Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0B032508.840ON64364334640.0
YMR278W (PGM3)8.840ON62264120390.0
Smik_13.4918.840ON62263820370.0
NCAS0C004108.840ON62563720200.0
Suva_13.4668.840ON62264020070.0
NDAI0K004108.840ON62663719540.0
Skud_13.4508.840ON62264219470.0
TPHA0I002508.840ON62964319340.0
Kpol_1068.88.840ON63264919050.0
KNAG0J002708.840ON62563918940.0
SAKL0D01474g8.840ON62463518780.0
TDEL0B005708.840ON63064518650.0
CAGL0M02981g8.840ON61763618480.0
Kwal_27.102588.840ON62063618290.0
ZYRO0G14190g8.840ON61063518240.0
KLTH0C03872g8.840ON62163818180.0
KAFR0B039208.840ON62464417750.0
KLLA0D01573g8.840ON60763716950.0
ABL126W8.840ON62463716890.0
Ecym_46118.840ON63063716710.0
KNAG0E023902.445ON5694331172e-05
NCAS0F014702.445ON5694501038e-04
CAGL0K03421g2.445ON5683901000.002
KLLA0B12694g2.445ON568418940.011
CAGL0B03597g6.11ON54030940.011
NCAS0F002006.11ON54928930.012
NDAI0K028906.11ON56133930.013
KLTH0D04796g2.445ON570392930.014
TBLA0G009806.11ON55828920.016
TDEL0A022102.445ON572396920.020
Smik_13.2912.445ON569384910.022
CAGL0K07480g2.445ON567500900.029
Kwal_56.223556.11ON54191900.030
KAFR0D030102.445ON569394900.031
YMR105C (PGM2)2.445ON569384900.032
TDEL0G046006.11ON52875890.041
Smik_12.264.29ON74896890.043
NCAS0A043502.445ON569448880.050
Kpol_1032.26.11ON53928880.052
Kpol_1018.1612.445ON569498870.063
KAFR0L003406.11ON54028870.067
NDAI0H023502.445ON569433870.071
ZYRO0F00506g6.11ON55024870.073
TDEL0E00210singletonON570392870.079
Suva_13.2822.445ON569453860.082
Smik_5.296.11ON55568860.083
YEL058W (PCM1)6.11ON55728850.12
KNAG0E009406.11ON53821850.12
Skud_5.316.11ON55728850.13
SAKL0E00902g6.11ON54463850.13
Suva_5.106.11ON55328850.13
Kwal_26.76282.445ON570388850.14
ACR015W6.11ON55265830.23
TBLA0I013802.445ON571394820.25
Ecym_24752.445ON567439820.29
Kpol_1033.542.445ON570136820.30
KLTH0C11506g6.11ON54464810.31
KLLA0D00858g6.11ON54119810.35
KNAG0C038307.335ON494126761.2
TPHA0M002106.11ON54528761.4
Ecym_30146.11ON55119752.0
Kwal_55.210883.460ON1455156742.9
TPHA0G029002.445ON569459733.3
KNAG0A062802.445ON57089733.7
KAFR0A042008.740ON26031698.1
ABL029W2.445ON56895699.8
Ecym_33682.329ON66988699.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0B03250
         (643 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...  1338   0.0  
YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...   790   0.0  
Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...   789   0.0  
NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...   782   0.0  
Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...   777   0.0  
NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...   757   0.0  
Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...   754   0.0  
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...   749   0.0  
Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...   738   0.0  
KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...   734   0.0  
SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...   728   0.0  
TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...   723   0.0  
CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...   716   0.0  
Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...   709   0.0  
ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...   707   0.0  
KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...   704   0.0  
KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...   688   0.0  
KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...   657   0.0  
ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...   655   0.0  
Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...   648   0.0  
KNAG0E02390 Chr5 (475467..477176) [1710 bp, 569 aa] {ON} Anc_2.4...    50   2e-05
NCAS0F01470 Chr6 complement(293218..294927) [1710 bp, 569 aa] {O...    44   8e-04
CAGL0K03421g Chr11 complement(314680..316386) [1707 bp, 568 aa] ...    43   0.002
KLLA0B12694g Chr2 (1107696..1109402) [1707 bp, 568 aa] {ON} high...    41   0.011
CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...    41   0.011
NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...    40   0.012
NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....    40   0.013
KLTH0D04796g Chr4 (437416..439128) [1713 bp, 570 aa] {ON} highly...    40   0.014
TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...    40   0.016
TDEL0A02210 Chr1 (400375..402093) [1719 bp, 572 aa] {ON} Anc_2.4...    40   0.020
Smik_13.291 Chr13 complement(460399..462108) [1710 bp, 569 aa] {...    40   0.022
CAGL0K07480g Chr11 complement(740462..742165) [1704 bp, 567 aa] ...    39   0.029
Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...    39   0.030
KAFR0D03010 Chr4 (594118..595827) [1710 bp, 569 aa] {ON} Anc_2.4...    39   0.031
YMR105C Chr13 complement(475897..477606) [1710 bp, 569 aa] {ON} ...    39   0.032
TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...    39   0.041
Smik_12.26 Chr12 (65808..68054) [2247 bp, 748 aa] {ON} YLL029W (...    39   0.043
NCAS0A04350 Chr1 (878688..880397) [1710 bp, 569 aa] {ON} Anc_2.4...    39   0.050
Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...    39   0.052
Kpol_1018.161 s1018 (412372..414081) [1710 bp, 569 aa] {ON} (412...    38   0.063
KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...    38   0.067
NDAI0H02350 Chr8 complement(571624..573333) [1710 bp, 569 aa] {O...    38   0.071
ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...    38   0.073
TDEL0E00210 Chr5 (28244..29956) [1713 bp, 570 aa] {ON} Anc_2.445...    38   0.079
Suva_13.282 Chr13 complement(457565..459274) [1710 bp, 569 aa] {...    38   0.082
Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)    38   0.083
YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...    37   0.12 
KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...    37   0.12 
Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)    37   0.13 
SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...    37   0.13 
Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)    37   0.13 
Kwal_26.7628 s26 (449302..451014) [1713 bp, 570 aa] {ON} YMR105C...    37   0.14 
ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...    37   0.23 
TBLA0I01380 Chr9 complement(297671..299386) [1716 bp, 571 aa] {O...    36   0.25 
Ecym_2475 Chr2 complement(927999..929702) [1704 bp, 567 aa] {ON}...    36   0.29 
Kpol_1033.54 s1033 (136243..137955) [1713 bp, 570 aa] {ON} (1362...    36   0.30 
KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...    36   0.31 
KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...    36   0.35 
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    34   1.2  
TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...    34   1.4  
Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...    33   2.0  
Kwal_55.21088 s55 (680183..684550) [4368 bp, 1455 aa] {ON} YGR11...    33   2.9  
TPHA0G02900 Chr7 (622303..624012) [1710 bp, 569 aa] {ON}               33   3.3  
KNAG0A06280 Chr1 (955994..957706) [1713 bp, 570 aa] {ON}               33   3.7  
KAFR0A04200 Chr1 complement(842429..843211) [783 bp, 260 aa] {ON...    31   8.1  
ABL029W Chr2 (343850..345556) [1707 bp, 568 aa] {ON} Syntenic ho...    31   9.8  
Ecym_3368 Chr3 (700956..702965) [2010 bp, 669 aa] {ON} similar t...    31   9.8  

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score = 1338 bits (3464), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 643/643 (100%), Positives = 643/643 (100%)

Query: 1   MSDEQQFNALIKDYPEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRITF 60
           MSDEQQFNALIKDYPEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRITF
Sbjct: 1   MSDEQQFNALIKDYPEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRITF 60

Query: 61  GTAGLRSTMEAGFSRMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFAK 120
           GTAGLRSTMEAGFSRMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFAK
Sbjct: 61  GTAGLRSTMEAGFSRMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFAK 120

Query: 121 IAATVFLIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNLKASVGVMVTASHNPKMDN 180
           IAATVFLIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNLKASVGVMVTASHNPKMDN
Sbjct: 121 IAATVFLIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNLKASVGVMVTASHNPKMDN 180

Query: 181 GYKVYYSNGCQIIPPHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLND 240
           GYKVYYSNGCQIIPPHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLND
Sbjct: 181 GYKVYYSNGCQIIPPHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLND 240

Query: 241 YITQLEEKLTSKDIIHLSKKIDVKSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFIV 300
           YITQLEEKLTSKDIIHLSKKIDVKSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFIV
Sbjct: 241 YITQLEEKLTSKDIIHLSKKIDVKSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFIV 300

Query: 301 VEEQKHPDPGFPTVSFPNPEEKGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQ 360
           VEEQKHPDPGFPTVSFPNPEEKGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQ
Sbjct: 301 VEEQKHPDPGFPTVSFPNPEEKGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQ 360

Query: 361 GTWHQFTGNEIGYLFAYFEFQKYKISKQDLHRLYMVNSTVSSQMIKKMAEIEGFNYEETL 420
           GTWHQFTGNEIGYLFAYFEFQKYKISKQDLHRLYMVNSTVSSQMIKKMAEIEGFNYEETL
Sbjct: 361 GTWHQFTGNEIGYLFAYFEFQKYKISKQDLHRLYMVNSTVSSQMIKKMAEIEGFNYEETL 420

Query: 421 TGFKWIGNRAIDLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQIDK 480
           TGFKWIGNRAIDLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQIDK
Sbjct: 421 TGFKWIGNRAIDLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQIDK 480

Query: 481 MDPYEIIQLGFKKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDKGVSEGNKKYPDHIGE 540
           MDPYEIIQLGFKKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDKGVSEGNKKYPDHIGE
Sbjct: 481 MDPYEIIQLGFKKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDKGVSEGNKKYPDHIGE 540

Query: 541 EFKIIKYRDLTTGYQSDTPDNKPLLPVDPSSQMITVEMIPTDNESDGSIRLTIRGSGTEP 600
           EFKIIKYRDLTTGYQSDTPDNKPLLPVDPSSQMITVEMIPTDNESDGSIRLTIRGSGTEP
Sbjct: 541 EFKIIKYRDLTTGYQSDTPDNKPLLPVDPSSQMITVEMIPTDNESDGSIRLTIRGSGTEP 600

Query: 601 KLKVYIEACSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF 643
           KLKVYIEACSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF
Sbjct: 601 KLKVYIEACSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF 643

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score =  790 bits (2039), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/641 (59%), Positives = 480/641 (74%), Gaps = 24/641 (3%)

Query: 7   FNALIKDYPEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRITFGTAGLR 66
              +++  P DL+  + LW +QD++  T +E+  LCK ++  ELH+RFDSRI FGTAGLR
Sbjct: 2   LQGILETVPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGLR 61

Query: 67  STMEAGFSRMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFAKIAATVF 126
           S M+AGFSRMNTL V+QASQGLATY++    +    L+AV+GHDHR+HSKEFA+  A  F
Sbjct: 62  SQMQAGFSRMNTLVVIQASQGLATYVRQQFPDN---LVAVVGHDHRFHSKEFARATAAAF 118

Query: 127 LIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNLKASVGVMVTASHNPKMDNGYKVYY 186
           L+ GFKV+YLN D       ++FVHTP+VPF V  LKASVGVM+TASHNPKMDNGYKVYY
Sbjct: 119 LLKGFKVHYLNPD-------HEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYY 171

Query: 187 SNGCQIIPPHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLNDYITQLE 246
           SNGCQIIPPHD  IS  IDANLEPW N W++ +++  A  +G L+Y R+ ML  Y+ ++ 
Sbjct: 172 SNGCQIIPPHDHAISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEV- 230

Query: 247 EKLTSKDIIHLSK-KIDVKSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFIVVEEQK 305
               SK+++ ++  K++VK+KPWFVYTPMHGVG++IF+ I  + L + EG+D++ V EQ+
Sbjct: 231 ----SKNLVEINPLKLEVKAKPWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQ 286

Query: 306 HPDPGFPTVSFPNPEEKGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQGTWHQ 365
           +PDP FPTV FPNPEEKGA+D+GI LAE + I L++ANDPDADRFS+AVK   S G W Q
Sbjct: 287 NPDPSFPTVGFPNPEEKGALDIGINLAEKHDIDLLVANDPDADRFSVAVKDMQS-GEWRQ 345

Query: 366 FTGNEIGYLFAYFEFQKYKISK---QDLHRLYMVNSTVSSQMIKKMAEIEGFNYEETLTG 422
            TGNEIG+LFA++E+QKYK      Q +H L M+NSTVSSQMIKKMAEIEGF+YE+TLTG
Sbjct: 346 LTGNEIGFLFAFYEYQKYKSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTG 405

Query: 423 FKWIGNRAIDLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQIDKMD 482
           FKWIGNRAI L  KG  VPFG+EEAIGYMFP ME DKDGI+A+++F+QA+  W     +D
Sbjct: 406 FKWIGNRAILLEKKGYYVPFGFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLD 465

Query: 483 PYEIIQLGFKKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDKGVSEGNKKYPDHIGEEF 542
           P  +++ GFKKYGVF EYNGYY   +  +TK IFDY+R  Y     EG   YP  IGEE 
Sbjct: 466 PLNVLENGFKKYGVFKEYNGYYVVPNPTVTKDIFDYIRNVY---TPEG-ASYPSSIGEEI 521

Query: 543 KIIKYRDLTTGYQSDTPDNKPLLPVDPSSQMITVEMIPTDNESDGSIRLTIRGSGTEPKL 602
           +++ YRDLTTGYQSDT ++KP LPVDP+SQMITV   P++   +  IR TIRGSGTEPKL
Sbjct: 522 EVLYYRDLTTGYQSDTINHKPTLPVDPTSQMITVSARPSNGSENEHIRFTIRGSGTEPKL 581

Query: 603 KVYIEACSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF 643
           KVYIEAC+     ASFLAK  WNVL+REW RP++  I T F
Sbjct: 582 KVYIEACANEEQRASFLAKLTWNVLRREWFRPDEMNIVTKF 622

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  789 bits (2037), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/638 (59%), Positives = 475/638 (74%), Gaps = 24/638 (3%)

Query: 10  LIKDYPEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRITFGTAGLRSTM 69
            ++  P +L++ + LW EQD++  T +E+  LCK ++  ELH RFDSRI FGTAGLRS M
Sbjct: 5   FLEAVPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGLRSQM 64

Query: 70  EAGFSRMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFAKIAATVFLIA 129
           +AGF+RMNTL ++QASQGLATY K    N    L+AV+GHDHR+HSKEFA+  AT FL+ 
Sbjct: 65  QAGFNRMNTLVIIQASQGLATYAKQQFPNN---LVAVVGHDHRFHSKEFARATATAFLLK 121

Query: 130 GFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNLKASVGVMVTASHNPKMDNGYKVYYSNG 189
           GFKV+YLN D       ++FVHTP+VPF V  LKASVGVMVTASHNPKMDNGYKVYYSNG
Sbjct: 122 GFKVHYLNPD-------HEFVHTPLVPFAVDKLKASVGVMVTASHNPKMDNGYKVYYSNG 174

Query: 190 CQIIPPHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLNDYITQLEEKL 249
           CQIIPPHD  IS  ID NLEPW N WN+ +++     +G L+Y R+ +L  Y+ ++ + L
Sbjct: 175 CQIIPPHDHAISDSIDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNL 234

Query: 250 TSKDIIHLSKKIDVKSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFIVVEEQKHPDP 309
              D +    K +VK+KPWFVYTPMHGVG++IF+ I  + + + EG+D++ V EQ+ PDP
Sbjct: 235 VGTDPL----KFEVKAKPWFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDP 290

Query: 310 GFPTVSFPNPEEKGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQGTWHQFTGN 369
            FPTV+FPNPEEKGA+D+GI LAE++GI+L+IANDPDADRFS+A+K   S G W Q TGN
Sbjct: 291 SFPTVAFPNPEEKGALDLGINLAENHGINLLIANDPDADRFSVAIKDIRS-GEWRQLTGN 349

Query: 370 EIGYLFAYFEFQKYKISK---QDLHRLYMVNSTVSSQMIKKMAEIEGFNYEETLTGFKWI 426
           EIG+LFA FEFQK+K  +   Q  H L M++STVSSQMIKKMAE+EGF+YEETLTGFKWI
Sbjct: 350 EIGFLFAIFEFQKFKSMEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWI 409

Query: 427 GNRAIDLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQIDKMDPYEI 486
           GNRAI L  +G  VPFG+EEAIGYMFP ME DKDG++A+++F+QA+  W     +DP  I
Sbjct: 410 GNRAILLEKEGYYVPFGFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISI 469

Query: 487 IQLGFKKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYD-KGVSEGNKKYPDHIGEEFKII 545
           ++ GFKKYGVF EYNGYY  +   +T +IFDY+R  Y  KGVS     YP  IG+E +++
Sbjct: 470 LEDGFKKYGVFKEYNGYYIVSSPIVTNEIFDYIRNAYTPKGVS-----YPSSIGKEIEVL 524

Query: 546 KYRDLTTGYQSDTPDNKPLLPVDPSSQMITVEMIPTDNESDGSIRLTIRGSGTEPKLKVY 605
            YRDLT GYQSDT ++KP LP+DPSSQMITV   P+D      IR TIRGSGTEPK+KVY
Sbjct: 525 NYRDLTIGYQSDTSNHKPTLPIDPSSQMITVSAKPSDGNEGEHIRFTIRGSGTEPKIKVY 584

Query: 606 IEACSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF 643
           IEAC+     A+FLAK  WNVLKREW RPE+  I T F
Sbjct: 585 IEACADEEQRATFLAKLTWNVLKREWFRPEKMDIVTHF 622

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score =  782 bits (2020), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/637 (58%), Positives = 481/637 (75%), Gaps = 23/637 (3%)

Query: 11  IKDYPEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRITFGTAGLRSTME 70
           + + PE+L++ + LWL  D+++ TRKE++ LC++ N  ELH+RFD+RI FGTAGLRS ME
Sbjct: 8   LSNCPENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTAGLRSRME 67

Query: 71  AGFSRMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFAKIAATVFLIAG 130
           AGFSRMN+L +LQ++QGLA Y+K    N    L AV+GHDHR+HSKEFA + A++FL AG
Sbjct: 68  AGFSRMNSLIILQSTQGLANYIKEQFPNN---LTAVVGHDHRFHSKEFAIVTASIFLRAG 124

Query: 131 FKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNLKASVGVMVTASHNPKMDNGYKVYYSNGC 190
           FKV+YL  D       ++FVHTP+VPF+V NLKASVGVM+TASHNPKMDNGYKVYY N C
Sbjct: 125 FKVFYLTPD-------DQFVHTPLVPFSVLNLKASVGVMITASHNPKMDNGYKVYYDNAC 177

Query: 191 QIIPPHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLNDYITQLEEKLT 250
           QIIPPHD  I++ I  NLEPW  SW++            L++ +D+M   Y+ Q++  L 
Sbjct: 178 QIIPPHDKNIAEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLI 237

Query: 251 SKDIIHLSKKIDVKSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFIVVEEQKHPDPG 310
                HLS K DVK+ P+FVYTPMHGVG EIF K+S+E+L++ E  D++VV EQ+ PDP 
Sbjct: 238 HSS--HLSLK-DVKT-PFFVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPS 293

Query: 311 FPTVSFPNPEEKGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQGTWHQFTGNE 370
           FPTVSFPNPEEKGA+ + IKLA++NG+SLVIANDPDADRFS AV +K + G W Q TGNE
Sbjct: 294 FPTVSFPNPEEKGALSLAIKLAQENGLSLVIANDPDADRFSAAVLNKKT-GKWRQLTGNE 352

Query: 371 IGYLFAYFEFQKYK---ISKQDLHRLYMVNSTVSSQMIKKMAEIEGFNYEETLTGFKWIG 427
           IG+L  Y+EFQ Y+   ++ +  H L M+NSTVSSQMIK+MA++ GF+YE+TLTGFKWIG
Sbjct: 353 IGFLLGYYEFQLYEQQDVAFRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIG 412

Query: 428 NRAIDLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQIDKMDPYEII 487
           N+AIDL  +G  VPFG+EEAIGYMFP ME DKDGI+A  +F+QA+ +W    +M P++I+
Sbjct: 413 NKAIDLRQEGYYVPFGFEEAIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIM 472

Query: 488 QLGFKKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDKGVSEGNKKYPDHIGEEFKIIKY 547
           + GF K+GVF EYNGYY   DL ITK +FD++R++Y       NKKYP  IG E  +  +
Sbjct: 473 EEGFGKFGVFKEYNGYYILKDLSITKTVFDFIRHEY----PSTNKKYPSEIGNELIVTVF 528

Query: 548 RDLTTGYQSDTPDNKPLLPVDPSSQMITVEMIPTD-NESDGSIRLTIRGSGTEPKLKVYI 606
           RDLT GYQS+T DN P LPVDP+SQMITVE  P++ +  +G++RLT+RGSGTEPKLKVYI
Sbjct: 529 RDLTVGYQSNTKDNIPNLPVDPTSQMITVEAKPSEFSNLEGTVRLTMRGSGTEPKLKVYI 588

Query: 607 EACSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF 643
           EACS+S   A+ LA+  W++LKREW RPE TG+TT+F
Sbjct: 589 EACSKSEESATNLARSTWDILKREWFRPEVTGLTTSF 625

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  777 bits (2007), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/640 (58%), Positives = 476/640 (74%), Gaps = 22/640 (3%)

Query: 7   FNALIKDYPEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRITFGTAGLR 66
           +  L++  P DL+  + LW +QD++  T +E+  LCK+++  ELH+RFD+RI FGTAGLR
Sbjct: 2   YQQLLETVPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGLR 61

Query: 67  STMEAGFSRMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFAKIAATVF 126
           S M+AGFSRMNTL ++QA+QGLATY+K    +    L+ V+GHDHR+HSKEFA+  AT F
Sbjct: 62  SEMQAGFSRMNTLVIIQATQGLATYIKQQFPDN---LVVVVGHDHRFHSKEFARATATAF 118

Query: 127 LIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNLKASVGVMVTASHNPKMDNGYKVYY 186
           L+ GFKV+YLN D       ++FVHTP+VPF V  LKASVGVM+TASHNPKMDNGYKVYY
Sbjct: 119 LLKGFKVHYLNPD-------HEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYY 171

Query: 187 SNGCQIIPPHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLNDYITQLE 246
           SNGCQIIPPHD  IS  ID NLEPW N W + +++  A  +G L+Y R+ MLN Y  ++ 
Sbjct: 172 SNGCQIIPPHDHAISDSIDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVS 231

Query: 247 EKLTSKDIIHLSKKIDVKSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFIVVEEQKH 306
           + L   + +    K+++K+KPWFVYTPMHGVG+ IF+ I  + + + EGED++ V EQ++
Sbjct: 232 KTLVETNPL----KLEIKAKPWFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQN 287

Query: 307 PDPGFPTVSFPNPEEKGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQGTWHQF 366
           PDP FPTV FPNPEEKGA+D+G++LAE++ I+L++ANDPDADRFSIAVK   S   W Q 
Sbjct: 288 PDPSFPTVGFPNPEEKGALDIGMRLAEEHDINLLVANDPDADRFSIAVKDTQS-SKWRQL 346

Query: 367 TGNEIGYLFAYFEFQKYKISKQDLHR---LYMVNSTVSSQMIKKMAEIEGFNYEETLTGF 423
           TGNEIG+LFA+FEFQ+YK   ++  R   L M++STVSSQMIKKMAE+EGF YE+TLTGF
Sbjct: 347 TGNEIGFLFAFFEFQRYKNKDEEFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGF 406

Query: 424 KWIGNRAIDLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQIDKMDP 483
           KWIGNRAI L  +G  VPFG+EEAIGYMFP ME DKDGI+A V+ +QA+  W     +DP
Sbjct: 407 KWIGNRAIILEKEGYYVPFGFEEAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDP 466

Query: 484 YEIIQLGFKKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDKGVSEGNKKYPDHIGEEFK 543
            +I++ GF+KYGVF EYNGYY      +T +IF+Y+R  Y    +     YP  IGEE +
Sbjct: 467 IDILENGFQKYGVFKEYNGYYVVPSPLVTTEIFEYIRNVY----TPTGVPYPPSIGEEIE 522

Query: 544 IIKYRDLTTGYQSDTPDNKPLLPVDPSSQMITVEMIPTDNESDGSIRLTIRGSGTEPKLK 603
           ++ YRDLTTGYQSDTPD+KP+LPVDP+SQMIT+   P+D   +  IR TIRGSGTEPKLK
Sbjct: 523 VVYYRDLTTGYQSDTPDHKPVLPVDPTSQMITLSGKPSDGNGNEHIRFTIRGSGTEPKLK 582

Query: 604 VYIEACSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF 643
           VYIEAC+ +   AS+LAK  W+VL+R W RPE   ITT F
Sbjct: 583 VYIEACADNEKRASYLAKLTWDVLRRGWFRPEIMNITTDF 622

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score =  757 bits (1954), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/637 (59%), Positives = 469/637 (73%), Gaps = 21/637 (3%)

Query: 10  LIKDYPEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRITFGTAGLRSTM 69
           +  D P +L++ + LWL QDK + TR E+I LCK +N  ELH+RFDSRI FGTAGLRS M
Sbjct: 8   ICDDCPANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGTAGLRSRM 67

Query: 70  EAGFSRMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFAKIAATVFLIA 129
           EAGFSRMN L +LQASQGLA Y+K         L AV+GHDHR+HSK+FA I A+VFL  
Sbjct: 68  EAGFSRMNPLVILQASQGLAKYIKAQFPTN---LTAVVGHDHRFHSKQFAMITASVFLRV 124

Query: 130 GFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNLKASVGVMVTASHNPKMDNGYKVYYSNG 189
           GFKVYYLN      P D+ FVHTP+VPF+V +L AS+GVM+TASHNPKMDNGYKVYYSNG
Sbjct: 125 GFKVYYLN------PEDS-FVHTPLVPFSVNHLNASIGVMITASHNPKMDNGYKVYYSNG 177

Query: 190 CQIIPPHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLNDYITQLEEKL 249
           CQIIPPHD  I+  ID NLEPW + WN+         +  L+Y R+ M N Y+  +++ L
Sbjct: 178 CQIIPPHDKNIAATIDENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDIL 237

Query: 250 TSKDIIHLSKKIDVKSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFIVVEEQKHPDP 309
            S  I   S+  +   KPWFVYTPMHGVGY IFTKIS  ILH +E  D+ VV+EQ +PDP
Sbjct: 238 VSSSI---SRPNNNGKKPWFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDP 294

Query: 310 GFPTVSFPNPEEKGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQGTWHQFTGN 369
            FPTVSFPNPEEKGA+ +  KLAE+N ISLVIANDPDADRFS+A K++ + G W Q +GN
Sbjct: 295 AFPTVSFPNPEEKGALSLATKLAEENNISLVIANDPDADRFSVASKNEKT-GQWQQLSGN 353

Query: 370 EIGYLFAYFEFQKY---KISKQDLHRLYMVNSTVSSQMIKKMAEIEGFNYEETLTGFKWI 426
           EIG+LFA FE +KY    I  +  H L M+NSTVSSQMIKKMA++E F+YE+TLTGFKWI
Sbjct: 354 EIGFLFASFELEKYMSQDIEWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWI 413

Query: 427 GNRAIDLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQIDKMDPYEI 486
           GNRA+DL  +G  VPFG+EEAIGYMFPTM  DKDG++A V+F+ A+ YW   D   P++I
Sbjct: 414 GNRALDLQGQGYYVPFGFEEAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDI 473

Query: 487 IQLGFKKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDKGVSEGNKKYPDHIGEEFKIIK 546
           ++ GFKK+G F EYNGYY Y D   TK+IFD+VRY YD   + GN  YP +IG+EFKI  
Sbjct: 474 LEKGFKKFGFFKEYNGYYIYDDPKTTKQIFDFVRYQYD---TSGN-PYPKNIGKEFKIEV 529

Query: 547 YRDLTTGYQSDTPDNKPLLPVDPSSQMITVEMIPTDNESDGSIRLTIRGSGTEPKLKVYI 606
           +RDLTTGYQS+T DN P LPVDP S+MIT+E +P  +     +R T+RGSGTEPKLK+YI
Sbjct: 530 FRDLTTGYQSNTIDNLPNLPVDPHSEMITIEAVPKQDIGKSKVRFTMRGSGTEPKLKLYI 589

Query: 607 EACSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF 643
           EA + +   A  LA + WNVLK+EW+RP+ TG+TT F
Sbjct: 590 EAVADNEKCAIDLAYEMWNVLKKEWIRPDVTGLTTTF 626

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  754 bits (1947), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/642 (58%), Positives = 477/642 (74%), Gaps = 25/642 (3%)

Query: 5   QQFNALIKDYPEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRITFGTAG 64
           QQF   I   P DL+  + LW +QD+D  T +E+  LCK ++  ELH+RFD+RI FGTAG
Sbjct: 3   QQFLGTI---PSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAG 59

Query: 65  LRSTMEAGFSRMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFAKIAAT 124
           LRS M+AGFSRMN L ++QASQGLATY++    N    L+AV+GHDHR+HSK+FA+  AT
Sbjct: 60  LRSQMQAGFSRMNNLVIIQASQGLATYIRQQFPNN---LVAVVGHDHRFHSKKFARATAT 116

Query: 125 VFLIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNLKASVGVMVTASHNPKMDNGYKV 184
            FL+ GFKV+YLN          +FVHTP+VPF V  L ASVGVM+TASHNPKMDNGYKV
Sbjct: 117 AFLLKGFKVHYLNPGQ-------EFVHTPLVPFAVDELNASVGVMITASHNPKMDNGYKV 169

Query: 185 YYSNGCQIIPPHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLNDYITQ 244
           YYSNGCQIIPPHD  IS  ID NLEPW N+WN+ +I++    +G L+Y R+ ML  Y+ +
Sbjct: 170 YYSNGCQIIPPHDQAISNAIDMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEK 229

Query: 245 LEEKLTSKDIIHLSKKIDVKSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFIVVEEQ 304
           + + L     +    K++V+SKPWFVYTPMHGVG++IF+ I  + + + EG+D++ V EQ
Sbjct: 230 ISDNLVETTPL----KLEVRSKPWFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQ 285

Query: 305 KHPDPGFPTVSFPNPEEKGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQGTWH 364
           ++PDP FPTV FPNPEEKGA+++G++LAE + ISL+IANDPDADRFS+A+K   S G W 
Sbjct: 286 QNPDPSFPTVGFPNPEEKGALNIGMRLAEKHDISLLIANDPDADRFSVAIKDMQS-GMWQ 344

Query: 365 QFTGNEIGYLFAYFEFQKYKISK---QDLHRLYMVNSTVSSQMIKKMAEIEGFNYEETLT 421
           Q TGNEIG+LFA+FEF+K+K      Q  H L M++STVSSQMIK+MAE+EGF+YE+TLT
Sbjct: 345 QLTGNEIGFLFAFFEFEKFKSMDEQFQQTHPLAMLSSTVSSQMIKRMAEVEGFHYEDTLT 404

Query: 422 GFKWIGNRAIDLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQIDKM 481
           GFKWIGNRAI L  +G  VPFG+EEAIGYMFP ME DKDGI+A+V+F+QA+  W   + +
Sbjct: 405 GFKWIGNRAIILEKEGYYVPFGFEEAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNL 464

Query: 482 DPYEIIQLGFKKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDKGVSEGNKKYPDHIGEE 541
           DP  +++ GFKKYGVF EYNGYY   +  +TK+IF Y+R  Y    +  N  YP +IGEE
Sbjct: 465 DPINVLENGFKKYGVFKEYNGYYIVPNPIVTKEIFKYIRDVY----TPRNVPYPPYIGEE 520

Query: 542 FKIIKYRDLTTGYQSDTPDNKPLLPVDPSSQMITVEMIPTDNESDGSIRLTIRGSGTEPK 601
            +++ YRDLTTGYQSDT D+KP LPVDP+SQMITV   P D+  +  IR TIRGSGTEPK
Sbjct: 521 IRVLCYRDLTTGYQSDTLDHKPTLPVDPTSQMITVFARPNDSNGNEHIRFTIRGSGTEPK 580

Query: 602 LKVYIEACSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF 643
           LKVYIE  +     ASFLAK  W+VL+REW RPE+T ITT F
Sbjct: 581 LKVYIETRANEERRASFLAKLTWDVLRREWFRPEKTNITTNF 622

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score =  749 bits (1934), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/643 (58%), Positives = 473/643 (73%), Gaps = 21/643 (3%)

Query: 4   EQQFNALIKDYPEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRITFGTA 63
           +Q+   L+   PEDL++K+ +W   D +  T  E+ +LC + ++ ELH+RFD RI FGTA
Sbjct: 5   DQEIENLLSSIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIVFGTA 64

Query: 64  GLRSTMEAGFSRMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFAKIAA 123
           GLRS MEAGF+RMN LTVLQ++QGLA+Y+K+   +    L AV+GHDHRYHSKEFA+I A
Sbjct: 65  GLRSRMEAGFNRMNALTVLQSTQGLASYIKSQFPSN---LTAVVGHDHRYHSKEFAQITA 121

Query: 124 TVFLIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNLKASVGVMVTASHNPKMDNGYK 183
            VFL AGFKVYYLN      P D +FVHTPMVPF +    AS+GVM+TASHNP+MDNGYK
Sbjct: 122 AVFLNAGFKVYYLN------PND-EFVHTPMVPFGINLYSASIGVMITASHNPEMDNGYK 174

Query: 184 VYYSNGCQIIPPHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLNDYIT 243
           VYY+NGCQIIPPHD  I++CI+ NLEP  ++WN + +++ A     LIY ++ +L  Y+ 
Sbjct: 175 VYYNNGCQIIPPHDKNIAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYML 234

Query: 244 QLEEKLTSKDIIHLSKKIDVKSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFIVVEE 303
            L++ +  K+I  L   I  K KPWFVYTPMHGVGY+IF +IS+  L++ E  D++ V+E
Sbjct: 235 NLDKYIIPKNI-SLGTTIKGK-KPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKE 292

Query: 304 QKHPDPGFPTVSFPNPEEKGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQGTW 363
           Q  PDP FPTVSFPNPEEKGA+D+GIK A+ + I LV+ANDPDADRFS+AV++  +   +
Sbjct: 293 QIVPDPSFPTVSFPNPEEKGALDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTD-EF 351

Query: 364 HQFTGNEIGYLFAYFEFQKYKISKQDLHR---LYMVNSTVSSQMIKKMAEIEGFNYEETL 420
            Q TGNEIG+LFAYF +++Y +   D      L M+NSTVSSQMIKKMAE+EGF YE+TL
Sbjct: 352 QQLTGNEIGFLFAYFLWEQYSMLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTL 411

Query: 421 TGFKWIGNRAIDLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQIDK 480
           TGFKWIGN+A +L  +G  VPFG+EEAIGYMFP ME DKDGI ATV+F+QA+  W   +K
Sbjct: 412 TGFKWIGNKARELEKEGYYVPFGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNK 471

Query: 481 MDPYEIIQLGFKKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDKGVSEGNKKYPDHIGE 540
              ++II+ GFKKYGVF EYNGYY   DL +TK IFD +R +         +KY  HIG 
Sbjct: 472 QSLFDIIETGFKKYGVFKEYNGYYIVNDLSLTKIIFDNIREN-----KNDKEKYVSHIGT 526

Query: 541 EFKIIKYRDLTTGYQSDTPDNKPLLPVDPSSQMITVEMIPTDNESDGSIRLTIRGSGTEP 600
           EFK+I +RDLT GYQSDT  N P LPVDPSSQMIT+ +IPT    +GS+R TIRGSGTEP
Sbjct: 527 EFKVITFRDLTLGYQSDTIGNVPTLPVDPSSQMITMTIIPTSLPENGSVRFTIRGSGTEP 586

Query: 601 KLKVYIEACSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF 643
           KLKVYIEA +++  EA+ LAK  W+VLKREW   E+TG+TT F
Sbjct: 587 KLKVYIEANAKTEAEANRLAKLTWDVLKREWFSSEKTGLTTNF 629

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score =  738 bits (1905), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/649 (57%), Positives = 465/649 (71%), Gaps = 24/649 (3%)

Query: 1   MSDEQQFNALIKDYPEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRITF 60
           +S   +F+++++  P DL+ KV  WL QDK+  T  E+I LCK+ ++ ELH+RFD+RI F
Sbjct: 2   VSSNSEFDSVLETLPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRILF 61

Query: 61  GTAGLRSTMEAGFSRMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFAK 120
           GTAGLRS MEAGFSRMNTL VLQA+QGLATY+K   +     L AVIGHDHRYHSKEFA+
Sbjct: 62  GTAGLRSKMEAGFSRMNTLVVLQATQGLATYIK---QQFPSNLKAVIGHDHRYHSKEFAE 118

Query: 121 IAATVFLIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNLKASVGVMVTASHNPKMDN 180
           IA +VFL AGF VY LN           FVHTP+VPFTV  + ASVGVM+TASHNPKMDN
Sbjct: 119 IATSVFLSAGFTVYNLNPPG-------TFVHTPLVPFTVDQIGASVGVMITASHNPKMDN 171

Query: 181 GYKVYYSNGCQIIPPHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLND 240
           GYKVYYSNGCQIIPP D+ I++CID NLEPW NSW+  + +    S   LIY R+ ML  
Sbjct: 172 GYKVYYSNGCQIIPPVDASIAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLA 231

Query: 241 YITQLEEKLTSKDIIHLSKKIDVKSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFIV 300
           Y  +++  +  K  I   ++ D   KPWFVYTPMHGVGYEIFT +  E +++KE  D++ 
Sbjct: 232 YSDKVDNNIIDKKTI---REFDEHRKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLT 288

Query: 301 VEEQKHPDPGFPTVSFPNPEEKGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQ 360
           V+EQ  PDP FPT+SFPNPEEKGA+DM I LA++N ISLVIANDPDADRFS A+ +  S 
Sbjct: 289 VKEQIVPDPAFPTISFPNPEEKGALDMAIALAKENDISLVIANDPDADRFSAAIYNSHS- 347

