Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
TBLA0B032408.837ON28428412551e-176
ZYRO0G14124g8.837ON3692521555e-11
KAFR0B039008.837ON3792191539e-11
CAGL0M02937g8.837ON3732171521e-10
KLLA0D01859g8.837ON3712521474e-10
TDEL0B006008.837ON3692181458e-10
Smik_13.4898.837ON3722341458e-10
Ecym_46088.837ON4062581459e-10
Suva_13.4648.837ON3662181432e-09
Skud_13.4488.837ON3642261413e-09
Kwal_27.102758.837ON379691396e-09
TBLA0D032308.837ON375691371e-08
KLTH0C03938g8.837ON3762221361e-08
NDAI0K004408.837ON4042271352e-08
TPHA0I002208.837ON3772201324e-08
YMR276W (DSK2)8.837ON3732181307e-08
SAKL0D01540g8.837ON3652171262e-07
Kpol_1068.118.837ON3812371236e-07
ABL129W8.837ON345691236e-07
Kwal_27.101521.480ON381721227e-07
NCAS0C004308.837ON3692371228e-07
CAGL0L01309g1.480ON3921091192e-06
TDEL0G017504.16ON77501073e-06
NDAI0H002704.16ON77501073e-06
AFR285C5.701ON128501104e-06
KNAG0L021205.701ON128501104e-06
Ecym_40195.701ON128501105e-06
ZYRO0G06622g5.701ON128501096e-06
Smik_9.215.701ON124501086e-06
KLLA0A00616g5.701ON128501087e-06
TPHA0E002405.701ON128501087e-06
TPHA0D046005.701ON128501087e-06
TBLA0E021105.701ON128501087e-06
CAGL0G02475g5.701ON128501087e-06
SAKL0E14894g5.701ON128501087e-06
Skud_9.205.701ON125501087e-06
Smik_11.3575.701ON125501087e-06
Kwal_YGOB_Anc_5.7015.701ON128501087e-06
KLTH0E01078g5.701ON128501087e-06
TDEL0B022005.701ON128501088e-06
Kpol_1043.695.701ON128501088e-06
KNAG0A027308.386ON150491098e-06
AGL128W8.386ON152491098e-06
KAFR0D022305.701ON128501088e-06
KAFR0H002205.701ON128501088e-06
Suva_11.3305.701ON128501088e-06
Skud_11.3335.701ON128501088e-06
YIL148W (RPL40A)5.701ON128501088e-06
YKR094C (RPL40B)5.701ON128501088e-06
NDAI0E050305.701ON128501088e-06
NCAS0A032105.701ON128501088e-06
NCAS0G002405.701ON128501088e-06
Suva_10.32singletonON62481038e-06
NCAS0C029408.386ON152491099e-06
Kpol_1030.58.386ON152491081e-05
Kpol_1024.168.386ON152491081e-05
KNAG0C065805.701ON149491081e-05
TPHA0C023908.386ON150491081e-05
NDAI0G022808.386ON152491081e-05
KAFR0H020008.386ON152491081e-05
Kwal_23.33118.386ON150491081e-05
KLTH0F08734g8.386ON150491081e-05
YLR167W (RPS31)8.386ON152491081e-05
TDEL0F051008.386ON150491071e-05
Suva_10.2668.386ON152501071e-05
Skud_12.2348.386ON152501071e-05
Smik_12.2298.386ON152501071e-05
CAGL0G08173g8.386ON152491071e-05
KLTH0C03410g1.480ON391721121e-05
ZYRO0C04026g8.386ON152491071e-05
TBLA0H031808.386ON152491071e-05
KLLA0D18304g8.386ON150491071e-05
Ecym_41818.386ON152491071e-05
Ecym_84084.16ON153501072e-05
SAKL0H13926g8.386ON154491072e-05
TPHA0K022504.16ON153501072e-05
KNAG0J028804.16ON153501072e-05
TDEL0C025901.480ON368721112e-05
Suva_9.405.701ON144471062e-05
Suva_10.34singletonON151491062e-05
TBLA0G006704.16ON229501074e-05
NDAI0D049304.16ON229501074e-05
KAFR0I014704.16ON229501074e-05
Kwal_55.206074.16ON231501074e-05
KLTH0E05852g4.16ON409501084e-05
Suva_10.33singletonON254501074e-05
NDAI0F003005.701ON187491055e-05
SAKL0H25784g4.16ON305501075e-05
Skud_12.294.16ON381501076e-05
YLL039C (UBI4)4.16ON381501076e-05
ACL062C4.16ON382501076e-05
NCAS0C058504.16ON388501076e-05
Smik_12.184.16ON460501076e-05
Suva_10.304.16ON381501076e-05
KLLA0E00749g4.16ON381501076e-05
ZYRO0G07854g4.16ON460501077e-05
Kpol_1070.64.16ON533501077e-05
CAGL0D05082g4.16ON533501077e-05
NCAS0G041201.480ON392721069e-05
KNAG0J002908.837ON367721051e-04
Smik_5.561.480ON397741041e-04
Kpol_370.61.480ON404741041e-04
YEL037C (RAD23)1.480ON398741032e-04
KLLA0E22133g1.480ON383741023e-04
Skud_5.531.480ON397741013e-04
ZYRO0F05192g1.480ON384731004e-04
SAKL0D11814g1.480ON40074996e-04
Suva_10.31singletonON6449897e-04
Suva_5.321.480ON40974987e-04
TBLA0B021601.480ON40477970.001
TPHA0C008908.311ON7745890.001
NDAI0G003301.480ON42776890.009
NCAS0B035208.311ON7745820.010
NDAI0J010708.311ON7740780.037
YDR139C (RUB1)8.311ON7754770.040
Kpol_1036.628.311ON7745770.042
KAFR0E005301.480ON37966840.043
TDEL0F043808.311ON7761760.052
KNAG0G005101.480ON37575830.059
KLTH0G12540g8.311ON7753760.065
TPHA0O004401.480ON36976820.074
Ecym_35721.480ON44375790.17
KLLA0F17974g8.311ON7761720.18
ZYRO0D05962g8.311ON7740710.27
AFR358W1.480ON41375740.74
SAKL0H15818g8.311ON7749670.90
KAFR0I027801.480ON21431649.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= TBLA0B03240
         (284 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.83...   488   e-176
ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} simi...    64   5e-11
KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.8...    64   9e-11
CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highl...    63   1e-10
KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} simila...    61   4e-10
TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {O...    60   8e-10
Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276...    60   8e-10
Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar...    60   9e-10
Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276...    60   2e-09
Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276...    59   3e-09
Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa] {...    58   6e-09
TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa] {O...    57   1e-08
KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {...    57   1e-08
NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {O...    57   2e-08
TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837...    55   4e-08
YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}  DSK2Nucle...    55   7e-08
SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {...    53   2e-07
Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {O...    52   6e-07
ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic ho...    52   6e-07
Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa] {...    52   7e-07
NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}...    52   8e-07
CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa] ...    50   2e-06
TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16 ...    46   3e-06
NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON} A...    46   3e-06
AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp, ...    47   4e-06
KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387...    47   4e-06
Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}...    47   5e-06
ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128 a...    47   6e-06
Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C (REAL)     46   6e-06
KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa] {...    46   7e-06
TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa] {O...    46   7e-06
TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083) [...    46   7e-06
TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387 ...    46   7e-06
CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387...    46   7e-06
SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212) ...    46   7e-06
Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C (REAL)     46   7e-06
Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa] {O...    46   7e-06
Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128...    46   7e-06
KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128 a...    46   7e-06
TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa...    46   8e-06
Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa] {...    46   8e-06
KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON...    47   8e-06
AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic hom...    47   8e-06
KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa...    46   8e-06
KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa] {O...    46   8e-06
Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387...    46   8e-06
Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387...    46   8e-06
YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}  ...    46   8e-06
YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,...    46   8e-06
NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634) [...    46   8e-06
NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa...    46   8e-06
NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa] {O...    46   8e-06
Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON} Y...    44   8e-06
NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON...    47   9e-06
Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}...    46   1e-05
Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON...    46   1e-05
KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304) [...    46   1e-05
TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON...    46   1e-05
NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON...    46   1e-05
KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON...    46   1e-05
Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON...    46   1e-05
KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa] {O...    46   1e-05
YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusio...    46   1e-05
TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.38...    46   1e-05
Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W...    46   1e-05
Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W...    46   1e-05
Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W...    46   1e-05
CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly ...    46   1e-05
KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa] {...    48   1e-05
ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar...    46   1e-05
TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.38...    46   1e-05
KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON} simil...    46   1e-05
Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON} ...    46   1e-05
Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to...    46   2e-05
SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa] ...    46   2e-05
TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.1...    46   2e-05
KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.1...    46   2e-05
TDEL0C02590 Chr3 complement(448900..450006) [1107 bp, 368 aa] {O...    47   2e-05
Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W (REAL)     45   2e-05
Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON} ...    45   2e-05
TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16...    46   4e-05
NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON}              46   4e-05
KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.70...    46   4e-05
Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa] {O...    46   4e-05
KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {...    46   4e-05
Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON} ...    46   4e-05
NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701        45   5e-05
SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highl...    46   5e-05
Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,...    46   6e-05
YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}  U...    46   6e-05
ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON} S...    46   6e-05
NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON}             46   6e-05
Smik_12.18 Chr12 complement(49088..49552,49091..49552,49091..495...    46   6e-05
Suva_10.30 Chr10 complement(67747..67841,68061..68288,68558..690...    46   6e-05
KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON...    46   6e-05
ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa] {...    46   7e-05
Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON...    46   7e-05
CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} simila...    46   7e-05
NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON} Anc_1.4...    45   9e-05
KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON...    45   1e-04
Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON} Y...    45   1e-04
Kpol_370.6 s370 (10094..11308) [1215 bp, 404 aa] {ON} (10094..11...    45   1e-04
YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}  RA...    44   2e-04
KLLA0E22133g Chr5 complement(1974635..1975786) [1152 bp, 383 aa]...    44   3e-04
Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON} Y...    44   3e-04
ZYRO0F05192g Chr6 (434982..436136) [1155 bp, 384 aa] {ON} simila...    43   4e-04
SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} simila...    43   6e-04
Suva_10.31 Chr10 complement(68008..68199) [192 bp, 64 aa] {ON} Y...    39   7e-04
Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON} Y...    42   7e-04
TBLA0B02160 Chr2 complement(496901..498115) [1215 bp, 404 aa] {O...    42   0.001
TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]...    39   0.001
NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}...    39   0.009
NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234 ...    36   0.010
NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa...    35   0.037
YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp, ...    34   0.040
Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [23...    34   0.042
KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa] {O...    37   0.043
TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234 ...    34   0.052
KNAG0G00510 Chr7 complement(85742..86869) [1128 bp, 375 aa] {ON}...    37   0.059
KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 7...    34   0.065
TPHA0O00440 Chr15 (78697..79806) [1110 bp, 369 aa] {ON} Anc_1.48...    36   0.074
Ecym_3572 Chr3 complement(1083184..1084515) [1332 bp, 443 aa] {O...    35   0.17 
KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 7...    32   0.18 
ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa...    32   0.27 
AFR358W Chr6 (1087725..1088966) [1242 bp, 413 aa] {ON} Syntenic ...    33   0.74 
SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 7...    30   0.90 
KAFR0I02780 Chr9 (560687..561331) [645 bp, 214 aa] {ON} Anc_1.48...    29   9.6  

>TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.837
           YMR276W
          Length = 284

 Score =  488 bits (1255), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 246/284 (86%), Positives = 246/284 (86%)

Query: 1   MISVNIKFKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYN 60
           MISVNIKFKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYN
Sbjct: 1   MISVNIKFKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYN 60

Query: 61  FKDGHCIIVIIHKEEKXXXXXXXXXXXXXXXXXSVYPASNTPINSPTPFGEGNIITITTT 120
           FKDGHCIIVIIHKEEK                 SVYPASNTPINSPTPFGEGNIITITTT
Sbjct: 61  FKDGHCIIVIIHKEEKNNLHPPPNNTTNLNPNNSVYPASNTPINSPTPFGEGNIITITTT 120

Query: 121 SPDPYGVRSNEVHDPEVERELLQVLDHPRSFXXXXXXXXXXXXXRFLIQTNPHLRHMDIN 180
           SPDPYGVRSNEVHDPEVERELLQVLDHPRSF             RFLIQTNPHLRHMDIN
Sbjct: 121 SPDPYGVRSNEVHDPEVERELLQVLDHPRSFQENEMLLNNQNLLRFLIQTNPHLRHMDIN 180

Query: 181 GARQVLRDPRLQRAFMDVNFLNQQISLRRTAIEHANNGITHPGSSNETITVVTRIDESGN 240
           GARQVLRDPRLQRAFMDVNFLNQQISLRRTAIEHANNGITHPGSSNETITVVTRIDESGN
Sbjct: 181 GARQVLRDPRLQRAFMDVNFLNQQISLRRTAIEHANNGITHPGSSNETITVVTRIDESGN 240

Query: 241 LVGNAVDQEQYRRNQIEVALQAHRQALDRLXXXXXXXXHPPPGK 284
           LVGNAVDQEQYRRNQIEVALQAHRQALDRL        HPPPGK
Sbjct: 241 LVGNAVDQEQYRRNQIEVALQAHRQALDRLQNQNQQQQHPPPGK 284

>ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} similar
           to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
           Nuclear-enriched ubiquitin-like polyubiquitin- binding
           protein required for spindle pole body (SPB) duplication
           and for transit through the G2/M phase of the cell cycle
           involved in proteolysis interacts with the proteasome
          Length = 369

 Score = 64.3 bits (155), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 61/252 (24%), Positives = 100/252 (39%), Gaps = 29/252 (11%)

Query: 2   ISVNIKFKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNF 61
           I+V IK  + K+ +  + +  +S    +I    +IP ++QRLIYSG+IL  ++TL+ YN 
Sbjct: 4   ITVQIKSGQNKWEVTVDPESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQFYNL 63

Query: 62  KDGHCIIVIIHKEEKXXXXXXXXXXXXX-----------XXXXSVYPASNTPIN-SPTPF 109
           +DGH + ++   +                              S  P +  P N S    
Sbjct: 64  QDGHSVHLVKSSKAPGNASGGSSSTAAATAGSGASAVPPSGNASTTPTTGAPSNLSAGQS 123

Query: 110 GEGNIITITTT----------SPDPYGVRSNEVHDPEVERELLQVLDHPRSFXXXXXXXX 159
           G  N +   T+          S D +G      + P  E +LL +LD+P           
Sbjct: 124 GGFNPLADLTSARYAGFTSLPSADMFGPDGGATNMPNQE-DLLNMLDNPIFQSQMNEMLS 182

Query: 160 XXXXXRFLIQTNPHLRHMDINGARQVLRDPRLQRAFMDVNFLNQQISLRRT-----AIEH 214
                 F+IQ+NP L+ M    ARQ+ + P  ++   +   + Q +   R          
Sbjct: 183 NPQMVDFMIQSNPQLQAMGPQ-ARQMFQSPFFRQMLTNPQMIRQSMQFARMMNPGGGEND 241

Query: 215 ANNGITHPGSSN 226
           A N    PG+ N
Sbjct: 242 AANAFPAPGNEN 253

>KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.837
           YMR276W
          Length = 379

 Score = 63.5 bits (153), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 52/219 (23%), Positives = 97/219 (44%), Gaps = 13/219 (5%)

Query: 2   ISVNIKFKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNF 61
           I+++IK  + K+ + + L + I+ +  +I    +IP  NQRLIYSG+IL  ++T++ Y  
Sbjct: 3   ITIHIKSGQNKWDVNTNLSDSIATLKEEISKISEIPATNQRLIYSGKILKDDQTVESYKI 62

Query: 62  KDGHCIIVIIHKEEKXXXXXXXXXXXXXXXXXSVYPASNTPINSPT----PFGEGNIIT- 116
           ++GH I ++                       +   A + P N  +     F   N +T 
Sbjct: 63  EEGHSIHLVKSGGNVARNSAATNTTPTATSNENTNSAPSVPSNIASGQTGGFNPLNDLTS 122

Query: 117 ------ITTTSPDPYGVRSNEVHDPEVERELLQVLDHPRSFXXXXXXXXXXXXXRFLIQT 170
                 +   S D +G        P  + ++L++LD+P                 F+IQ+
Sbjct: 123 ARYAGYLNMPSADMFGPDGGLNSGPS-QDDMLRMLDNPVFQSQMNEMLSNPQMIDFMIQS 181

Query: 171 NPHLRHMDINGARQVLRDPRLQRAFMDVNFLNQQISLRR 209
           NP L+ M    ARQ+L+ P  ++  ++ + + Q +   R
Sbjct: 182 NPQLQAMGPQ-ARQMLQSPMFRQMLINPDMIRQSMQFAR 219

>CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highly
           similar to uniprot|P48510 Saccharomyces cerevisiae
           YMR276w DSK2
          Length = 373

