  238 bits (606), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 130/340 (38%), Positives = 208/340 (61%), Gaps = 28/340 (8%)

Query: 1   MRQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNIS 60
           MR   +EY     + ++++DGGQGTELE+RG++++  +WST+P++      KD+K  ++ 
Sbjct: 1   MRLQLEEYLK---HEILLLDGGQGTELEKRGINIAHPLWSTLPYV-----TKDKK--HLK 50

Query: 61  IVKDMFQAFVAAGSQALMSITYQCSFSTISSNTK--IQALEEYNELLNKIVKFCR-ECIG 117
           I+K+M+ AF +AG  ALM+ITYQ SF ++ +++   I   +EY   L+ ++ +   +CI 
Sbjct: 51  IIKEMYSAFESAGCNALMTITYQASFLSMKNHSDGLINNEKEYTRFLDYVIDYTENQCIS 110

Query: 118 NSKYLIGSIGPYASHVS--AEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETV 175
            + YL+GS+GPYA+++S  AEY+G Y    +N+D++ +F+PQ              +ET+
Sbjct: 111 PNSYLVGSVGPYAAYLSNGAEYSGHY--IEDNIDFIEFFRPQVQHFAVSSRIDLIGIETI 168

Query: 176 PNKYELKALLSWDGTTI--KKPFYISLSVGDDGNLRDGTS-MDTISTMFQNREVKNPNLM 232
           PN  E KALL  + + +   KP+YIS++  ++GNLRDGT+  D   T+ ++ +   PNL+
Sbjct: 169 PNFEEFKALLRPEFSRLCALKPYYISITTDNEGNLRDGTARQDICETIKRSAQDLPPNLV 228

Query: 233 MVGVNCVSYDKTLMIIKKLQIAVPDLPL-------VCYPNSGEVYDQITQSWKTNNDI-K 284
             G+NCVS+     I+K L  ++ D+ +         YPNSGEVY   T SW  N +I  
Sbjct: 229 FFGINCVSFAHCADILKLLNDSLDDIGVENRLRFRAVYPNSGEVYHGDTHSWGPNPEIGP 288

Query: 285 LDSWETLVKDLVANGVRMVGGCCRTTPDDIHKIAQAVSHL 324
            D+WE L   +V  G  M+GGCCRT+P D+ +IA  VS +
Sbjct: 289 ADTWENLASKVVQQGCLMIGGCCRTSPADLRQIASVVSDI 328

>AFR410W Chr6 (1171334..1172446) [1113 bp, 370 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL273W (SAM4)
          Length = 370

 Score =  223 bits (569), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 119/317 (37%), Positives = 186/317 (58%), Gaps = 20/317 (6%)

Query: 16  VIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNISIVKDMFQAFVAAGSQ 75
           V+VMDGG G ELERRG+DV S +WST PF+     + D  +  +  ++ +++ F AAGS+
Sbjct: 59  VLVMDGGMGVELERRGMDVKSPLWSTAPFL-----RGDRAA--LDTIRGLYREFRAAGSR 111

Query: 76  ALMSITYQCSF-STISSNTKIQALEEYNELLNKIVKFC-RECIGNSK-YLIGSIGPYASH 132
            + ++TYQ SF S +  +  + +  +Y + L ++V F  REC+  ++ Y+IGS+GPYA+ 
Sbjct: 112 GISTLTYQASFHSMVKYSGSVSSRADYEKFLEQVVDFTYRECVDPARDYIIGSVGPYAAF 171

Query: 133 V--SAEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYELKALL--SWD 188
           +   AEYTGDYG   E +++ NYF+PQ             A ETVPN  EL A+L   + 
Sbjct: 172 LCNGAEYTGDYGF--ETINFFNYFEPQVSKFATDPRIDAIAFETVPNVVELMAMLQPEFH 229

Query: 189 GTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNR-EVKNPNLMMVGVNCVSYDKTLMI 247
                KPFYIS+S  D+  LRDGT +  +  + + R +   PNL+  G+NCV   ++  +
Sbjct: 230 ALLKNKPFYISISAKDEHVLRDGTPLAVVGQLIRERMDDLPPNLLCFGLNCVDLTRSAAM 289