Query: 361 GTWHQFTGNEIGYLFAYFEFQKYKISKQDL---HRLYMVNSTVSSQMIKKMAEIEGFNYE 417
           G W Q TGNEIG+LF Y+ F KY     +    H L M+NSTVSS+M+K MA+ E F + 
Sbjct: 348 GEWQQLTGNEIGFLFGYYLFNKYTNMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFI 407

Query: 418 ETLTGFKWIGNRAIDLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQ 477
           +TLTGFKWIGN+AIDL  +G  V FGYEEAIGYMFP ME DKDGI A+V+F+QA+  W+ 
Sbjct: 408 DTLTGFKWIGNKAIDLKKEGYHVVFGYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDN 467

Query: 478 IDKMDPYEIIQLGFKKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDKGVSEGNKKYPDH 537
           + K+   +I++ G +KYG F EYNGYY  ++  +T  IF Y+R +Y K    GN +YP  
Sbjct: 468 LSKVTVIDILEQGIEKYGAFKEYNGYYVVSNPQVTNDIFHYIRNEYPKN---GN-QYPKM 523

Query: 538 IGEEFKIIKYRDLTTGYQSDTPDNKPLLPVDPSSQMITVEMIPTDNE---SDGSIRLTIR 594
           IG   ++  +RDLTTG+QSDT DN P LPVDPSSQMIT+     D+E   SD  +R T+R
Sbjct: 524 IGTLLEVCSFRDLTTGFQSDTVDNIPSLPVDPSSQMITITAKICDDEYQKSDSIVRFTMR 583

Query: 595 GSGTEPKLKVYIEACSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF 643
           GSGTEPKLK+YIE  S+    AS +AK  W+VLK+EW+RPE TG+TT++
Sbjct: 584 GSGTEPKLKLYIEGHSKDPIAASKIAKLTWDVLKKEWIRPEVTGVTTSY 632

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score =  734 bits (1894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/639 (57%), Positives = 460/639 (71%), Gaps = 26/639 (4%)

Query: 10  LIKDYPEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRITFGTAGLRSTM 69
           ++++ PE LQ ++L WL  DK++ TR+E++DLC+  +  EL+ RF  RI FGTAGLRS M
Sbjct: 8   ILQNAPEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGTAGLRSRM 67

Query: 70  EAGFSRMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFAKIAATVFLIA 129
           EAG +R+N+L +LQA+QGLA Y+   A    +  +AV+GHDHR+HSKEFA + A VFL A
Sbjct: 68  EAGTNRLNSLVILQATQGLARYI---ASQFPKNKVAVVGHDHRFHSKEFATVTAAVFLRA 124

Query: 130 GFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNLKASVGVMVTASHNPKMDNGYKVYYSNG 189
           GFKV YLN      P D   VHTP+VPFTV +L ASVGVM+TASHNPKMDNGYKVY++NG
Sbjct: 125 GFKVLYLN------PGDT-LVHTPLVPFTVDHLNASVGVMITASHNPKMDNGYKVYFANG 177

Query: 190 CQIIPPHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLNDYITQLEEKL 249
           CQIIPPHD  I++ ID NLEPWE SW++  ++  AE +  ++Y +D M     TQL  K 
Sbjct: 178 CQIIPPHDLNIARSIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQM-----TQLYTKT 232

Query: 250 TSKDIIHLSKKI-DVKSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFIVVEEQKHPD 308
               +I   K + +  S PWFVYTPMHGVG EIF++IS ++L +KE ED++ V EQKHPD
Sbjct: 233 AELQLIGGRKVLRNPGSGPWFVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPD 292

Query: 309 PGFPTVSFPNPEEKGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQGTWHQFTG 368
           P FPTVSFPNPEEKGA+D  I+LA  NGI+LVIANDPDADRFS+AV    +   W Q TG
Sbjct: 293 PSFPTVSFPNPEEKGALDKAIELASQNGINLVIANDPDADRFSLAVFDSKT-ANWRQLTG 351

Query: 369 NEIGYLFAYFEFQKYKISK---QDLHRLYMVNSTVSSQMIKKMAEIEGFNYEETLTGFKW 425
           NEIG+LFAY +F+ YK      Q  H L ++NSTVSSQMIKKMAE+EGF+YE+TLTGFKW
Sbjct: 352 NEIGFLFAYQQFEMYKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKW 411

Query: 426 IGNRAIDLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQIDKMDPYE 485
           IGNRA DL  KG   PFGYEEAIGYMF  ME DKDGI+A+++F+ ++ +W       P +
Sbjct: 412 IGNRARDLEKKGFFAPFGYEEAIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLD 471

Query: 486 IIQLGFKKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDKGVSEGNKKYPDHIGEEFKII 545
           I++ G+KKYGVF EYNGYY   +  I K+ FDY+R D   G      +YP+ IG EF+++
Sbjct: 472 ILEDGYKKYGVFKEYNGYYIVDNPKIMKETFDYIRNDRKPGT-----QYPEAIGSEFQVV 526

Query: 546 KYRDLTTGYQSDTPDNKPLLPVDPSSQMITVEMIPT-DNESDGSIRLTIRGSGTEPKLKV 604
            +RDLT G+QSDT D+ P LPVDP+SQMITV   PT DN     +R TIRGSGTEPKLKV
Sbjct: 527 SFRDLTLGFQSDTSDHIPTLPVDPNSQMITVCAKPTHDNVERDHVRFTIRGSGTEPKLKV 586

Query: 605 YIEACSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF 643
           YIEACS S T A  LAKQ W+ L+  W RP+ TG+ T F
Sbjct: 587 YIEACSGSETGAQQLAKQMWDTLQEVWFRPQTTGLVTDF 625

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score =  728 bits (1878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/635 (56%), Positives = 449/635 (70%), Gaps = 25/635 (3%)

Query: 15  PEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRITFGTAGLRSTMEAGFS 74
           P+DL++ V LWL  DK+  TR E+++L +  + +ELH R D RI+FGTAGLRS MEAGFS
Sbjct: 9   PDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLRSRMEAGFS 68

Query: 75  RMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFAKIAATVFLIAGFKVY 134
           RMNTLTVLQASQGLA+Y+K+      + L  ++GHDHRYHS EFA++  T FL  GFKVY
Sbjct: 69  RMNTLTVLQASQGLASYIKSQFP---ENLSVIVGHDHRYHSNEFARVTVTAFLQLGFKVY 125

Query: 135 YLNDDSLEDPRDNKFVHTPMVPFTVKNLKASVGVMVTASHNPKMDNGYKVYYSNGCQIIP 194
           YLN  S +      FVHTPMVPFT+  L AS G+M+TASHNPKMDNGYKVYYSNGCQIIP
Sbjct: 126 YLNLSSKDS--TETFVHTPMVPFTINQLNASAGIMITASHNPKMDNGYKVYYSNGCQIIP 183

Query: 195 PHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLNDYITQLEEKLTSKDI 254
           PHD  IS+ ID NL PW  +W+  E++  A   G L   ++ + + YI  + ++L    +
Sbjct: 184 PHDRLISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELVRVPM 243

Query: 255 IHLSKKIDVKSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFIVVEEQKHPDPGFPTV 314
           +   K       PWFVYTPMHGVG+EIF +I+   L +KEG+ ++ V EQ+ PDP FPTV
Sbjct: 244 LDCDK-------PWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTV 296

Query: 315 SFPNPEEKGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQGTWHQFTGNEIGYL 374
           SFPNPEEKGA+D+ I LAE+  I LVIANDPDADRFS+AVK+      W Q TGNEIG+L
Sbjct: 297 SFPNPEEKGALDLSIALAEEQDIRLVIANDPDADRFSVAVKNGDR---WSQLTGNEIGFL 353

Query: 375 FAYFEFQKYKI---SKQDLHRLYMVNSTVSSQMIKKMAEIEGFNYEETLTGFKWIGNRAI 431
           FAY+++Q Y+    S +  H L M+NSTVSSQMIK +AE E F+YE+TLTGFKW+GNRA 
Sbjct: 354 FAYYQWQDYQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAF 413

Query: 432 DLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQIDKMDPYEIIQLGF 491
           +L  +G  VPF YEEAIGYMFP +E DKDGI+A V+F+Q +  W   D+M P +++  GF
Sbjct: 414 ELETQGYYVPFAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGF 473

Query: 492 KKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDKGVSEGNKKYPDHIGEEFKIIKYRDLT 551
            KYGVF EYNGYY    L +TK++FDY+R DY    +     YP  IG EF +I +RDLT
Sbjct: 474 GKYGVFKEYNGYYIVPRLSLTKEVFDYIREDY----TPSGHAYPPAIGSEFSVISFRDLT 529

Query: 552 TGYQSDTPDNKPLLPVDPSSQMITVEMIPTDNESDGS---IRLTIRGSGTEPKLKVYIEA 608
           TGYQSDT DN P LPVD SSQMIT  + P++ +   S   +R TIRGSGTEPKLKVYIEA
Sbjct: 530 TGYQSDTIDNVPNLPVDASSQMITATLRPSNGKESTSGEQVRFTIRGSGTEPKLKVYIEA 589

Query: 609 CSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF 643
            S     A  LA++ W VL+REW RPE+TG+ T F
Sbjct: 590 KSTDEKRAQHLARETWQVLRREWFRPERTGLETKF 624

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score =  723 bits (1865), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/645 (56%), Positives = 452/645 (70%), Gaps = 25/645 (3%)

Query: 2   SDEQQFNALIKDYPEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRITFG 61
           SDE++   +I   P DL + V  WL QD +  TR EI++LCK+ +  ELH+R D+RI FG
Sbjct: 8   SDEKE---VINSVPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTRILFG 64

Query: 62  TAGLRSTMEAGFSRMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFAKI 121
           TAGLRS MEAGFSRMNTL VLQA+QGLA ++K   K     L AV+GHDHR++S+EFA  
Sbjct: 65  TAGLRSRMEAGFSRMNTLVVLQATQGLAQHIK---KQFPDALTAVVGHDHRFNSQEFALA 121

Query: 122 AATVFLIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNLKASVGVMVTASHNPKMDNG 181
               FL AGFKV +LND        +KFVHTP+VPFTV  + ASVGVM+TASHNPKMDNG
Sbjct: 122 TVATFLQAGFKVIFLNDG-------DKFVHTPIVPFTVNEVGASVGVMITASHNPKMDNG 174

Query: 182 YKVYYSNGCQIIPPHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLNDY 241
           YKVYYSNGCQIIPPHDS I+Q I+ NL  W  +W + E++        L+Y  + M+  Y
Sbjct: 175 YKVYYSNGCQIIPPHDSEIAQSIEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERY 234

Query: 242 ITQLEEKLTSKDIIHLSKKIDVKSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFIVV 301
             ++ + L  +  I   K+     KPWFVYTP+HGVGY+IF +I+ E +++  G D++ V
Sbjct: 235 TKKMGQSLVDRTTISAEKE----GKPWFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCV 290

Query: 302 EEQKHPDPGFPTVSFPNPEEKGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQG 361
           +EQ+ PDP FPTV FPNPEEKGA+DM I +A+ NGISLV+ANDPDADRFS AVK   + G
Sbjct: 291 KEQQLPDPSFPTVPFPNPEEKGALDMAISVADKNGISLVLANDPDADRFSAAVKDNKT-G 349

Query: 362 TWHQFTGNEIGYLFAYFEFQKYKISKQDL---HRLYMVNSTVSSQMIKKMAEIEGFNYEE 418
           TW Q TGNEIG LFA++EFQKY+   ++    H L M+NSTVSSQ+I KMAEIE F+Y +
Sbjct: 350 TWRQLTGNEIGALFAFYEFQKYQKKNEEYKEKHPLAMLNSTVSSQLIMKMAEIEQFHYID 409

Query: 419 TLTGFKWIGNRAIDLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQI 478
           TLTGFKWIGNR +DL      VPFG+EEAIGYMFP ME DKDGI+A  +F+Q +  W   
Sbjct: 410 TLTGFKWIGNRTLDLEAMNYYVPFGFEEAIGYMFPVMEHDKDGISAASVFLQMYRKWLVG 469

Query: 479 DKMDPYEIIQLGFKKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDKGVSEGNKKYPDHI 538
            K     +++  F+KYGVF EYNGYY   D  + K++FD++R DY    SE +  YP  I
Sbjct: 470 SKKTLLTVLEDIFEKYGVFKEYNGYYSVNDPKVIKEVFDFIRNDY----SETHDPYPSRI 525

Query: 539 GEEFKIIKYRDLTTGYQSDTPDNKPLLPVDPSSQMITVEMIPTDNESDGSIRLTIRGSGT 598
           GEE K+ K+RDLT GYQSDT + +P LPVDP+SQMIT        +   S+R TIRGSGT
Sbjct: 526 GEELKVNKFRDLTLGYQSDTVNQRPDLPVDPNSQMITAWTKVNGAKPYESVRFTIRGSGT 585

Query: 599 EPKLKVYIEACSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF 643
           EPKLKVYIEACS+S   AS LA+  W VLKREW RP+ TG+TT F
Sbjct: 586 EPKLKVYIEACSKSEERASELAQLTWRVLKREWFRPDVTGLTTTF 630

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score =  716 bits (1848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/636 (55%), Positives = 452/636 (71%), Gaps = 28/636 (4%)

Query: 13  DYPEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRITFGTAGLRSTMEAG 72
           D P +L+  +  WL+ DK++ TR E+I LC   N  ELH+RFDSRI FGTAGLR+ MEAG
Sbjct: 5   DIPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAGLRARMEAG 64

Query: 73  FSRMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFAKIAATVFLIAGFK 132
            +R+N L +LQASQGLATY+K+      Q L AV+GHDHRYHS+EFA++ A  F+ AGFK
Sbjct: 65  TNRLNKLVILQASQGLATYIKDKFP---QNLTAVVGHDHRYHSQEFAQVTAATFIRAGFK 121

Query: 133 VYYLNDDSLEDPRDNKFVHTPMVPFTVKNLKASVGVMVTASHNPKMDNGYKVYYSNGCQI 192
           VYYLN      P D +FVHTPMVP++V +L ASVGVM+TASHNPKMDNGYKVYY+NGCQI
Sbjct: 122 VYYLN------PHD-EFVHTPMVPYSVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQI 174

Query: 193 IPPHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLNDYITQLEEKLTSK 252
           IPPHD GI++ I+ NLEPW   WN+ +I++NAE+ G + Y R  ML  Y+  +  +L  +
Sbjct: 175 IPPHDHGIAETINNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLIQR 234

Query: 253 DIIHLSKKIDVKSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFIVVEEQKHPDPGFP 312
           D     +      KPWFVYTPMHGVG++IF+ I NE L++K+  D+I V EQK PDP F 
Sbjct: 235 DFAAPDE------KPWFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFR 288

Query: 313 TVSFPNPEEKGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQGTWHQFTGNEIG 372
           TVSFPNPEEKGA+++ I LAE NGI LV+ANDP+ADRFS+AV+   S+  W Q TGNEIG
Sbjct: 289 TVSFPNPEEKGALNLAITLAEANGIKLVLANDPNADRFSVAVRDD-SKNEWKQLTGNEIG 347

Query: 373 YLFAYFEFQKY-KISKQDLHR--LYMVNSTVSSQMIKKMAEIEGFNYEETLTGFKWIGNR 429
            LFA++EF+ Y K + + +    L M+NSTVS+Q+IK+MAE EGF Y++TLTGFKWIGN 
Sbjct: 348 LLFAFYEFKMYQKAADKGIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNE 407

Query: 430 AIDLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQIDKMDPYEIIQL 489
           A  L  KG  VPFGYEEAIGYMFP ME DKDG++A ++F+QA+  W Q    +P +II  
Sbjct: 408 AAKLEEKGYFVPFGYEEAIGYMFPAMEHDKDGVSAAIVFLQAYANWLQ-SSSNPIDIIHE 466

Query: 490 GFKKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDK-GVSEGNKKYPDHIGEEFKIIKYR 548
            + KYGV  EYNGYY  +D   T K+F+ +R  Y   G+S     +P+ IGE F++ ++R
Sbjct: 467 CYDKYGVSAEYNGYYIVSDPSKTDKVFESIRSSYTSMGLS-----FPESIGEHFRVTEFR 521

Query: 549 DLTTGYQSDTPDNKPLLPVDPSSQMITVEMIPTDNESDG-SIRLTIRGSGTEPKLKVYIE 607
           DLT G+ S T D KPLLPVD +SQMIT+  +P+   + G S+R TIRGSGTEPKLKVYIE
Sbjct: 522 DLTIGFDSTTADKKPLLPVDKNSQMITITAVPSGASNTGESVRFTIRGSGTEPKLKVYIE 581

Query: 608 ACSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF 643
             S +   A  LAK  W  LK EW +P   G++T F
Sbjct: 582 GISSTEGRARILAKSLWETLKHEWFKPSSNGLSTDF 617

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score =  709 bits (1829), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/636 (54%), Positives = 440/636 (69%), Gaps = 31/636 (4%)

Query: 15  PEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRITFGTAGLRSTMEAGFS 74
           P DL+  V  W E DK++ TR EI+ L    N  ELH+R D RI+FGTAGLRS MEAGFS
Sbjct: 9   PADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLRSKMEAGFS 68

Query: 75  RMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFAKIAATVFLIAGFKVY 134
           RMNTLTVLQASQGLA Y+   A+   +     +GHDHR++S++FA++ +  FL   FKVY
Sbjct: 69  RMNTLTVLQASQGLAKYI---AEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQLRFKVY 125

Query: 135 YLNDDSLEDPRDNKFVHTPMVPFTVKNLKASVGVMVTASHNPKMDNGYKVYYSNGCQIIP 194
            L  ++  DP+ + FVHTPMVPF +  L AS GVM+TASHNPKMDNGYKVYYSNGCQIIP
Sbjct: 126 SLGFNA--DPKKDAFVHTPMVPFAIDRLGASAGVMITASHNPKMDNGYKVYYSNGCQIIP 183

Query: 195 PHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLNDYITQLEEKLTSKDI 254
           PHD  I+Q I  NL PWE +W+ K ++A A  KG  +  +  M++ Y+ ++ +KL S D 
Sbjct: 184 PHDRLIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLVSSD- 242

Query: 255 IHLSKKIDVKSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFIVVEEQKHPDPGFPTV 314
                 I  +SKPWFVYTP+HGVG+EIF +I++E+L + EG D+  V E K PDP FPTV
Sbjct: 243 ------IGDRSKPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTV 296

Query: 315 SFPNPEEKGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQGTWHQFTGNEIGYL 374
           SFPNPEE GA+D+ I LA+ NGIS V+ NDPDADRFS AVK    QG W Q TGNEIG+L
Sbjct: 297 SFPNPEEAGALDLAIALADKNGISFVLGNDPDADRFSAAVK---HQGKWRQLTGNEIGFL 353

Query: 375 FAYFEFQKYKISKQDL---HRLYMVNSTVSSQMIKKMAEIEGFNYEETLTGFKWIGNRAI 431
           FA F ++KY+    +    + L ++NSTVSSQMIKK+A +E F+YE+TLTGFKW+GNRA 
Sbjct: 354 FAQFVWEKYQKESSEFKLENPLALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRAR 413

Query: 432 DLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQIDKMDPYEIIQLGF 491
            L + G  VPF YEEAIG+MF  +  DKDG++A V+F+Q    W +   + P +++Q  F
Sbjct: 414 QLESSGYYVPFAYEEAIGFMFSDIVHDKDGVSAAVVFLQMLWSWKK-QALSPIDVLQSAF 472

Query: 492 KKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDKGVSEGNKKYPDHIGEEFKIIKYRDLT 551
            KYGVF EYNGYY   DL +T +IF  +R  YD         YP HIG +F ++ + DLT
Sbjct: 473 GKYGVFKEYNGYYTVPDLSLTDRIFSDIRSSYD--------SYPKHIGNQFDVVSFTDLT 524

Query: 552 TGYQSDTPDNKPLLPVDPSSQMITVEMIPTDNESDGS----IRLTIRGSGTEPKLKVYIE 607
            G+QSDT DN P LPVDPSSQMI   ++P+ +   G+    +R T RGSGTEPKLKVYIE
Sbjct: 525 KGFQSDTADNTPRLPVDPSSQMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPKLKVYIE 584

Query: 608 ACSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF 643
           A S   T AS LA+  WNVL+ EW +P++TG++T F
Sbjct: 585 ATSVEETRASDLARTTWNVLRDEWFKPKETGLSTKF 620

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score =  707 bits (1824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/635 (56%), Positives = 456/635 (71%), Gaps = 36/635 (5%)

Query: 15  PEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRITFGTAGLRSTMEAGFS 74
           PE+L++ + LWL QD+++ T KEI +LC + N  ELHER +SR+ FGTAGLR+ MEAGFS
Sbjct: 6   PENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARMEAGFS 65

Query: 75  RMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFAKIAATVFLIAGFKVY 134
           RMNTL V+QA+QGLA Y+K   K     L+AV+GHDHR++S +FAK  ATV L AGF+V+
Sbjct: 66  RMNTLVVIQATQGLAQYIK---KQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFEVH 122

Query: 135 YLNDDSLEDPRDNKFVHTPMVPFTVKNLKASVGVMVTASHNPKMDNGYKVYYSNGCQIIP 194
           YLN       + + +VHTPMVPFTV  +KASVGVM+TASHNPK+DNGYKVYY+NGCQIIP
Sbjct: 123 YLN-------QGDSYVHTPMVPFTVDRVKASVGVMITASHNPKLDNGYKVYYANGCQIIP 175

Query: 195 PHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLNDYITQLEEKLTSKDI 254
           PHDS I++ I++NLEP    W++ + M  A  +G LIY RD ML  YI+ +++   ++  
Sbjct: 176 PHDSAIARSIESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCVKDSFVTE-- 233

Query: 255 IHLSKKIDV--KSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFIVVEEQKHPDPGFP 312
                 +D   K KPWFVYTPMHGVGY++F +I+++IL ++   DF+VV EQ +PDP FP
Sbjct: 234 ------LDSLPKGKPWFVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFP 287

Query: 313 TVSFPNPEEKGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQGTWHQFTGNEIG 372
           TV FPNPEEKGA+D+ IKLAE++GI LVIA+DPDADRFS+A   KG  G W Q +GN+IG
Sbjct: 288 TVQFPNPEEKGALDLAIKLAENHGIKLVIASDPDADRFSVAF--KGPHG-WQQLSGNDIG 344

Query: 373 YLFAYFEFQKYK---ISKQDLHRLYMVNSTVSSQMIKKMAEIEGFNYEETLTGFKWIGNR 429
           +LFAY+E QKY+      Q  H L M+NSTVSSQMI  MA +EGF++E+TLTGFKWIGNR
Sbjct: 345 FLFAYYELQKYRGFDAEYQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNR 404

Query: 430 AIDLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQIDKMDPYEIIQL 489
           A++L  +G  VPFG+EEAIGYMFP  E DKDGI+A V+F+QA+  W    K  P +I+  
Sbjct: 405 ALELEARGYYVPFGFEEAIGYMFPATEHDKDGISAAVVFLQAYHSWISQGK-SPLDILDE 463

Query: 490 GFKKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDKGVSEGNKKYPDHIGEEFKIIKYRD 549
              KYGVF EYNGYY   +  +T K F Y+R DY    +   + YP  IG + ++  +RD
Sbjct: 464 ASAKYGVFREYNGYYLVDEPSLTNKTFAYIREDY----TPKGENYPRTIG-DLQVKTFRD 518

Query: 550 LTTGYQSDTPDNKPLLPVDPSSQMITVEMIPTDNESDGSIRLTIRGSGTEPKLKVYIEAC 609
           LTTGYQSDTP+N P L VDPSSQMIT+   P    S   +R T+RGSGTEPKLKVYIEA 
Sbjct: 519 LTTGYQSDTPNNIPNLHVDPSSQMITIVAQPKGGGSGEHVRFTLRGSGTEPKLKVYIEAG 578

Query: 610 SRSATEASFLAKQAWNVLKREWM-RPEQTGITTAF 643
           ++S   A  LA+Q W++L+ EW  RP   G+TT F
Sbjct: 579 AQSDPRARELARQTWDILREEWFNRP---GLTTKF 610

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score =  704 bits (1818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/638 (54%), Positives = 442/638 (69%), Gaps = 31/638 (4%)

Query: 13  DYPEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRITFGTAGLRSTMEAG 72
           + PEDL+  V  WL+ DK++ TR +II L +  +  EL  R + RITFGTAGLRS MEAG
Sbjct: 8   EVPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGLRSRMEAG 67

Query: 73  FSRMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFAKIAATVFLIAGFK 132
           F+RMNTLTVLQASQGLA Y+   A N    L  V+GHDHR++SK+FA++    FL  GFK
Sbjct: 68  FNRMNTLTVLQASQGLAKYI---ASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQLGFK 124

Query: 133 VYYLNDDSLEDPRDNKFVHTPMVPFTVKNLKASVGVMVTASHNPKMDNGYKVYYSNGCQI 192
           VY L     ED   +  VHTPMVPF + +L+AS G+M+TASHNPKMDNGYKVYYSNGCQI
Sbjct: 125 VYDLG--FTEDASQDVVVHTPMVPFGIDHLRASGGIMITASHNPKMDNGYKVYYSNGCQI 182

Query: 193 IPPHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLNDYITQLEEKLTSK 252
           IPPHD  ISQ I ANLEPW+ +W+   + A A     LI  + V+++ Y+  +   L   
Sbjct: 183 IPPHDQRISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSLVIT 242

Query: 253 DIIHLSKKIDVKSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFIVVEEQKHPDPGFP 312
           ++ H          PWFVYTP+HGVG+EIF KI +    + +G D++ VEEQK+PDP FP
Sbjct: 243 NVNH-------TKAPWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFP 295

Query: 313 TVSFPNPEEKGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQGTWHQFTGNEIG 372
           TVSFPNPEEKGA+D  I+LAE + I+ V+ NDPDADRFS+A K  G    W Q TGNEIG
Sbjct: 296 TVSFPNPEEKGALDKAIELAEKHDITFVLGNDPDADRFSVAAKHNGQ---WRQLTGNEIG 352

Query: 373 YLFAYFEFQKYKISKQDL---HRLYMVNSTVSSQMIKKMAEIEGFNYEETLTGFKWIGNR 429
           +LFA ++++ Y++        + L M+NSTVSSQMIKKMAE+EGF+YE+TLTGFKW+GNR
Sbjct: 353 FLFAQYKWETYRLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNR 412

Query: 430 AIDLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQIDKMDPYEIIQL 489
           A +L N G  VPF YEEAIGYMF  +  DKDGI+A V+F+Q    W +   + P++++Q 
Sbjct: 413 ARELENAGYFVPFAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSW-KAQALTPFDVLQR 471

Query: 490 GFKKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDKGVSEGNKKYPDHIGEEFKIIKYRD 549
            ++KYGVF EYNGYY   DL +T K+F         G+  G    P HIG+EF++  Y D
Sbjct: 472 AYQKYGVFKEYNGYYIVPDLSLTDKVF--------SGIRSGFSLQPTHIGQEFRVESYTD 523

Query: 550 LTTGYQSDTPDNKPLLPVDPSSQMITVEMIPTDNES----DGSIRLTIRGSGTEPKLKVY 605
           LTTGYQS+TPD++P LPVDPSSQMIT  + PT +        S+R T RGSGTEPKLKVY
Sbjct: 524 LTTGYQSNTPDSEPRLPVDPSSQMITATLTPTSSTGRQGFSESVRFTARGSGTEPKLKVY 583

Query: 606 IEACSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF 643
           IEA S S   AS LAK+AW+VL+REW +PEQTG+ T F
Sbjct: 584 IEAVSSSEELASALAKKAWDVLRREWFKPEQTGLATNF 621

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score =  688 bits (1775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/644 (52%), Positives = 437/644 (67%), Gaps = 21/644 (3%)

Query: 1   MSDEQQFNALIKDY-PEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRIT 59
           MS +    +LI +Y PE L+     WL  D+++ TR EI+ +    + KEL  R + RI 
Sbjct: 1   MSSQSNILSLIDEYVPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIP 60

Query: 60  FGTAGLRSTMEAGFSRMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFA 119
           FGTAGLR  MEAGF+RMN+L +LQ SQGLA Y+    +   Q L  V+GHDHRYHSKEFA
Sbjct: 61  FGTAGLRGRMEAGFTRMNSLVILQTSQGLAQYI---MEKFPQNLSVVVGHDHRYHSKEFA 117

Query: 120 KIAATVFLIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNLKASVGVMVTASHNPKMD 179
            I    FL AGFKV+YLN +       N+FVHTP+VP++V  L+++ GVM+TASHNPK D
Sbjct: 118 DITVATFLNAGFKVFYLNTE-------NEFVHTPLVPYSVDKLRSACGVMITASHNPKDD 170

Query: 180 NGYKVYYSNGCQIIPPHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLN 239
           NGYKVYYSNGCQIIPPHD  I+  I+ NL PW   WN+K++ +  E  G+L ++ + M  
Sbjct: 171 NGYKVYYSNGCQIIPPHDKNIALTIEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFL 230

Query: 240 DYITQLEEKLTSKDIIHLSKKIDVKSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFI 299
            Y+  +   + +     L        KPWFVYTPMHGVG++IF +I+ ++L + E  D+ 
Sbjct: 231 AYVQDITRYVFTNGSPMLKT-----GKPWFVYTPMHGVGHKIFGQIAKQVLGLSENVDYF 285

Query: 300 VVEEQKHPDPGFPTVSFPNPEEKGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGS 359
            V EQ  PDP FPTVSFPNPEEKGA+DM I+LAE  G++L+IANDPDADRFS AVK K S
Sbjct: 286 SVPEQIKPDPSFPTVSFPNPEEKGALDMAIQLAEREGLTLIIANDPDADRFSAAVKDKRS 345

Query: 360 QGTWHQFTGNEIGYLFAYFEFQKYKISKQDLHRLYMVNSTVSSQMIKKMAEIEGFNYEET 419
              W Q +GNEIG LFA F+ Q++K        L M+NSTVSSQM+KKMA++EGF+YEET
Sbjct: 346 H-EWRQLSGNEIGSLFAIFKLQEHKEKAASRKPLAMLNSTVSSQMLKKMAQVEGFHYEET 404

Query: 420 LTGFKWIGNRAIDLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQID 479
           LTGFKWIGNRA+ L  +G  V FGYEEAIGYMFP ME DKDGI A+V+F+  +  W +++
Sbjct: 405 LTGFKWIGNRALQLEQQGYDVCFGYEEAIGYMFPCMEHDKDGIIASVVFLHMYSKWLELE 464

Query: 480 KMDPYEIIQLGFKKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDKGVSEGNKKYPDHIG 539
            + P +++ L F+KYGVF EYNGYY   +  + + +F Y+R +Y        + YP+ +G
Sbjct: 465 GLGPLDVLDLCFEKYGVFSEYNGYYTVEEPALIESVFSYIRDEY----CPKARPYPEKLG 520

Query: 540 EEFKIIKYRDLTTGYQSDTPDNKPLLPVDPSSQMITVEMIPTDNESDGSIRLTIRGSGTE 599
            EF +  +RDLT GYQSDT D KP LPVD SSQMIT  + P        IR TIRGSGTE
Sbjct: 521 REFFLTSFRDLTLGYQSDTIDFKPTLPVDASSQMITATLKPERTVGHEEIRFTIRGSGTE 580

Query: 600 PKLKVYIEACSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF 643
           PKLKVYIE+ + +   A+ LA   WNVL+REW RPE TG+ T+F
Sbjct: 581 PKLKVYIESHAANKEAAANLAHLTWNVLRREWFRPEITGLKTSF 624

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score =  657 bits (1695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/637 (52%), Positives = 435/637 (68%), Gaps = 39/637 (6%)

Query: 10  LIKDYPEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRITFGTAGLRSTM 69
           +I+  P DLQ KV  WL+ DK + TR EI+ LC   ++ ELH+R D+ I FGTAGLR  M
Sbjct: 6   VIESLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAGLRGRM 65

Query: 70  EAGFSRMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFAKIAATVFLIA 129
           EAGF+RMN LTV QASQGLA Y+K   K   + L  V+GHDHR++S+ F K+    FL  
Sbjct: 66  EAGFNRMNALTVKQASQGLAKYIK---KQFPENLTVVVGHDHRHNSRLFGKVTVDTFLQL 122

Query: 130 GFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNLKASVGVMVTASHNPKMDNGYKVYYSNG 189
           GFKV++LN ++     +   VHTP+VPFTV    ASVG+M+TASHNPKMDNGYKVYY+NG
Sbjct: 123 GFKVFHLNHEN-----EKSLVHTPLVPFTVNATGASVGIMITASHNPKMDNGYKVYYTNG 177

Query: 190 CQIIPPHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLNDYITQLEEKL 249
           CQIIPPHD  I++ I  NLEP+           ++   G +I  ++ M   YI  +   L
Sbjct: 178 CQIIPPHDKLIAESIIHNLEPF-----------SSPQTGTIIDCKEKMTKKYIDAIGSTL 226

Query: 250 TSKDIIHLSKKIDVKSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFIVVEEQKHPDP 309
               +   +KK +   +PWFVYTPMHGVG+EIF  IS ++L ++EG+D++VVEEQK+PD 
Sbjct: 227 IDGAV---NKKTN---EPWFVYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDA 280

Query: 310 GFPTVSFPNPEEKGAIDMGIKLAEDN-GISLVIANDPDADRFSIAVKSKGSQGT--WHQF 366
            FPTVSFPNPEEKGA+D+ ++    N  + L+IANDPDADRFS+AV+      T  W Q 
Sbjct: 281 DFPTVSFPNPEEKGALDLAVEYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQL 340

Query: 367 TGNEIGYLFAYFEFQKYKISKQDLHRLYMVNSTVSSQMIKKMAEIEGFNYEETLTGFKWI 426
           TGNEIG+LFAY+E+++YK S  D   L M+NSTVSSQMIK+MAEIEGF+YE+TLTGFKW+
Sbjct: 341 TGNEIGFLFAYYEWERYKHSPID-EPLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWL 399

Query: 427 GNRAIDLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQIDKMDPYEI 486
           GNRA++L  +G   PF YEEAIGYMF ++  DKDGI+A ++F+QA+  W +       +I
Sbjct: 400 GNRALELEQEGYYTPFAYEEAIGYMFSSVVHDKDGISAAIVFLQAYSKW-RASGQTVLDI 458

Query: 487 IQLGFKKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDKGVSEGNKKYPDHIGEEFKIIK 546
           +     KYG F E+NGYY   DL ITK++FD +R             YP  +G  F+IIK
Sbjct: 459 LATASLKYGHFKEFNGYYIVPDLAITKQVFDAIR--------SIESPYPKKLGSSFEIIK 510

Query: 547 YRDLTTGYQSDTPDNKPLLPVDPSSQMITVEMIPTDNESDGSIRLTIRGSGTEPKLKVYI 606
           +RDLT GYQSDTPD+ P L  DPSSQMIT EM+  +  +   +R TIRGSGTEPKLKVYI
Sbjct: 511 FRDLTNGYQSDTPDHIPELASDPSSQMITCEMLLVEQPT-SRVRFTIRGSGTEPKLKVYI 569

Query: 607 EACSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF 643
           EA + +   +  LAK  W+VL++EW +PE TG+ T F
Sbjct: 570 EARTNTEPNSIALAKFTWDVLRQEWFKPELTGLLTPF 606

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/637 (53%), Positives = 429/637 (67%), Gaps = 29/637 (4%)

Query: 15  PEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRITFGTAGLRSTMEAGFS 74
           P  L+  ++ WL  DK+  T+ EI +L  +    EL +R   RITFGTAGLR+ MEAGFS
Sbjct: 9   PSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLRARMEAGFS 68

Query: 75  RMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFAKIAATVFLIAGFKVY 134
           RMNTLTV+QASQGLA Y+K+   +    L  VIGHDHR+HS+EFA+     FL   + +Y
Sbjct: 69  RMNTLTVIQASQGLARYIKSQFPD---DLKVVIGHDHRFHSREFAEATIAAFLQLDYDIY 125

Query: 135 YLN---DDSLEDPRDNKFVHTPMVPFTVKNLKA---SVGVMVTASHNPKMDNGYKVYYSN 188
           YLN     S ED     FVHTPMVPF + N++    S GVM+TASHNPKMDNGYKVYY+N
Sbjct: 126 YLNYVPPGSDED----VFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYAN 181

Query: 189 GCQIIPPHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLNDYITQLEEK 248
           GCQIIPPHD  I + IDANLEPW  +W+ K ++  A   G L   R  ML  Y   ++  
Sbjct: 182 GCQIIPPHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKYKDSIQTM 241

Query: 249 LTSKDIIHLSKKIDVKSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFIVVEEQKHPD 308
           L  +  +  +        PWFVYTPMHGVGYE F +    +L ++E +D+IVV EQK+PD
Sbjct: 242 LVKQSNLKFA------GGPWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPD 295

Query: 309 PGFPTVSFPNPEEKGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQGTWHQFTG 368
           P FPTVSFPNPEE+GA+DM +K+A+ NGI++V+ANDPDADRFS+AVK     G W+Q TG
Sbjct: 296 PEFPTVSFPNPEERGALDMAMKVADANGITVVLANDPDADRFSVAVK---YHGEWNQLTG 352

Query: 369 NEIGYLFAYFEFQKY-KISKQDLHRLYMVNSTVSSQMIKKMAEIEGFNYEETLTGFKWIG 427
           N+IG LFA  E Q Y K  K D  +L M+ S VSSQ+++KMAE EGF   ETLTGFKW+G
Sbjct: 353 NQIGILFAQAEMQSYFKEPKLDRKQLAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLG 412

Query: 428 NRAIDLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQIDKMDPYEII 487
           NRA +L  +G  VPF YEEAIGYMF  +  DKDGIAA  +F+Q    W ++ K    E++
Sbjct: 413 NRARELELEGYYVPFAYEEAIGYMFSQVVHDKDGIAAAAVFLQMCYEWKKVAK-SSQEVL 471