Query: 248 IKKLQIAVPDLPL---VCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGVRMVG 304
           + +L + + D P+     YPN   V+D+   +W+ + D +  +W   VK  +    RM+G
Sbjct: 290 LAELNMQLQDCPIKFQAIYPNGTSVFDESLSAWRPSKDAESLTWAEAVKLYLNQDCRMIG 349

Query: 305 GCCRTTPDDIHKIAQAV 321
           GCC TTP D+ +IA+A+
Sbjct: 350 GCCGTTPQDMRQIAEAL 366

>KLTH0H12716g Chr8 (1079836..1080882) [1047 bp, 348 aa] {ON} similar
           to uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 348

 Score =  215 bits (547), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 125/335 (37%), Positives = 192/335 (57%), Gaps = 30/335 (8%)

Query: 1   MRQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNIS 60
           MR+  KE+F    N ++++DGGQGTELE++GV +S  +WST+PFI +          ++ 
Sbjct: 1   MRKPLKEFFK---NNILLLDGGQGTELEKKGVSISHPLWSTLPFIIK-------NKTHLE 50

Query: 61  IVKDMFQAFVAAGSQALMSITYQCSFSTIS--SNTKIQALEEYNELLNKIVKFC-RECIG 117
            +K+M++ F  AGS ALM+ITYQ SFS++   S   + + E+Y   L+ ++ F  RECI 
Sbjct: 51  AIKEMYRDFAEAGSNALMTITYQASFSSMKKYSEGLVNSEEDYAAFLDYVIGFTDRECIT 110

Query: 118 NSKYLIGSIGPYASHVS--AEYTGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETV 175
             KYL+GS+GPYA  +S  AEY+G YG     +D+++Y+ PQ              +ET+
Sbjct: 111 PDKYLVGSVGPYAGLLSNGAEYSGYYG--EGKIDFIDYYSPQVKHFALSPRIDLIGIETI 168

Query: 176 PNKYELKALLS--WDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVKNP-NLM 232
           PN  E KALLS  +   +  KP+YIS++  ++G LRDGTS++ I    +      P N +
Sbjct: 169 PNIDEFKALLSPEFSRLSFSKPYYISVTTDNNGCLRDGTSLNEICRAIKQSASLLPDNFV 228

Query: 233 MVGVNCVSYDKTLMIIKKLQIAVPDLPLV--------CYPNSGEVYDQITQSWKTNNDI- 283
              +NCV +   + I++ L   + ++  V         YPNSGE+Y   T SW +N    
Sbjct: 229 FFAINCVEFLHCVEILQSLNDCL-EMQGVDRRFRFRGAYPNSGEIYHGGTHSWSSNPYAG 287

Query: 284 KLDSWETLVKDLVANGVRMVGGCCRTTPDDIHKIA 318
             D+WE L   L++    M+GGCCRT  ++I ++A
Sbjct: 288 PEDTWENLTLGLLSQECLMLGGCCRTGSEEIRQMA 322

>Skud_101.1 Chr101 complement(3..602) [600 bp, 200 aa] {ON} YPL273W
           (REAL)
          Length = 200

 Score =  207 bits (528), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 95/195 (48%), Positives = 135/195 (69%), Gaps = 1/195 (0%)

Query: 78  MSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKYLIGSIGPYASHVSAEY 137
           M+ TYQ S+ ++S NT I+ L EYN LL +IV F R+CIG +KYLIG IGP+ +H+  E+
Sbjct: 1   MTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRDCIGENKYLIGCIGPWGAHICREF 60

Query: 138 TGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYELKALLSWDGTTIKKPFY 197
           TGDYG  PE++D+  YFKPQ               ET+PN +EL+A+LSWD + + KPFY
Sbjct: 61  TGDYGPDPESIDFYEYFKPQLDNFNKNDKLDLIGFETIPNVHELRAILSWDESILSKPFY 120

Query: 198 ISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVSYDKTLMIIKKLQIAVP 256
           I LSV + G LRDGT+M+ ++ + +    K NPN  ++G+NCVS++++  I++ L  A+P
Sbjct: 121 IGLSVHEHGVLRDGTTMEEVAKVIKGLGDKINPNFSLLGINCVSFNQSPDILESLHQALP 180

Query: 257 DLPLVCYPNSGEVYD 271
           D+ L+ YPNSGEVYD
Sbjct: 181 DMALLAYPNSGEVYD 195

>Skud_100.1 Chr100 complement(3..602) [600 bp, 200 aa] {ON} YPL273W
           (REAL)
          Length = 200