Query: 488 QLGFKKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDKGVSEGNKKYPDHIGEEFKIIKY 547
           Q  ++KYG F++YNGYY  +   +TK++FDY R +Y    +   K YP HIG EF++   
Sbjct: 472 QECYEKYGYFVDYNGYYISSAPAVTKEVFDYFRNEY----TPAGKPYPSHIGCEFEVEYL 527

Query: 548 RDLTTGYQSDTPDNKPLLPVDPSSQMITVEMIPTDNESDG-SIRLTIRGSGTEPKLKVYI 606
           RDLT GYQSDT  N P LPVD +SQMIT  + P   E+D  S+R T RGSGTEPKLKVYI
Sbjct: 528 RDLTVGYQSDTATNIPDLPVDHNSQMITCVLKPVKMETDCESVRFTARGSGTEPKLKVYI 587

Query: 607 EACSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF 643
           E+C+ +   AS L+  AW+VLKREW RP +TG+ T F
Sbjct: 588 ESCAANHQRASHLSHLAWDVLKREWFRPTETGLQTNF 624

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/637 (52%), Positives = 423/637 (66%), Gaps = 28/637 (4%)

Query: 15  PEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRITFGTAGLRSTMEAGFS 74
           P+DL+ K+  W + DK+  T  EI  L  S N  EL  R   RI+FGTAGLR+ MEAGF+
Sbjct: 14  PDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFGTAGLRARMEAGFA 73

Query: 75  RMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFAKIAATVFLIAGFKVY 134
           RMNTLTV+QASQGLATY+K+   N    L  V+GHDHRY+SK FA++A   FL  GF+VY
Sbjct: 74  RMNTLTVIQASQGLATYIKSQFPNN---LKVVVGHDHRYNSKSFAEVAIAAFLQLGFEVY 130

Query: 135 YLNDDSLEDPRD-NKFVHTPMVPFTVKNLK--ASVGVMVTASHNPKMDNGYKVYYSNGCQ 191
           YLN   +   +D   +VHTPMVPFTV N++  AS G+M+TASHNPKMDNGYKVYYSNGCQ
Sbjct: 131 YLN--YVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNPKMDNGYKVYYSNGCQ 188

Query: 192 IIPPHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLNDYITQLEEKLTS 251
           I PPHD  I+  IDANL PW+ +W+ ++++ +A +   L   +  ++ +Y+ +++  L +
Sbjct: 189 ITPPHDKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQSSLVT 248

Query: 252 KDIIHLSKKIDVKSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFIVVEEQKHPDPGF 311
                 +  +    K WFVYTPMHGVGYEIF  I    LH+KE E ++VV  QK PDP F
Sbjct: 249 ------TNSLADCGKNWFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDPEF 302

Query: 312 PTVSFPNPEEKGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQGTWHQFTGNEI 371
            TVSFPNPEE+GA+++ I+LA  +G  LV+ANDPDADRFS AVK       W Q TGN++
Sbjct: 303 TTVSFPNPEEEGALNLAIELAARSGAELVLANDPDADRFSAAVKDGNK---WKQLTGNQL 359

Query: 372 GYLFAYFEFQKYKISKQDLHRLYMVNSTVSSQMIKKMAEIEGFNYEETLTGFKWIGNRAI 431
           GYLFA  + +K+    ++   L M+ STVSSQMI KMA++EGF + ETLTGFKW+ NRAI
Sbjct: 360 GYLFAVGQLEKFSNQNENKKPLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAI 419

Query: 432 DLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQIDKMDPYEIIQLGF 491
           DL N G  VPF YEEAIGYMF ++  DKDG++A   F+Q    W +  K  P +++  G+
Sbjct: 420 DLENDGFYVPFAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARWKKEGKT-PLDVLNAGY 478

Query: 492 KKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDKGVSEGNK-KYPDHIGEEFKIIKYRDL 550
           +KYG F+EYNGYY   DL I   +F Y+R         GN   YP  IG EF +  +RDL
Sbjct: 479 EKYGNFVEYNGYYSVQDLSIIGDVFKYIR-----NACNGNDVPYPSTIGNEFAVASFRDL 533

Query: 551 TTGYQSDTPDNKPLLPVDPSSQMITVEMIP----TDNESDGSIRLTIRGSGTEPKLKVYI 606
           T GYQSDT ++ P LPV P S MIT  + P    T   S   +R TIRGSGTEPKLKVYI
Sbjct: 534 TVGYQSDTGNHIPNLPVSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYI 593

Query: 607 EACSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF 643
           E+ +     A+ LAK  W+VLKREW RPE TG+ T F
Sbjct: 594 ESNALDKEYATKLAKLTWDVLKREWFRPEVTGLQTKF 630

>KNAG0E02390 Chr5 (475467..477176) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 106/433 (24%), Positives = 174/433 (40%), Gaps = 53/433 (12%)

Query: 106 VIGHDHRYHSKEFAKIAATVFLIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNLK-- 163
           V+G D RY++       A +    G +   +  + L        + TP     ++  K  
Sbjct: 58  VVGGDGRYYNDVILHKIAAIGAANGVRKLVIGQNGL--------LSTPAASHIMRTYKEK 109

Query: 164 ASVGVMVTASHN---PKMDNGYKVYYSNGCQIIPPHDSGISQCIDANLEPWENSWNYKEI 220
            + G+++TASHN   PK D G K   SNG     P  + I + +   L+ ++   +  E+
Sbjct: 110 CTGGIILTASHNPGGPKNDMGIKYNLSNGGPAPEPVTNKIWE-VSKQLDHYKIIPDLPEL 168

Query: 221 ----MANAESKGDLIYHRDVMLNDYITQLEEKL---TSKDIIHLSKKIDVKSKPW-FVYT 272
               +A     G L+        DY+  L+E       K  IH  +      K W  ++ 
Sbjct: 169 ALDTLAENVQYGPLLVDVVDTTRDYVEFLKEIFDFPLIKSFIHKQR----SQKHWKLLFD 224

Query: 273 PMHGVGYEIFTKISNEILHMKEGEDFIVVEEQKHPDPGFPTVSFPNPEEKGAIDMGIKLA 332
            M+GV       I  +   +   E    V +  HP P F  +  P+P    A  +  ++ 
Sbjct: 225 GMNGVTGPYGKAIFVDEFELPAEE----VLQNWHPQPDFGGIH-PDPNLTYARSLVDRVD 279

Query: 333 EDNGISLVIANDPDADRFSIAVKSKGSQGTWHQFTGNEIGYLFAYFEFQKYKISKQDLHR 392
            +N I    A+D D DR  I        G      G+ +  +  Y     Y  +KQ ++ 
Sbjct: 280 REN-IEFGAASDGDGDRNMIY-----GAGPAFVSPGDSVAIIAEYAAEIPY-FAKQGIYG 332

Query: 393 LYMVNSTVSSQMIKKMAEIEGFNYEETLTGFKWIGNRAIDLINKGNIVPFGYEEAIGYMF 452
           L     T S+  I ++AE  G    E  TG+K+       L +   +   G EE+ G   
Sbjct: 333 LARSFPTASA--IDRVAEKHGLKCYEVPTGWKFF----CALFDAKKLSICG-EESFGTGS 385

Query: 453 PTMEIDKDGIAATVIFIQAFMYWNQ--IDKMDPYEIIQLGF-KKYG--VFIEYNGYYRYT 507
             +  +KDG+ A + ++     +N+   D+    +IIQ  F KKYG   F  Y+  Y + 
Sbjct: 386 NHVR-EKDGVWAIIAWLNLLAIYNRRHPDRDVSIKIIQEEFWKKYGRVFFTRYD--YEHV 442

Query: 508 DLGITKKIFDYVR 520
           D    KK+ D +R
Sbjct: 443 DSNSAKKVIDNLR 455

>NCAS0F01470 Chr6 complement(293218..294927) [1710 bp, 569 aa] {ON}
           Anc_2.445 YKL127W
          Length = 569

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 107/450 (23%), Positives = 180/450 (40%), Gaps = 70/450 (15%)

Query: 106 VIGHDHRYHSKEFAKIAATVFLIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNL--K 163
           V+G D RY++       A +    G K   +    L        + TP     ++    K
Sbjct: 58  VVGGDGRYYNDVILHKIAAIGAANGVKKLVIGQRGL--------LSTPAASHIMRTYEEK 109

Query: 164 ASVGVMVTASHNP---KMDNGYKVYYSNGCQIIPPHDSGISQCIDANLEPWENSWNYKEI 220
              G+++TASHNP   K D G K   SNG     P  + I + I   +  ++   ++ E+
Sbjct: 110 TQGGIILTASHNPGGIKNDMGIKFNLSNGGPAPEPVTNKIWE-ISKKMTSFKIIKDFPEL 168

Query: 221 ----MANAESKGDLIYHRDVMLN-----DYITQLEEKLTSKDIIHLSKKIDVKSKPW-FV 270
               +   +  G L+   DV+       +++ Q+ +    K  +H  +     +K W  +
Sbjct: 169 ELETLGKNKKYGPLLV--DVIDTTKAYVEFVKQIFDFDLIKKFVHKQR----DTKHWKLL 222

Query: 271 YTPMHGVGYEIFTKISNEILHMKEGEDFIVVEEQKHPDPGFPTVSFPNPEEKGAIDMGIK 330
           +  M+GV       I  + L +   E    V +Q HP P F  V  P+P    A  +  +
Sbjct: 223 FDGMNGVTGPYGKAIFVDELGLPADE----VLQQWHPSPDFGGVH-PDPNLTYAKALVDR 277

Query: 331 LAEDNGISLVIANDPDADRFSIAVKSKGSQGTWHQFTGNEIGYLFAYFEFQKYKISKQDL 390
           +  +N I    A+D D DR  I        G      G+ +  +  Y     Y  +KQ +
Sbjct: 278 VDREN-IEFGAASDGDGDRNMIY-----GAGPAFVSPGDSVAIIAEYAAEIPY-FAKQGI 330

Query: 391 HRLYMVNSTVSSQMIKKMAEIEGFNYEETLTGFKWIGNRAIDLINKGNIVPFGYEEAIGY 450
           + L    S  +S  I ++A+  G N  E  TG+K+       L +   +   G EE+ G 
Sbjct: 331 YGL--ARSFPTSSAIDRVAKAHGLNCYEVPTGWKFF----CALFDAKKLSICG-EESFGT 383

Query: 451 MFPTMEIDKDGIAATVIFIQAFMYWNQ--IDKMDPYEIIQLGFKKYGVFIEYNGYYRYTD 508
               +  +KDGI A + ++     +N+   D+    +IIQ  F        +N Y R   
Sbjct: 384 GSNHVR-EKDGIWAILAWLNLLAIYNKHHPDRDVSIKIIQDEF--------WNKYGRTF- 433

Query: 509 LGITKKIFDYVRYDYDKGVSEGNKKYPDHI 538
                    + RYDY+K  +E   K  D++
Sbjct: 434 ---------FTRYDYEKVATEDAAKVIDNL 454

>CAGL0K03421g Chr11 complement(314680..316386) [1707 bp, 568 aa]
           {ON} highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105c Phosphoglucomutase 2
          Length = 568

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 94/390 (24%), Positives = 155/390 (39%), Gaps = 52/390 (13%)

Query: 104 IAVIGHDHRYHSKEFAKIAATVFLIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNLK 163
           + V+G D RY++    +  A +    G K   +  + L        + TP     ++  K
Sbjct: 55  VLVVGGDGRYYNDVILQKIAAIGAANGVKKLVIGQNGL--------LSTPAASHIMRTYK 106

Query: 164 --ASVGVMVTASHN---PKMDNGYKVYYSNGCQIIPPHDSGISQCIDANLEPWENSWNYK 218
              + G+++TASHN   P+ D G K   SNG     P  + I + I   L  ++   ++ 
Sbjct: 107 EKCTGGIILTASHNPGGPENDMGIKYNLSNGGPAPEPVTNKIWE-ISKKLTHYKIVKDFP 165

Query: 219 EI----MANAESKGDLIYHRDVM-LNDYITQLEEKLTSKDIIHLSKKIDVKSKPW-FVYT 272
           E+    +   +  G L+   DV+   D   QL +++   ++IH       K K W  +  
Sbjct: 166 ELDLTKLVENKKYGPLLV--DVIDTTDAYIQLLKEIFDFELIHKFIAKQRKEKGWKLLVD 223

Query: 273 PMHGVGYEIFTKISNEILHMKEGEDFIVVEEQKHPDPGFPTVSFPNPEEKGAIDMGIKLA 332
            M+GV        +  I   + G D   V +  HP P F  +  P+P    A  + ++  
Sbjct: 224 SMNGV----TGPYAKAIFVDEFGLDSKEVLQNWHPQPDFGGLH-PDPNLTYAHTL-VERV 277

Query: 333 EDNGISLVIANDPDADR-----FSIAVKSKGSQGTWHQFTGNEIGYLFAYFEFQKYKISK 387
               I    A+D D DR     +  A  S G          NEI Y             K
Sbjct: 278 NKEKIEFGAASDGDGDRNMIYGYGPAFVSPGDSVAIIAEYANEIPYF-----------KK 326

Query: 388 QDLHRLYMVNSTVSSQMIKKMAEIEGFNYEETLTGFKWIGNRAIDLINKGNIVPFGYEEA 447
           Q ++ L     T S+  I ++A+  G N  E  TG+K+       L +   +   G EE+
Sbjct: 327 QGIYGLARSFPTASA--IDRVAKKHGLNCYEVPTGWKFF----CALFDAKKLSICG-EES 379

Query: 448 IGYMFPTMEIDKDGIAATVIFIQAFMYWNQ 477
            G     +  +KDGI A + ++     +NQ
Sbjct: 380 FGTGSNHVR-EKDGIWAIMAWLNILAIFNQ 408

>KLLA0B12694g Chr2 (1107696..1109402) [1707 bp, 568 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 568

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 99/418 (23%), Positives = 164/418 (39%), Gaps = 65/418 (15%)

Query: 101 QKLIAVIGHDHRYHSKEFAKIAATVFLIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVK 160
           Q    VIG D RY++    +  A +    G +   +          N  + TP     ++
Sbjct: 53  QGATLVIGGDGRYYNDVVIQKIAAIGSANGVRKIVIGH--------NGILSTPAASHIIR 104

Query: 161 --NLKASVGVMVTASHN---PKMDNGYKVYYSNGCQIIPPHDSGISQCIDANLEPWENS- 214
             + K + G+++TASHN   P  D G K   +NG     P    ++  I      W  S 
Sbjct: 105 AYHEKCTGGIILTASHNPGGPTNDFGIKYNLANGG----PAPESVTNSI------WHKSR 154

Query: 215 --WNYKEI----------MANAESKGDLIYHRDVMLNDYITQLEEKLTSKDIIHLSKKID 262
              +YK +          +   +  GDL+         Y+  ++E     D   +   ID
Sbjct: 155 ELTHYKIVESFPAIDLTKIGQDQKYGDLLVDIVDSTAAYVELMKEIF---DFPLIKSFID 211

Query: 263 VKSKPWF--VYTPMHGVGYEIFTKISNEILHMKEGEDFIVVEEQKHPDPGFPTVSFPNPE 320
            ++K  F  ++  M+GV     T    E L +KE        +  HP P F  +  P+P 
Sbjct: 212 TQAKNGFKILFDAMNGV-----TGPYGEALFVKELGLPESSLQNYHPKPDFGGLH-PDPN 265

Query: 321 EKGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQGTWHQFTGNEIGYLFAYFEF 380
              A  + ++  +  GI    A+D D DR  I        G      G+ +  +  Y   
Sbjct: 266 LTYAHTL-VERVDKYGIQFGAASDGDGDRNMIY-----GAGPAFVSPGDSVAIIAEYASA 319

Query: 381 QKYKISKQDLHRLYMVNSTVSSQMIKKMAEIEGFNYEETLTGFKWIGNRAIDLINKGNIV 440
             Y   KQ ++ L    S  +S  I ++A+ +G N  E  TG+K+       L +   + 
Sbjct: 320 IPY-FKKQGIYGL--ARSFPTSSAIDRVAKEQGLNCYEVPTGWKFF----CALFDAKKLS 372

Query: 441 PFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQ--IDKMDPYEIIQLGF-KKYG 495
             G EE+ G     +  +KDG+ A + ++     +NQ   +K    + IQ  F +KYG
Sbjct: 373 ICG-EESFGTGSNHVR-EKDGVWAIMAWLNILAIYNQRFPNKEASIKSIQTDFWQKYG 428

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 22/30 (73%)

Query: 164 ASVGVMVTASHNPKMDNGYKVYYSNGCQII 193
           A VGVM+TASHNP  DNG K+  S+G  ++
Sbjct: 52  APVGVMITASHNPPRDNGVKIVESDGSMLL 81

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
           Anc_6.11 YEL058W
          Length = 549

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%)

Query: 166 VGVMVTASHNPKMDNGYKVYYSNGCQII 193
           VGVMVTASHNP +DNG KV    G  +I
Sbjct: 60  VGVMVTASHNPPLDNGVKVVEPTGAMLI 87

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
           YEL058W
          Length = 561

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 23/33 (69%)

Query: 161 NLKASVGVMVTASHNPKMDNGYKVYYSNGCQII 193
           N  +++GVMVTASHNP  DNG K+   NG  ++
Sbjct: 63  NKHSAIGVMVTASHNPPEDNGVKIIEPNGSMLL 95

>KLTH0D04796g Chr4 (437416..439128) [1713 bp, 570 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 570

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 87/392 (22%), Positives = 159/392 (40%), Gaps = 50/392 (12%)

Query: 101 QKLIAVIGHDHRYHSKEFAKIAATVFLIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVK 160
           Q  + V+G D RY++ E  +    +    G K   +  + L        + TP     ++
Sbjct: 53  QDAVLVVGGDGRYYNNEVLQKIGEIGAANGVKKLIVGQNGL--------LSTPAASHIIR 104

Query: 161 NL--KASVGVMVTASHN---PKMDNGYKVYYSNGCQIIPPHDSGISQCI---DANLEPWE 212
           +   K++ G+++TASHN   P+ D G K   SNG     P    ++  I      L  ++
Sbjct: 105 SYPEKSTGGIILTASHNPGGPENDFGIKYNLSNGG----PAPESVTNSIFEKSKQLASYK 160

Query: 213 NSWNYKEI----MANAESKGDLIYHRDVMLNDYITQLEEKLTSKDIIHLSKKID-VKSKP 267
              N+ +I    +   +  G L+     +  +Y+  ++E     D   + K ID  +S  
Sbjct: 161 TVKNFPKINLSKIGKNQEYGSLLVDVIDVTAEYVKLMKEIF---DFDLIKKFIDHQRSTK 217

Query: 268 WF--VYTPMHGVGYEIFTKISNEILHMKEGEDFIVVEEQKHPDPGFPTVSFPNPEEKGAI 325
            F  ++  ++G+       I  + L +   E    V +   P P F  +  P+P    A 
Sbjct: 218 GFKILFDALNGITGPYGKAIFADELGLPAEE----VLQNYEPKPDFGGLH-PDPNLTYAH 272

Query: 326 DMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQGTWHQFTGNEIGYLFAYFEFQKYKI 385
            + ++  +   I+   A+D D DR  I        G      G+ +  +  Y     Y  
Sbjct: 273 TL-VERVDKEQIAFGAASDGDGDRNMIY-----GCGPAFVSPGDSVAIIAEYASEIPY-F 325

Query: 386 SKQDLHRLYMVNSTVSSQMIKKMAEIEGFNYEETLTGFKWIGNRAIDLINKGNIVPFGYE 445
            KQ ++ L    S  +S  I ++A+ +G N  E  TG+K+       L +   +   G E
Sbjct: 326 KKQGIYGL--ARSFPTSAAIDRVAKAQGLNCYEVPTGWKFF----CALFDAKKLSICG-E 378

Query: 446 EAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQ 477
           E+ G     +  +KDG+ A V ++     +N+
Sbjct: 379 ESFGTGSNHVR-EKDGVWAIVAWLNILAIYNR 409

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
           Anc_6.11 YEL058W
          Length = 558

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 21/28 (75%)

Query: 165 SVGVMVTASHNPKMDNGYKVYYSNGCQI 192
           +VGVMVTASHNP +DNG K+   NG  +
Sbjct: 61  AVGVMVTASHNPPVDNGVKIVEPNGSML 88

>TDEL0A02210 Chr1 (400375..402093) [1719 bp, 572 aa] {ON} Anc_2.445
           YKL127W
          Length = 572

 Score = 40.0 bits (92), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 92/396 (23%), Positives = 158/396 (39%), Gaps = 65/396 (16%)

Query: 106 VIGHDHRYHSKEFAKIAATVFLIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNL--- 162
           V+G D RY++ +  +I A++    G     +    L        + TP     ++     
Sbjct: 58  VVGGDGRYYNDKILQIIASISAANGVGKLVIGQHGL--------LSTPAASHIIRTYQDK 109

Query: 163 ---KASVGVMVTASHN---PKMDNGYKVYYSNGCQIIPPHDSGISQCIDANLEPWENS-- 214
              K + G+++TASHN   P  D G K   SNG     P    ++  I      WE S  
Sbjct: 110 SGKKVTGGIILTASHNPGGPDNDIGIKYNLSNGG----PAPESVTNAI------WEISKK 159

Query: 215 -WNYK--------EIMANAESK-GDLIYHRDVMLNDYITQLEEKLTSKDIIHLSKKIDVK 264
             +YK        ++    E K G+L      +   Y+  L+E     D   + K +D +
Sbjct: 160 LTSYKIIKNLPQLDLSTKGEKKLGNLEIDVVDVTQAYVEFLKEIF---DFDLIKKFVDTQ 216

Query: 265 --SKPW-FVYTPMHGVGYEIFTKISNEILHMKEGEDFIVVEEQKHPDPGFPTVSFPNPEE 321
             +K W  ++  ++GV       I  + L + E E    V +  HP P F  +  P+P  
Sbjct: 217 RSTKHWKLLFDGLNGVTGPYGKAIFVDELGLPENE----VLQNCHPKPDFGGIH-PDPNL 271

Query: 322 KGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQGTWHQFTGNEIGYLFAYFEFQ 381
             A  + ++  +   I    A+D D DR  I        G      G+ +  +  Y +  
Sbjct: 272 TYARTL-VERVDKEKIEFGAASDGDGDRNMIY-----GYGPAFVSPGDSVAIIAEYAKEI 325

Query: 382 KYKISKQDLHRLYMVNSTVSSQMIKKMAEIEGFNYEETLTGFKWIGNRAIDLINKGNIVP 441
            Y  +KQ ++ L    S  +S  I ++A  +G N  E  TG+K+       L +   +  
Sbjct: 326 PY-FAKQGIYGL--ARSFPTSSAIDRVAAEQGLNCYEVPTGWKFF----CALFDAKKLSI 378

Query: 442 FGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQ 477
            G EE+ G     +  +KDG+ A + ++     +N+
Sbjct: 379 CG-EESFGTGSNHVR-EKDGVWAIIAWLNILAIYNK 412

>Smik_13.291 Chr13 complement(460399..462108) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 89/384 (23%), Positives = 153/384 (39%), Gaps = 44/384 (11%)

Query: 106 VIGHDHRYHSKEFAKIAATVFLIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNL--K 163
           V+G D RY++       A +    G K   +    L        + TP     ++    K
Sbjct: 58  VVGGDGRYYNDVILHKIAAIGAANGVKKLVIGQHGL--------LSTPAASHIMRTYEEK 109

Query: 164 ASVGVMVTASHN---PKMDNGYKVYYSNGCQIIPPHDSGISQCIDANLEPWENSWNYKEI 220
            + G+++TASHN   P+ D G K   SNG    P   + +   I   L  ++   ++ E+
Sbjct: 110 CTGGIILTASHNPGGPENDMGIKYNLSNGGP-APESVTNVIWDISKKLTSYKIIKDFPEL 168

Query: 221 ----MANAESKGDLIYHRDVMLNDYITQLEEKLTSKDIIHLSKKIDVK--SKPW-FVYTP 273
               +   +  G L+     +  DY+  L+E     D   + K ID +  +K W  ++  
Sbjct: 169 DLATIGKNKKYGPLLVDIIDITKDYVDFLKEIF---DFKLIKKFIDNQRSTKNWKLLFDS 225

Query: 274 MHGVGYEIFTKISNEILHMKEGEDFIVVEEQKHPDPGFPTVSFPNPEEKGAIDMGIKLAE 333
           M+GV       I  +   +   E    V +  HP P F  +  P+P    A  + +K  +
Sbjct: 226 MNGVTGPYGKAIFVDEFGLPADE----VLQNWHPSPDFGGMH-PDPNLTYASTL-VKRVD 279

Query: 334 DNGISLVIANDPDADRFSIAVKSKGSQGTWHQFTGNEIGYLFAYFEFQKYKISKQDLHRL 393
              I    A+D D DR  I        G      G+ +  +  Y     Y  +KQ ++ L
Sbjct: 280 REKIEFGAASDGDGDRNMIY-----GYGPSFVSPGDSVAIIAEYAAEIPY-FAKQGIYGL 333

Query: 394 YMVNSTVSSQMIKKMAEIEGFNYEETLTGFKWIGNRAIDLINKGNIVPFGYEEAIGYMFP 453
               S  +S  I ++A+  G N  E  TG+K+       L +   +   G EE+ G    
Sbjct: 334 --ARSFPTSAAIDRVAKAHGLNCYEVPTGWKFF----CALFDAKKLSICG-EESFGTGSN 386

Query: 454 TMEIDKDGIAATVIFIQAFMYWNQ 477
            +  +KDG+ A + ++     +N+
Sbjct: 387 HVR-EKDGVWAIMAWLNILAIYNK 409

>CAGL0K07480g Chr11 complement(740462..742165) [1704 bp, 567 aa]
           {ON} highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105c PGM2 phosphoglucomutase
          Length = 567

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 113/500 (22%), Positives = 202/500 (40%), Gaps = 65/500 (13%)

Query: 61  GTAGLRSTMEAGFSRMN-TLTVLQASQGLATYMKNDAKNTGQK-LIAVIGHDHRYHSKEF 118
           GT+GLR   +      N T   +QA          DA   G K  + V+G D R+++   
Sbjct: 17  GTSGLRKKTKVFMEEPNYTENFIQAIM--------DAIPEGAKDAVLVVGGDGRFYNDVI 68

Query: 119 AKIAATVFLIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNL--KASVGVMVTASHN- 175
            +  A +    G +   +  + L        + TP     +++   K + G+++TASHN 
Sbjct: 69  MQKIAAIGAANGVRKLIIGQNGL--------LSTPAASHVIRSYAEKCTGGIILTASHNP 120

Query: 176 --PKMDNGYKVYYSNGCQIIPPHDSGISQCIDANLEPWENSWNYKEI----MANAESKGD 229
             P+ D G K   +NG     P  + + + +   L  ++   ++ ++    +   +  G 
Sbjct: 121 GGPENDLGIKYNLANGGPAPEPVTNKMWE-VSKQLTHYKIIKDFPQVDFSKIGKDQQYGP 179

Query: 230 LIYHRDVMLNDYITQLEE----KLTSKDIIHLSKKIDVKSKPW-FVYTPMHGVGYEIFTK 284
           L+        DY+  ++E    KL  K+ IH  +    ++K W  ++  ++G+       
Sbjct: 180 LLVDIIDTTEDYVKFMKEIFDFKLI-KEFIHKQR----EAKNWKLLFDSLNGITGPYGKA 234

Query: 285 ISNEILHMKEGEDFIVVEEQKHPDPGFPTVSFPNPEEKGAIDMGIKLAEDNGISLVIAND 344
           I  +   +   E    V +  HP P F  +  P+P    A  + ++  +   I    A+D
Sbjct: 235 IFVDEFDLPADE----VLQNWHPQPDFGGLH-PDPNLTYAHTL-VERVDREKIEFGAASD 288

Query: 345 PDADRFSIAVKSKGSQGTWHQFTGNEIGYLFAYFEFQKYKISKQDLHRLYMVNSTVSSQM 404
            D DR  I        G      G+ +  +  Y +   Y   KQ ++ L    S  +S  
Sbjct: 289 GDGDRNMIY-----GAGPAFVSPGDSVAIIAEYAKEIPY-FQKQGIYGL--ARSFPTSGA 340

Query: 405 IKKMAEIEGFNYEETLTGFKWIGNRAIDLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAA 464
           I ++A+ +G N  E  TG+K+       L +   +   G EE+ G     +  +KDG+ A
Sbjct: 341 IDRVAKAQGLNCYEVPTGWKFF----CALFDAKKLSICG-EESFGTGSNHIR-EKDGVWA 394

Query: 465 TVIFIQAFMYWNQ--IDKMDPYEIIQLGF-KKYGVFIEYNGYYRYTDLGITKKIFDYVRY 521
              ++     +N+   +K    + IQ  F  KYG       + RY   GIT +  + V  
Sbjct: 395 ICAWLNILALYNKHNPEKEASIKTIQEEFWAKYGRTF----FTRYDYEGITTEKANKVVD 450

Query: 522 DYDKGVSEGNKKYPDHIGEE 541
             DK V++   K     G+E
Sbjct: 451 LLDKFVNDPKSKNAPFPGDE 470

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
           YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
           186] FULL
          Length = 541

 Score = 39.3 bits (90), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 41/91 (45%), Gaps = 29/91 (31%)

Query: 165 SVGVMVTASHNPKMDNGYKVYYSNGCQIIPPHDSGISQCIDANLEPWENSWN-YKEIMAN 223
           +VGVM+TASHNP  DNG K+                   +D   E  E SW  Y   +AN
Sbjct: 57  TVGVMITASHNPPEDNGVKI-------------------VDPKGEMLEQSWEVYATDLAN 97

Query: 224 AESKGDLIYHRDVMLNDYITQLEEKLTSKDI 254
           + S+G          ++++  +E  +T  ++
Sbjct: 98  SASQG---------FSEFVASVERLMTKLEV 119

>KAFR0D03010 Chr4 (594118..595827) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 39.3 bits (90), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 90/394 (22%), Positives = 154/394 (39%), Gaps = 64/394 (16%)

Query: 106 VIGHDHRYHSKEFAKIAATVFLIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNL--K 163
           V+G D RY++    +  A +    G K   +  + L        + TP     +++   K
Sbjct: 58  VVGGDGRYYNDVILEKIAKIGAANGVKKLVVGQNGL--------LSTPAASHIIRSYHEK 109

Query: 164 ASVGVMVTASHN---PKMDNGYKVYYSNGCQIIPPHDSGISQCIDANLEPWENS---WNY 217
            + G+++TASHN   PK D G K   +NG     P    ++  I      WENS    +Y
Sbjct: 110 VTGGIILTASHNPGGPKNDMGIKYNLANGG----PAPESVTDKI------WENSKKLTSY 159

Query: 218 KEI----------MANAESKGDLIYHRDVMLNDYITQLEEKL---TSKDIIHLSKKIDVK 264
           K I          +   +  G ++     +   Y+  L+E       K  IH  +    K
Sbjct: 160 KIIKDLPTLDTSKIGENQKYGPILIDVIDVTKAYVEFLKEIFDFELIKKFIHTQR----K 215

Query: 265 SKPW-FVYTPMHGVGYEIFTKISNEILHMKEGEDFIVVEEQKHPDPGFPTVSFPNPEEKG 323
           +K W  ++  ++G+       I  +   + E E    V +  HP P F  +  P+P    
Sbjct: 216 TKNWKLLFDGLNGITGPYGKAIFVDEFELPENE----VLQNYHPQPDFGGLH-PDPNLTY 270

Query: 324 AIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQGTWHQFTGNEIGYLFAYFEFQKY 383
           A  + +   +   I    A+D D DR  I        G      G+ +  +  Y     Y
Sbjct: 271 ARSL-VDRVDKEKIEFGAASDGDGDRNMIY-----GYGPAFVSPGDSVAIIAEYASEIPY 324

Query: 384 KISKQDLHRLYMVNSTVSSQMIKKMAEIEGFNYEETLTGFKWIGNRAIDLINKGNIVPFG 443
             +KQ ++ L    S  +S  I ++A+  G    E  TG+K+       L +   +   G
Sbjct: 325 -FAKQGIYGL--ARSFPTSAAIDRVAKAHGLECYEVPTGWKFF----CALFDAKKLSICG 377

Query: 444 YEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQ 477
            EE+ G     +  +KDG+ A V ++     +N+
Sbjct: 378 -EESFGTGSNHVR-EKDGLWAIVAWLNVLAIFNK 409

>YMR105C Chr13 complement(475897..477606) [1710 bp, 569 aa] {ON}
           PGM2Phosphoglucomutase, catalyzes the conversion from
           glucose-1-phosphate to glucose-6-phosphate, which is a
           key step in hexose metabolism; functions as the acceptor
           for a Glc-phosphotransferase
          Length = 569

 Score = 39.3 bits (90), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 89/384 (23%), Positives = 153/384 (39%), Gaps = 44/384 (11%)

Query: 106 VIGHDHRYHSKEFAKIAATVFLIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNL--K 163
           V+G D RY++       A +    G K   +    L        + TP     ++    K
Sbjct: 58  VVGGDGRYYNDVILHKIAAIGAANGIKKLVIGQHGL--------LSTPAASHIMRTYEEK 109

Query: 164 ASVGVMVTASHN---PKMDNGYKVYYSNGCQIIPPHDSGISQCIDANLEPWENSWNYKEI 220
            + G+++TASHN   P+ D G K   SNG        + I + I   L  ++   ++ E+
Sbjct: 110 CTGGIILTASHNPGGPENDMGIKYNLSNGGPAPESVTNAIWE-ISKKLTSYKIIKDFPEL 168

Query: 221 ----MANAESKGDLIYHRDVMLNDYITQLEEKLTSKDIIHLSKKIDVK--SKPW-FVYTP 273
               +   +  G L+     +  DY+  L+E     D   + K ID +  +K W  ++  
Sbjct: 169 DLGTIGKNKKYGPLLVDIIDITKDYVNFLKEIF---DFDLIKKFIDNQRSTKNWKLLFDS 225

Query: 274 MHGVGYEIFTKISNEILHMKEGEDFIVVEEQKHPDPGFPTVSFPNPEEKGAIDMGIKLAE 333
           M+GV       I  +   +   E    V +  HP P F  +  P+P    A  + +K  +
Sbjct: 226 MNGVTGPYGKAIFVDEFGLPADE----VLQNWHPSPDFGGMH-PDPNLTYASSL-VKRVD 279

Query: 334 DNGISLVIANDPDADRFSIAVKSKGSQGTWHQFTGNEIGYLFAYFEFQKYKISKQDLHRL 393
              I    A+D D DR  I        G      G+ +  +  Y     Y  +KQ ++ L
Sbjct: 280 REKIEFGAASDGDGDRNMIY-----GYGPSFVSPGDSVAIIAEYAAEIPY-FAKQGIYGL 333

Query: 394 YMVNSTVSSQMIKKMAEIEGFNYEETLTGFKWIGNRAIDLINKGNIVPFGYEEAIGYMFP 453
               S  +S  I ++A+  G N  E  TG+K+       L +   +   G EE+ G    
Sbjct: 334 --ARSFPTSGAIDRVAKAHGLNCYEVPTGWKFF----CALFDAKKLSICG-EESFGTGSN 386

Query: 454 TMEIDKDGIAATVIFIQAFMYWNQ 477
            +  +KDG+ A + ++     +N+
Sbjct: 387 HVR-EKDGVWAIMAWLNILAIYNK 409

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
           YEL058W
          Length = 528

 Score = 38.9 bits (89), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 39/75 (52%), Gaps = 7/75 (9%)

Query: 166 VGVMVTASHNPKMDNGYKVYYSNGCQIIPPHDSGISQCIDANL---EPWENSWNYKEIMA 222
           VGVM+TASHNP  DNG KV   +G  +I   +S  ++   ANL    P E+       + 
Sbjct: 57  VGVMITASHNPSGDNGVKVVEPDGSMLIQSWESTATEL--ANLLANRPLEDIKAKVGQLT 114

Query: 223 NAES--KGDLIYHRD 235
           + ES  +  LI  RD
Sbjct: 115 SGESSVRPQLIVGRD 129

>Smik_12.26 Chr12 (65808..68054) [2247 bp, 748 aa] {ON} YLL029W
           (REAL)
          Length = 748

 Score = 38.9 bits (89), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 45/96 (46%), Gaps = 9/96 (9%)

Query: 505 RYTDLGITKKIFDYVRYDYDKGVSEGNKKYPDHIGEEFKI--IKYR-------DLTTGYQ 555
           R +D+      F Y+  + DK +   N  + D I E FKI  I+ R        LT    
Sbjct: 341 RGSDIDYNPVFFSYIAINEDKTILFTNNPFGDEISEYFKINGIEVRPYEQIWQHLTKVTV 400

Query: 556 SDTPDNKPLLPVDPSSQMITVEMIPTDNESDGSIRL 591
             TP++K L+P   S QM+    IP D + +G+ ++
Sbjct: 401 QATPEHKFLVPDGASWQMVRCLNIPNDTDHEGTSKM 436

>NCAS0A04350 Chr1 (878688..880397) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 38.5 bits (88), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 102/448 (22%), Positives = 172/448 (38%), Gaps = 88/448 (19%)

Query: 61  GTAGLRSTMEAGFSRMN-TLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFA 119
           GT+GLR       +  N T   +QA       M +      Q    V+G D R+++    
Sbjct: 19  GTSGLRKKTAIFMNEPNYTENFIQA-------MLDAIPEGSQDATLVVGGDGRFYNDVIM 71

Query: 120 KIAATVFLIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNLKASV--GVMVTASHN-- 175
              A +    G K   +  + L        + TP     +++ +  V  G+++TASHN  
Sbjct: 72  NKIAAISAANGVKKLIIGQNGL--------LSTPAASHIIRSYEEKVTGGIILTASHNPG 123