 Score =  201 bits (511), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 132/195 (67%), Gaps = 1/195 (0%)

Query: 78  MSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSKYLIGSIGPYASHVSAEY 137
           M+ TYQ S+ ++S NT I+ L EYN LL +IV F R CIG  KYLIG IGP+ +H+  E+
Sbjct: 1   MTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRVCIGEDKYLIGCIGPWGAHICCEF 60

Query: 138 TGDYGLHPENVDYLNYFKPQXXXXXXXXXXXXXAMETVPNKYELKALLSWDGTTIKKPFY 197
           TGDYG  P+++D+  YFKPQ               ET+PN +EL+A+LSWD + + KPFY
Sbjct: 61  TGDYGPDPQSIDFYKYFKPQLDNFNKSDKLDLIGFETIPNVHELRAILSWDESILSKPFY 120

Query: 198 ISLSVGDDGNLRDGTSMDTISTMFQNREVK-NPNLMMVGVNCVSYDKTLMIIKKLQIAVP 256
           I LSV + G LRDGT+M+ ++ + +    K NPN  ++G+NCVS++++  I++ L   +P
Sbjct: 121 IGLSVHEHGVLRDGTTMEEVAKVIKGLGDKINPNFSLLGINCVSFNQSPDILESLHQVLP 180

Query: 257 DLPLVCYPNSGEVYD 271
           ++ L+ YPNSGEVYD
Sbjct: 181 NMALLAYPNSGEVYD 195

>YMR321C Chr13 complement(917579..917896) [318 bp, 105 aa] {ON}
           Putative protein of unknown function; proposed to be a
           palmitoylated membrane protein
          Length = 105

 Score =  108 bits (269), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 72/94 (76%), Gaps = 1/94 (1%)

Query: 228 NPNLMMVGVNCVSYDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDS 287
           NPNL  +G+NCVS++++  I++ L  A+P++ L+ YPNSGEVYD   + W  N+D KL+S
Sbjct: 9   NPNLSFLGINCVSFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSD-KLNS 67

Query: 288 WETLVKDLVANGVRMVGGCCRTTPDDIHKIAQAV 321
           W+T+VK  +++G R++GGCCRT+P DI +I+ AV
Sbjct: 68  WDTVVKQYISSGARIIGGCCRTSPKDIQEISAAV 101

>Skud_47.2 Chr47 (1368..1655) [288 bp, 96 aa] {ON} YPL273W (REAL)
          Length = 96

 Score =  104 bits (259), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 65/96 (67%), Gaps = 1/96 (1%)

Query: 1  MRQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNIS 60
          +R   K+    +P  V+V+DGGQGTELE RG+ V++ VWST+PFI   FW  DE S N  
Sbjct: 2  VRLPLKQLLEDNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWS-DESSANRK 60

Query: 61 IVKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQ 96
          IVK MF  F+ AG++ LM+ TYQ S+ ++S NT I+
Sbjct: 61 IVKGMFNDFLNAGAEILMTTTYQTSYKSVSENTPIK 96

>KAFR0L00560 Chr12 (102072..105842) [3771 bp, 1256 aa] {ON}
           Anc_7.154 YER008C
          Length = 1256

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 38/84 (45%), Gaps = 4/84 (4%)

Query: 215 DTISTMFQNREVKNPNLMMVGV--NCVSYDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQ 272
           + ++ +F NR V     M   +  +  S D+   I+ +L +    L L C   S E Y  
Sbjct: 722 EKVTELFLNRVVDELGTMFAYIKNDSTSKDQLTSILSRL-LVFSSLVLFCKEASNESYRS 780

Query: 273 ITQSWKTNND-IKLDSWETLVKDL 295
           I + W  N+  I  + W  ++KD+
Sbjct: 781 IIEQWNKNSQLIYTNIWSKILKDM 804

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,121,453
Number of extensions: 1431993
Number of successful extensions: 3820
Number of sequences better than 10.0: 40
Number of HSP's gapped: 3820
Number of HSP's successfully gapped: 40
Length of query: 326
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 216
Effective length of database: 40,868,139
Effective search space: 8827518024
Effective search space used: 8827518024
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)