Query: 176 -PKMDNGYKVYYSNGCQIIPPHDSGISQCIDANLEPWENS---WNYKEI----------M 221
            P+ D G K   +NG     P    ++  I      WE S    +YK I          M
Sbjct: 124 GPENDLGIKYNLANGG----PAPESVTNAI------WEVSKKLTHYKIIKNFPPLDLSKM 173

Query: 222 ANAESKGDLIYHRDVMLNDYITQLEEKL---TSKDIIHLSKKIDVKSKPW-FVYTPMHGV 277
              +  G L+     +  DY+  L+E       K  IH  +    ++K W  ++  ++G+
Sbjct: 174 GKDQKYGPLLVDIIDVTKDYVDFLKEIFDFELIKKFIHKQR----ETKNWKLLFDSLNGI 229

Query: 278 ----GYEIFTK----ISNEILHMKEGEDFIVVEEQKHPDPGFPTVSFPNPEEKGAIDMGI 329
               G  IF       +NE+L            +  HP P F  +  P+P    A  + +
Sbjct: 230 TGPYGKAIFVDEFDLPANEVL------------QNWHPKPDFGGLH-PDPNLTYAKTL-V 275

Query: 330 KLAEDNGISLVIANDPDADRFSIAVKSKGSQGTWHQFTGNEIGYLFAYFEFQKYKISKQD 389
           +  +   I    A+D D DR  I        G      G+ +  +  Y     Y + KQ 
Sbjct: 276 ERVDREKIEFGAASDGDGDRNMIY-----GAGPAFVSPGDSVAIIAEYASEIPYFV-KQG 329

Query: 390 LHRLYMVNSTVSSQMIKKMAEIEGFNYEETLTGFKWIGNRAIDLINKGNIVPFGYEEAIG 449
           ++ L    S  +S  I ++A+  G +  E  TG+K+       L +   +   G EE+ G
Sbjct: 330 IYGL--ARSFPTSAAIDRVAKAHGLSCYEVPTGWKFF----CALFDAKKLSICG-EESFG 382

Query: 450 YMFPTMEIDKDGIAATVIFIQAFMYWNQ 477
                +  +KDG+ A V ++     +N+
Sbjct: 383 TGSNHIR-EKDGLWAIVAWLNVLAIYNK 409

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
           complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score = 38.5 bits (88), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 165 SVGVMVTASHNPKMDNGYKVYYSNGCQI 192
           +VGVM+TASHNP  DNG K+   NG  +
Sbjct: 53  AVGVMITASHNPPEDNGVKIVEPNGAML 80

>Kpol_1018.161 s1018 (412372..414081) [1710 bp, 569 aa] {ON}
           (412372..414081) [1710 nt, 570 aa]
          Length = 569

 Score = 38.1 bits (87), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 121/498 (24%), Positives = 195/498 (39%), Gaps = 92/498 (18%)

Query: 61  GTAGLRSTMEAGFSRMN-TLTVLQASQGLATYMKNDAKNTGQK-LIAVIGHDHRYHSKEF 118
           GT+GLR   +      N T   +QA+         DA   G K    V+G D RY++   
Sbjct: 19  GTSGLRKKTKVFAEEPNYTENFIQATM--------DAIPEGCKGATLVVGGDGRYYNDVI 70

Query: 119 AKIAATVFLIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNLK--ASVGVMVTASHN- 175
                ++    G +   +          N  + TP     +++ K   + G+++TASHN 
Sbjct: 71  MNKIVSIAGANGVRKLIIGH--------NGILSTPAASHVIRSYKEKCTGGIILTASHNP 122

Query: 176 --PKMDNGYKVYYSNGCQIIPPHDSGISQCIDANLEPWENS---WNYKEIMANAE---SK 227
             PK D G K   +NG     P    ++  I      WE S     YK I    E   SK
Sbjct: 123 GGPKNDIGIKYNLANGG----PAPESVTNAI------WEASKKLTEYKVIEGLPELDTSK 172

Query: 228 -------GDLIYHRDVMLNDYITQLEEKLTSKDIIHLSKKIDVKSKPW-FVYTPMHGVGY 279
                  G L+         Y+  L+E    K I     K   ++K W  ++  ++GV  
Sbjct: 173 IAVDIKYGPLLVDIIDSTEAYVDYLKEIFDFKLIKEFVTK-QRETKGWKLLFDSLNGV-- 229

Query: 280 EIFTKISNEILHMKE-GEDFIVVEEQKHPDPGFPTVSFPNPEEKGAIDMGIKLAEDNGIS 338
              T    E + +KE G     V +  HP P F  +  P+P    A  +  ++ ++N I 
Sbjct: 230 ---TGPYGEAIFVKELGLPADEVLQNWHPLPDFGGLH-PDPNLTYAHTLVERVDKEN-IQ 284

Query: 339 LVIANDPDADRFSIAVKSKGSQGTWHQFTGNEIGYLFAYFEFQKYKISKQDLHRLYMVNS 398
              A+D D DR  I        G      G+ +  +  Y +   Y  +KQ ++   +  S
Sbjct: 285 FGAASDGDGDRNMIY-----GAGPAFVSPGDSVAIISEYADEIPY-FAKQGIYG--VARS 336

Query: 399 TVSSQMIKKMAEIEGFNYEETLTGFKWIGNRAIDLINKGNIVPFGYEEAIGYMFPTMEID 458
             +S  + ++A+ +G N  E  TG+K+       L +   +   G EE+ G     +  +
Sbjct: 337 FPTSSALDRVAKAKGLNCYEVPTGWKFF----CALFDDQKVSICG-EESFGTGSNHIR-E 390

Query: 459 KDGIAATVIFIQAFMYWNQIDKMDPYEI--IQLGF-KKYGVFIEYNGYYRYTDLGITKKI 515
           KDG+ A V ++     +N+ +      I  IQ  F +KYG                  + 
Sbjct: 391 KDGVWAIVAWLNILAIYNKHNPTKDASIATIQHEFWQKYG------------------RT 432

Query: 516 FDYVRYDYDKGVSEGNKK 533
           F + RYDY+  +SE   K
Sbjct: 433 F-FTRYDYENLMSEDANK 449

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
           Anc_6.11 YEL058W
          Length = 540

 Score = 38.1 bits (87), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 166 VGVMVTASHNPKMDNGYKVYYSNGCQII 193
           +GVM+TASHNP  DNG K+   +G  +I
Sbjct: 59  IGVMITASHNPPQDNGVKIVEPSGAMLI 86

>NDAI0H02350 Chr8 complement(571624..573333) [1710 bp, 569 aa] {ON}
           Anc_2.445 YKL127W
          Length = 569

 Score = 38.1 bits (87), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 104/433 (24%), Positives = 173/433 (39%), Gaps = 53/433 (12%)

Query: 106 VIGHDHRYHSKEFAKIAATVFLIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNL--K 163
           V+G D RY++       A +    G K   +    L        + TP     ++    K
Sbjct: 58  VVGGDGRYYNDVILHKIAAIGAANGVKKLVVGQHGL--------LSTPAASHIMRTYEEK 109

Query: 164 ASVGVMVTASHNP---KMDNGYKVYYSNGCQIIPPHDSGISQCIDANLEPWENSWNYKEI 220
            + G+++TASHNP   + D G K   SNG     P  + I + I   +  ++   ++ E+
Sbjct: 110 TTGGIILTASHNPGGLENDMGIKYNLSNGGPAPEPVTNKIWE-ISKKMTHYKIIKDFPEL 168

Query: 221 ----MANAESKGDLIYHRDVMLNDYITQLEEKL---TSKDIIHLSKKIDVKSKPW-FVYT 272
               +   +  G L+     +   Y+  L+E       K  IH  +    + K W  ++ 
Sbjct: 169 ELETLGKNKKYGPLLVDVIDITKAYVDFLKEIFDFELIKKFIHNQR----EKKHWKLLFD 224

Query: 273 PMHGVGYEIFTKISNEILHMKEGEDFIVVEEQKHPDPGFPTVSFPNPEEKGAIDMGIKLA 332
            M+GV       I  +   +   E    V +Q HP P F  V  P+P    A  +  ++ 
Sbjct: 225 GMNGVTGPYGKAIFVDEFGLPADE----VLQQWHPQPDFGGVH-PDPNLTYAKALVDRVN 279

Query: 333 EDNGISLVIANDPDADRFSIAVKSKGSQGTWHQFTGNEIGYLFAYFEFQKYKISKQDLHR 392
            +  I    A+D D DR  I        G      G+ +  +  Y     Y   KQ ++ 
Sbjct: 280 REK-IEFGAASDGDGDRNMIY-----GAGPAFVSPGDSVAIIAEYASEIPY-FKKQGIYG 332

Query: 393 LYMVNSTVSSQMIKKMAEIEGFNYEETLTGFKWIGNRAIDLINKGNIVPFGYEEAIGYMF 452
           L     T SS  I ++A+  G N  +  TG+K+    A+   NK +I     EE+ G   
Sbjct: 333 LARSFPTASS--IDRVAKAHGLNCYQVPTGWKFFC--ALFDANKLSICG---EESFGTGS 385

Query: 453 PTMEIDKDGIAATVIFIQAFMYWNQ--IDKMDPYEIIQLGF-KKYG--VFIEYNGYYRYT 507
             +  +KDG+ A + ++     +N+   +K    +IIQ  F  KYG   F  Y+  Y + 
Sbjct: 386 NHVR-EKDGLWAIIAWLNVLAIYNKHNPEKDVSIKIIQDEFWNKYGRTFFTRYD--YEHV 442

Query: 508 DLGITKKIFDYVR 520
                 K+ D +R
Sbjct: 443 TTEAAGKVIDQLR 455

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 550

 Score = 38.1 bits (87), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 16/24 (66%), Positives = 19/24 (79%)

Query: 166 VGVMVTASHNPKMDNGYKVYYSNG 189
           +GVMVTASHNP +DNG KV   +G
Sbjct: 59  IGVMVTASHNPPVDNGVKVVEPDG 82

>TDEL0E00210 Chr5 (28244..29956) [1713 bp, 570 aa] {ON} Anc_2.445
           YKL127W
          Length = 570

 Score = 38.1 bits (87), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 86/392 (21%), Positives = 156/392 (39%), Gaps = 53/392 (13%)

Query: 104 IAVIGHDHRYHSKEFAKIAATVFLIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNL- 162
           I V+G D RY++ +  +I A +    G +   +    L        + TP     +++  
Sbjct: 54  ILVVGGDGRYYNDKILQIIAAISAANGVRKLVIGQHGL--------LSTPAASHIIRSYQ 105

Query: 163 -----KASVGVMVTASHN---PKMDNGYKVYYSNGCQIIPPHDSGISQC---IDANLEPW 211
                K + G+++TASHN   P+ D G K   SNG     P    ++     I   L  +
Sbjct: 106 DKDGKKVTGGIILTASHNPGGPENDIGIKYNLSNGG----PAPESVTNAIWDISKKLTHY 161

Query: 212 ENSWNYKEI---MANAESKGDLIYHRDVMLNDYITQLEEKLTSKDIIHLSKKIDVK--SK 266
           +    + EI   +   +S G L+        +Y+  L+      D   + K +D +  +K
Sbjct: 162 KIVKGFPEINLSVKGEKSYGSLVIDVVDTTQEYVDFLKGIF---DFDLIKKFVDTQRSTK 218

Query: 267 PW-FVYTPMHGVGYEIFTKISNEILHMKEGEDFIVVEEQKHPDPGFPTVSFPNPEEKGAI 325
            W  ++  ++GV       I  + L + E E    V +  HP P F  +  P+P    A 
Sbjct: 219 NWKLLFDGLNGVTGPYGRAIFVDELGLPENE----VLQNCHPKPDFGGIH-PDPNLTYAR 273

Query: 326 DMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQGTWHQFTGNEIGYLFAYFEFQKYKI 385
            + +   +   I    A+D D DR  I        G      G+ +  +  Y     Y  
Sbjct: 274 TL-VDRVDKEKIEFGAASDGDGDRNMIY-----GYGPAFVSPGDSVAIIAEYASEIPY-F 326

Query: 386 SKQDLHRLYMVNSTVSSQMIKKMAEIEGFNYEETLTGFKWIGNRAIDLINKGNIVPFGYE 445
           ++  ++ L    S  +S  I ++A+ +G N     TG+K+       L +   +   G E
Sbjct: 327 AQNGIYGL--ARSFPTSTAIDRVAKAKGLNCYVVPTGWKFF----CALFDAKKLSICG-E 379

Query: 446 EAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQ 477
           E+ G     +  +KDG+ A + ++     +N+
Sbjct: 380 ESFGTGSNHVR-EKDGVWAVIAWLNILAIYNK 410

>Suva_13.282 Chr13 complement(457565..459274) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 37.7 bits (86), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 107/453 (23%), Positives = 176/453 (38%), Gaps = 74/453 (16%)

Query: 106 VIGHDHRYHSKEFAKIAATVFLIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNL--K 163
           V+G D RY++       A +    G K   +    L        + TP     ++    K
Sbjct: 58  VVGGDGRYYNDVILHKIAAISAANGVKKLVIGQHGL--------LSTPAASHIMRTYEDK 109

Query: 164 ASVGVMVTASHN---PKMDNGYKVYYSNGCQIIPPHDSGISQCIDANLEPWENSWNYKEI 220
            + G+++TASHN   P+ D G K   SNG        + I + I   L  ++   ++ E+
Sbjct: 110 CTGGIILTASHNPGGPENDMGIKYNLSNGGPAPESVTNAIWE-ISKKLTSYKIVKDFPEL 168

Query: 221 ----MANAESKGDLIYHRDVMLNDYITQLEEKLTSKDIIHLSKKIDVK--SKPW-FVYTP 273
               +      G L+     +   Y+  +EE     D   + K ID +  +K W  ++  
Sbjct: 169 DLQTIGKDRKYGPLLIDIIDVTKAYVELMEEIF---DFNLIKKFIDNQRSTKNWKLLFDS 225

Query: 274 MHGV----GYEIFTKISNEILHMKEGEDFIVVEEQKHPDPGFPTVSFPNPEEKGAIDMGI 329
           M+GV    G  IF          K G     V +  HP P F  +  P+P    A  + +
Sbjct: 226 MNGVTGPYGKAIFVD--------KFGLPAEEVLQNWHPSPDFGGMH-PDPNLTYASSL-V 275

Query: 330 KLAEDNGISLVIANDPDADRFSIAVKSKGSQGTWHQFTGNEIGYLFAYFEFQKYKISKQD 389
           K  +   I    A+D D DR  I        G      G+ +  +  Y     Y  +KQ 
Sbjct: 276 KRVDREQIEFGAASDGDGDRNMIY-----GYGPSFVSPGDSVAIIAEYAAEIPY-FAKQG 329

Query: 390 LHRLYMVNSTVSSQMIKKMAEIEGFNYEETLTGFKWIGNRAIDLINKGNIVPFGYEEAIG 449
           ++ L    S  +S  I ++A+  G N  E  TG+K+       L +   +   G EE+ G
Sbjct: 330 IYGL--ARSFPTSAAIDRVAKAHGLNCYEVPTGWKFF----CALFDAKKLSICG-EESFG 382

Query: 450 YMFPTMEIDKDGIAATVIFIQAFMYWNQ--IDKMDPYEIIQLGF-KKYGVFIEYNGYYRY 506
                +  +KDG+ A + ++     +N+   +K    + IQ  F  KYG           
Sbjct: 383 TGSNHVR-EKDGVWAIMAWLNILAIYNKHHPEKEASIKTIQDEFWAKYG----------- 430

Query: 507 TDLGITKKIFDYVRYDYDKGVSEGNKKYPDHIG 539
                  + F + RYD++K  SE   +  D +G
Sbjct: 431 -------RTF-FTRYDFEKVESEKANEIVDQLG 455

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score = 37.7 bits (86), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 36/68 (52%), Gaps = 11/68 (16%)

Query: 129 AGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNLKAS---VGVMVTASHNPKMDNGYKVY 185
           AGF+    N D++        + T  +   +++LK     VGVM+TASHNP  DNG K+ 
Sbjct: 28  AGFRTLAKNLDTV--------MFTTGILAILRSLKLQGQYVGVMITASHNPYQDNGVKIV 79

Query: 186 YSNGCQII 193
             +G  ++
Sbjct: 80  EPDGSMLL 87

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
           N-acetylglucosamine-phosphate mutase; converts
           GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the
           biosynthesis of chitin and for the formation of
           N-glycosylated mannoproteins and
           glycosylphosphatidylinositol anchors
          Length = 557

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 166 VGVMVTASHNPKMDNGYKVYYSNGCQII 193
           VGVM+TASHNP  DNG K+   +G  ++
Sbjct: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
           YEL058W
          Length = 538

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 17/21 (80%), Positives = 17/21 (80%)

Query: 164 ASVGVMVTASHNPKMDNGYKV 184
           A VGVMVTASHNP  DNG KV
Sbjct: 56  AQVGVMVTASHNPPEDNGVKV 76

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 166 VGVMVTASHNPKMDNGYKVYYSNGCQII 193
           VGVM+TASHNP  DNG K+   +G  ++
Sbjct: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 544

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 30/63 (47%), Gaps = 18/63 (28%)

Query: 166 VGVMVTASHNPKMDNGYKVYYSNGCQIIPPHDSGISQCIDANLEPWENSWNYKEIMANAE 225
           VGVM+TASHNP  DNG K+    G            + +D   EP+         +AN+ 
Sbjct: 58  VGVMITASHNPPQDNGVKIVDPKG------------EMLDQAWEPFATE------LANSA 99

Query: 226 SKG 228
           SKG
Sbjct: 100 SKG 102

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 20/28 (71%)

Query: 166 VGVMVTASHNPKMDNGYKVYYSNGCQII 193
           VGVM+TASHNP  DNG K+   +G  ++
Sbjct: 60  VGVMITASHNPYQDNGVKIVEPDGSMLL 87

>Kwal_26.7628 s26 (449302..451014) [1713 bp, 570 aa] {ON} YMR105C
           (PGM2) - Phosphoglucomutase [contig 55] FULL
          Length = 570

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 90/388 (23%), Positives = 156/388 (40%), Gaps = 52/388 (13%)

Query: 106 VIGHDHRYHSKEFAKIAATVFLIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNL--K 163
           V+G D RY++ E  +I   +    G +   L          N  + TP     +++   K
Sbjct: 58  VVGGDGRYYNNEVMQIIGAIAAANGVRKMILGQ--------NGILSTPAASHIIRSYPEK 109

Query: 164 ASVGVMVTASHN---PKMDNGYKVYYSNGCQIIPPHDSGISQCI---DANLEPWENSWNY 217
            + G+++TASHN   P+ D G K   SNG     P    ++  I      L  ++   N+
Sbjct: 110 CTGGIILTASHNPGGPENDFGIKYNLSNGG----PAPESVTNAIFEKSKQLTHYKIVKNF 165

Query: 218 KEI----MANAESKGDLIYHRDVMLNDYITQLEEKLTSKDIIHLSKKID-VKSKPWF--V 270
            +I    +   +  G L+        DY+  ++E     D   + K ID  +S   F  +
Sbjct: 166 PKIDFSKIGKDQKYGPLLVDVVDSTADYVALMKEIF---DFDLIKKFIDNQRSTKGFKIL 222

Query: 271 YTPMHGVGYEIFTKISNEILHMKE-GEDFIVVEEQKHPDPGFPTVSFPNPEEKGAIDMGI 329
           +  ++GV     T    E + +KE G     V +   P P F  +  P+P    A  + +
Sbjct: 223 FDSLNGV-----TGPYGEAIFVKELGLPAEEVLQNYVPKPDFGGLH-PDPNLTYAHTL-V 275

Query: 330 KLAEDNGISLVIANDPDADRFSIAVKSKGSQGTWHQFTGNEIGYLFAYFEFQKYKISKQD 389
           +  +   I+   A+D D DR  I        G      G+ +  +  Y     Y   KQ 
Sbjct: 276 ERVDKEQIAFGAASDGDGDRNMIY-----GCGPAFVSPGDSVAIIAEYASEIPY-FKKQG 329

Query: 390 LHRLYMVNSTVSSQMIKKMAEIEGFNYEETLTGFKWIGNRAIDLINKGNIVPFGYEEAIG 449
           ++ L    S  +S  I ++A+ +G    E  TG+K+       L +   +   G EE+ G
Sbjct: 330 IYGL--ARSFPTSAAIDRVAKEQGLACYEVPTGWKFF----CALFDAKKLSICG-EESFG 382

Query: 450 YMFPTMEIDKDGIAATVIFIQAFMYWNQ 477
                +  +KDG+ A V ++     +N+
Sbjct: 383 TGSNHVR-EKDGVWAIVAWLNILAIYNR 409

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score = 36.6 bits (83), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 31/65 (47%), Gaps = 18/65 (27%)

Query: 164 ASVGVMVTASHNPKMDNGYKVYYSNGCQIIPPHDSGISQCIDANLEPWENSWNYKEIMAN 223
           A VGVM+TASHNP  DNG K        ++ PH   ++         WE    +   +AN
Sbjct: 56  AYVGVMLTASHNPPEDNGVK--------LVDPHGEMLA-------AEWE---KHATALAN 97

Query: 224 AESKG 228
             S+G
Sbjct: 98  CASQG 102

>TBLA0I01380 Chr9 complement(297671..299386) [1716 bp, 571 aa] {ON}
           Anc_2.445 YKL127W
          Length = 571

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 91/394 (23%), Positives = 148/394 (37%), Gaps = 63/394 (15%)

Query: 106 VIGHDHRYHSKEFAKIAATVFLIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNL--- 162
           V+G D RY++       A +    G K   +  + L        + TP     ++     
Sbjct: 59  VVGGDGRYYNDAILHNIAAIGAANGVKKLIVGQNGL--------LSTPAASHIIRTYAPG 110

Query: 163 KASVGVMVTASHN---PKMDNGYKVYYSNGCQIIPPHDSGISQCIDANLEPWENS---WN 216
           + + G+++TASHN   PK D G K    NG     P    +++ I      WE S    N
Sbjct: 111 EITGGIILTASHNPGGPKNDMGIKYNIQNGA----PAPEPVTEAI------WEASKKLQN 160

Query: 217 YKEI----------MANAESKGDLIYHRDVMLNDYITQLEEKLTSKDIIHLSKKIDV--K 264
           YK I          +   +  G L+         Y+  ++E     D   + K +D   K
Sbjct: 161 YKIIKDFPELELKTLGKNKQYGPLLVDVIDTCEAYVQFIKEIF---DFPLIKKFVDTQRK 217

Query: 265 SKPW-FVYTPMHGVGYEIFTKISNEILHMKEGEDFIVVEEQKHPDPGFPTVSFPNPEEKG 323
           +K W  ++  M+GV       I  + L +   E    V +  HP P F     P+P    
Sbjct: 218 TKNWKLLFDGMNGVTGPYGKAIFVDELGLPADE----VLKDWHPSPDFGG-HHPDPNLTY 272

Query: 324 AIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQGTWHQFTGNEIGYLFAYFEFQKY 383
           A  + +   +   I    A+D D DR  I        G      G+ +  +  Y     Y
Sbjct: 273 AKSL-VDRVDKEKIEFGAASDGDGDRNMIY-----GYGPAFVSPGDSVAIIAEYASDIPY 326

Query: 384 KISKQDLHRLYMVNSTVSSQMIKKMAEIEGFNYEETLTGFKWIGNRAIDLINKGNIVPFG 443
              K  ++ L     T SS  I ++A+  G    E  TG+K+       L +   +   G
Sbjct: 327 -FKKNGIYGLARSFPTASS--IDRVAKAHGLKAYEVPTGWKFF----CKLFDSKKVSICG 379

Query: 444 YEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQ 477
            EE+ G     +  +KDG+ A + ++     +NQ
Sbjct: 380 -EESFGTGSNHVR-EKDGVWAIIAWLNILAIYNQ 411

>Ecym_2475 Chr2 complement(927999..929702) [1704 bp, 567 aa] {ON}
           similar to Ashbya gossypii ABL029W
          Length = 567

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 96/439 (21%), Positives = 168/439 (38%), Gaps = 54/439 (12%)

Query: 61  GTAGLRSTMEAGFSRMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFAK 120
           GT+GLR   +       T   +QA       +        Q  I V+G D RY++    +
Sbjct: 19  GTSGLRKKTKVFQQEHYTENFIQA-------ILEAIPEGCQDAILVVGGDGRYYNDVVMQ 71

Query: 121 IAATVFLIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNL--KASVGVMVTASHN--- 175
             A V    G K   +  + L        + TP     ++    K + G+++TASHN   
Sbjct: 72  KIAEVGSANGVKKLIIGQNGL--------MSTPAASHLIRTYAEKVTGGIILTASHNPGG 123

Query: 176 PKMDNGYKVYYSNGCQIIPPHDSGISQCIDANLEPWENSWNYKEI----MANAESKGDLI 231
           P  D G K   +NG        S + + I   L  ++    + ++    +   +  GDL+
Sbjct: 124 PDNDLGIKYNLANGAPAPEKVTSAMYE-ISKKLTHYKIVEPFPKLDLSRIGTDQKYGDLL 182

Query: 232 YHRDVMLNDYITQLEEKLTSKDIIHLSKKIDVKSKPWFVYTPMHGV----GYEIFTKISN 287
                    Y+  ++E      I    +K   +     ++  ++G+    G  IF     
Sbjct: 183 VDIIDTTAAYVKLVKEIFDFDLIKSFLQKAQSEYDFKILFDALNGITGPYGRAIFVD--- 239

Query: 288 EILHMKEGEDFIVVEEQKHPDPGFPTVSFPNPEEKGAIDMGIKLAEDNGISLVIANDPDA 347
               +   E F+   +   P P F  +  P+P    A D+  ++ E+  I+   A+D D 
Sbjct: 240 ---ELGLPEHFL---QHCTPLPDFGGLH-PDPNLTYAHDLVSRVDEEQ-IAFGAASDGDG 291

Query: 348 DRFSIAVKSKGSQGTWHQFTGNEIGYLFAYFEFQKYKISKQDLHRLYMVNSTVSSQMIKK 407
           DR  I        G      G+ +  +  Y +   Y  +K  +H L    S  +S  I  
Sbjct: 292 DRNMIY-----GAGPAFVSPGDSVAIIAEYAQEIPY-FAKNGIHGL--ARSFPTSGAIDL 343

Query: 408 MAEIEGFNYEETLTGFKWIGNRAIDLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVI 467
           +A+  G N  E  TG+K+  N    L +   +   G EE+ G     +  +KDG+ A + 
Sbjct: 344 VAKEHGLNCYEVPTGWKFFCN----LFDSKKLSICG-EESFGTGSDHIR-EKDGLWAIIA 397

Query: 468 FIQAFMYWNQIDKMDPYEI 486
           ++     +N+ +   P  I
Sbjct: 398 WLNVLAIYNRRNPEKPASI 416

>Kpol_1033.54 s1033 (136243..137955) [1713 bp, 570 aa] {ON}
           (136243..137955) [1713 nt, 571 aa]
          Length = 570

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 58/136 (42%), Gaps = 22/136 (16%)

Query: 61  GTAGLRSTMEAGFSRMN-TLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFA 119
           GT+GLR   +   S  N T   +Q+   +   + N  KN+      V+G D R+++    
Sbjct: 19  GTSGLRKKTKIFMSEKNYTENFIQS---ILNSIPNGVKNS----TIVVGGDGRFYNDIIL 71

Query: 120 KIAATVFLIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNLKASV---GVMVTASHN- 175
                +    G +   +          N  + TP   + ++N K S    G+++TASHN 
Sbjct: 72  DKIMQISAANGVRKLVIGQ--------NGILSTPAASYIIRNYKESCNGGGIILTASHNP 123

Query: 176 --PKMDNGYKVYYSNG 189
             P+ D G K   SNG
Sbjct: 124 GGPENDIGIKYNLSNG 139

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar
           to uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
           Essential N-acetylglucosamine- phosphate mutase a
           hexosephosphate mutase involved in the biosynthesis of
           chitin
          Length = 544

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 31/64 (48%), Gaps = 20/64 (31%)

Query: 165 SVGVMVTASHNPKMDNGYKVYYSNGCQIIPPHDSGISQCIDANLEPWENSW-NYKEIMAN 223
           +VGVM+TASHNP  DNG K+                   +D   E  E SW +Y   +AN
Sbjct: 57  TVGVMITASHNPPEDNGVKI-------------------VDPKGEMLEQSWESYATDLAN 97

Query: 224 AESK 227
           + ++
Sbjct: 98  SATQ 101

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 541

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 15/19 (78%), Positives = 16/19 (84%)

Query: 166 VGVMVTASHNPKMDNGYKV 184
           VGVM+TASHNP  DNG KV
Sbjct: 54  VGVMITASHNPPEDNGVKV 72

>KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.335
           YDL159W
          Length = 494

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/126 (22%), Positives = 62/126 (49%), Gaps = 15/126 (11%)

Query: 395 MVNSTVSSQMIKKMAEIEGFNYEETLTGFKWIGNRAIDLINKGNIVPFGYE-EAIGYMFP 453
           M+N T++ ++I  M  ++  ++++ L+ +K   +R ++     N +  G E + + +   
Sbjct: 218 MINHTINDEIIILMEYMDCSSFDKILSVYKSFQSRKME-----NGLQEGVEHKQLTWFNN 272

Query: 454 TMEIDKDGIAATVIFIQAFMYWNQIDKMDPYEIIQLGFKKYGVFIEYNGYYRYTDLGITK 513
            + + K  I+  V+   A++Y N       Y+II    K   V +   GY +  D G++K
Sbjct: 273 PLVLSK--ISFGVLSGLAYLYEN-------YKIIHRDIKPSNVLLNSKGYVKICDFGVSK 323

Query: 514 KIFDYV 519
           K+ + +
Sbjct: 324 KMINSI 329

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
           Anc_6.11 YEL058W
          Length = 545

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 19/28 (67%)

Query: 165 SVGVMVTASHNPKMDNGYKVYYSNGCQI 192
           +VGVM+TASHN   DNG K+   +G  +
Sbjct: 57  AVGVMITASHNQPCDNGVKIVEPDGSML 84

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
           similar to Ashbya gossypii ACR015W
          Length = 551

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 13/19 (68%), Positives = 15/19 (78%)

Query: 166 VGVMVTASHNPKMDNGYKV 184
           VG M+TASHNP  DNG K+
Sbjct: 58  VGAMITASHNPPQDNGVKL 76

>Kwal_55.21088 s55 (680183..684550) [4368 bp, 1455 aa] {ON} YGR116W
           (SPT6) - transcriptional regulator, interacts with
           histones, primarily histone H3, possesses nucleosome
           assembly activity [contig 132] FULL
          Length = 1455

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 67/156 (42%), Gaps = 37/156 (23%)

Query: 407 KMAEIEGFNYEETLTGFKWIGNRAIDLINKGNI-VPFGYEEAIGYMFPTMEIDKDGIAA- 464
           K+A  + F  +  LTGFK     AI  ++K N+ VPF Y     Y+      +KDG    
Sbjct: 342 KLAVDKNFEPDYDLTGFKEAVGNAIRFVSKENLEVPFIYAYRRNYISSK---EKDGFVLN 398

Query: 465 ---------------TVIFIQAFM--YWNQIDKMDPYEIIQLGFKKYGVFIEYNGYYRYT 507
                          ++I+ + ++  ++ Q+D  DP  I++  FK  G           T
Sbjct: 399 EDDLWEILYMDAEFHSIIYKRDYVRKFYKQLDIQDP--IVEEYFKNQGSST--------T 448

Query: 508 DLGITKKIFDYVRYDY-----DKGVSEGNKKYPDHI 538
           DL   + I++Y+ + +     D  +S+GN     H+
Sbjct: 449 DLTSLQDIYNYLEFKFAREINDALLSQGNGSTKKHM 484

>TPHA0G02900 Chr7 (622303..624012) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 102/459 (22%), Positives = 182/459 (39%), Gaps = 71/459 (15%)

Query: 61  GTAGLRSTMEAGFSRMN-TLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFA 119
           GT+GLR   +   +  N T   +QA   +   +   ++N+      V+G D R+++    
Sbjct: 19  GTSGLRKKSKVFMNEPNYTENFIQA---ILDAIPEGSENS----TLVVGGDGRFYNDVIL 71

Query: 120 KIAATVFLIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNLKASV--GVMVTASHN-- 175
           ++ A +    G +   +    +        + TP     ++     V  G+++TASHN  
Sbjct: 72  QLIAEIGAANGVRKLIIGQAGI--------LSTPAASHIIRTYHEEVTGGIILTASHNPG 123

Query: 176 -PKMDNGYKVYYSNGCQIIPPHDSGISQCI---DANLEPWENSWNYKEIMANAESK---- 227
            P+ D G K   +NG     P    ++  I     NL  ++   ++ +I  N  S+    
Sbjct: 124 GPENDIGIKYNLANGG----PAPESVTNAIWEASKNLTTYKTMKDFPKIDINTISENVKY 179

Query: 228 GDLIYHRDVMLNDYITQLEEKLTSKDIIHLSKKIDVKSKP--W-FVYTPMHGVGYEIFTK 284
           G L+        DY+  L+E     D   + K I+ + K   W  ++  ++GV       
Sbjct: 180 GPLLIDIIDSTEDYVKFLKEIF---DFPLIKKFIETQRKTNNWKLLFDSLNGVTGPYGKA 236

Query: 285 ISNEILHMKEGEDFIVVEEQKHPDPGFPTVSFPNPEEKGAIDMGIKLAEDNGISLVIAND 344
           I  +   +   E    V +  HP P F  +  P+P    A  + +   +   I    A+D
Sbjct: 237 IFVDEFGLPADE----VLQNWHPQPDFGGLH-PDPNLTYARTL-VDRVDKEKIEFGAASD 290

Query: 345 PDADR-----FSIAVKSKGSQGTWHQFTGNEIGYLFAYFEFQKYKISKQDLHRLYMVNST 399
            D DR     +  A  S G          NEI Y            +KQ ++   +  S 
Sbjct: 291 GDGDRNMIYGYGPAFVSPGDSVAIIAEYANEIPYF-----------AKQGIYG--VARSF 337

Query: 400 VSSQMIKKMAEIEGFNYEETLTGFKWIGNRAIDLINKGNIVPFGYEEAIGYMFPTMEIDK 459
            +S  I  +A+ +G +  E  TG+K+       L +   +   G EE+ G     +  +K
Sbjct: 338 PTSSAIDLVAKHKGLDCYEVPTGWKFF----CALFDAKKLSICG-EESFGTGSNHVR-EK 391

Query: 460 DGIAATVIFIQAFMYWNQ--IDKMDPYEIIQLGF-KKYG 495
           DG+ A + ++     +N+   +K    + IQ  F +KYG
Sbjct: 392 DGVWAIIAWLNILAIYNKHHPEKDASIKTIQTEFWQKYG 430

>KNAG0A06280 Chr1 (955994..957706) [1713 bp, 570 aa] {ON} 
          Length = 570

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 42/89 (47%), Gaps = 13/89 (14%)

Query: 106 VIGHDHRYHSKEFAKIAATVFLIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNLK-- 163
           VIG D R+++       A +    G +   +  + L        + TP   + +++ K  
Sbjct: 59  VIGGDGRFYNDVVINKIAAISAANGVRKLVIGQNGL--------LSTPATSYIIRSYKDK 110

Query: 164 ASVGVMVTASHN---PKMDNGYKVYYSNG 189
           A+ G+++TASHN   P+ D G K   +NG
Sbjct: 111 ATGGIILTASHNPGGPENDMGIKYNLANG 139

>KAFR0A04200 Chr1 complement(842429..843211) [783 bp, 260 aa] {ON}
           Anc_8.740 YOR280C
          Length = 260

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 20/31 (64%)

Query: 181 GYKVYYSNGCQIIPPHDSGISQCIDANLEPW 211
           GY+++Y  G ++IP +D G+ +  DA +  W
Sbjct: 32  GYELHYPCGTEVIPANDVGLEEDTDAEMFGW 62

>ABL029W Chr2 (343850..345556) [1707 bp, 568 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL127W (PGM1) and
           YMR105C (PGM2)
          Length = 568

 Score = 31.2 bits (69), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 43/95 (45%), Gaps = 13/95 (13%)

Query: 101 QKLIAVIGHDHRYHSKEFAKIAATVFLIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVK 160
           +  + VIG D RY++    +  A V    G +   +  + L        + TP     ++
Sbjct: 53  ENAVLVIGGDGRYYNDAVMQKIAEVGSANGVRKLIIGQNGL--------LSTPAASHIIR 104

Query: 161 NL--KASVGVMVTASHNPKM-DNGYKVYY--SNGC 190
               K + G+++TASHNP   DN + + Y  +NG 
Sbjct: 105 TYHDKVTGGIILTASHNPGGPDNDFGIKYNLANGA 139

>Ecym_3368 Chr3 (700956..702965) [2010 bp, 669 aa] {ON} similar to
           Ashbya gossypii ADL286W
          Length = 669

 Score = 31.2 bits (69), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 22/88 (25%), Positives = 44/88 (50%), Gaps = 2/88 (2%)

Query: 502 GYYRYTDLGITKKIFDYVRYDYDKGVSEG--NKKYPDHIGEEFKIIKYRDLTTGYQSDTP 559
            Y+++ D  + + +F Y+ Y +D+ V++   +KK+ DHI +  +      LT    S++P
Sbjct: 237 NYFKFLDKYLDENLFKYIEYFHDEEVTKSVIHKKFVDHILDPVREKIQATLTKISTSNSP 296

Query: 560 DNKPLLPVDPSSQMITVEMIPTDNESDG 587
            +   L +  S   IT   +  ++  DG
Sbjct: 297 ADIKTLVILISQIFITDNALLKNHLYDG 324

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.136    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 74,276,384
Number of extensions: 3491392
Number of successful extensions: 10310
Number of sequences better than 10.0: 75
Number of HSP's gapped: 10413
Number of HSP's successfully gapped: 75
Length of query: 643
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 527
Effective length of database: 40,180,143
Effective search space: 21174935361
Effective search space used: 21174935361
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)