 Score = 63.2 bits (152), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 51/217 (23%), Positives = 95/217 (43%), Gaps = 14/217 (6%)

Query: 2   ISVNIKFKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNF 61
           I+++IK  + K+ +  +  + I ++  +I    +IP  NQRLIYSG+IL  ++T++ YN 
Sbjct: 3   ITIHIKSGQNKWDVSIDPSQTILNLKEEIAKVSEIPSGNQRLIYSGKILKDDQTVESYNI 62

Query: 62  KDGHCIIVIIHKEEKXXXXXXXXXXXXXXXXXSVYPASNTPINSPTPFGEGNIITITTT- 120
           KD H I ++                       +  P++   I S    G   +  +T   
Sbjct: 63  KDDHAIHMVKSGGNASTSNAPTNANESSNSSTTAVPSN---IASGQTGGFNPLADLTGAR 119

Query: 121 --------SPDPYGVRSNEVHDPEVERELLQVLDHPRSFXXXXXXXXXXXXXRFLIQTNP 172
                   S D +G      + P+ + E+L+++++P                 F+IQ+NP
Sbjct: 120 YAGYANLPSADMFGPDGGINNAPD-QDEMLRMMENPIFQSQMNEMLSNPEMLDFMIQSNP 178

Query: 173 HLRHMDINGARQVLRDPRLQRAFMDVNFLNQQISLRR 209
            L+ M    ARQ+L+ P  ++   +   + Q +   R
Sbjct: 179 QLQAMGPQ-ARQMLQSPFFRQMLTNPAMIRQSMQFAR 214

>KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} similar
           to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
           Nuclear-enriched ubiquitin-like polyubiquitin- binding
           protein required for spindle pole body (SPB) duplication
           and for transit through the G2/M phase of the cell cycle
           involved in proteolysis interacts with the proteasome
          Length = 371

 Score = 61.2 bits (147), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 63/252 (25%), Positives = 101/252 (40%), Gaps = 29/252 (11%)

Query: 2   ISVNIKFKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNF 61
           ISV++K  +  +T+E E    I      I     +P +NQRLIYSG+IL   +T++ Y  
Sbjct: 4   ISVHVKSGQNNWTVEIESAATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVESYKI 63

Query: 62  KDGHCIIVI--IHKEEKXXXXXXXXXXXXXXXXXSVYPASNTPINSPTPF---------- 109
           +DGH + ++                         S  P SN        F          
Sbjct: 64  QDGHSVHMVKSGGASAATTGSTTTGSAASPAATNSAAP-SNISAGQTGGFNPLADLTGAR 122

Query: 110 --GEGNIITITTTSPDPYGVRSNEVHDPEVERELLQVLDHPRSFXXXXXXXXXXXXXRFL 167
             G  N+ +     PD  G+ S+   +PE    +LQ+L++P                 FL
Sbjct: 123 YAGLANLPSADMFGPD-GGLNSSNGANPE---SMLQMLENPIFQSQMNEMLSNPQMVDFL 178

Query: 168 IQTNPHLRHMDINGARQVLRDPRLQRAFMDVNFLNQQISLRRT---AIEHANNGITHPGS 224
           IQ NP L+ +    AR +L+ P  ++   D   + Q + +  +   + + A +    PGS
Sbjct: 179 IQQNPQLQALGPR-ARDMLQSPFFRQMMTDPQMIRQSMQMANSMGMSPDGAASAFPAPGS 237

Query: 225 ------SNETIT 230
                 +NET T
Sbjct: 238 ASGAGGANETST 249

>TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score = 60.5 bits (145), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 52/218 (23%), Positives = 94/218 (43%), Gaps = 16/218 (7%)

Query: 2   ISVNIKFKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNF 61
           I+V +K  + K+ +    ++ +++   +I    +IP  NQRLIYSG+IL  ++ ++ Y  
Sbjct: 3   ITVQVKCGQSKWEVSVNPEKTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNVESYKI 62

Query: 62  KDGHCIIVIIHKEEKXXXXXXXXXXXXXXXXXSVYPASNT-PIN-SPTPFGEGNIITITT 119
           +DGH I ++  K                    +  P S T P N +    G  N ++  T
Sbjct: 63  QDGHAIHLV--KSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIASGQTGGFNPLSDLT 120

Query: 120 T----------SPDPYGVRSNEVHDPEVERELLQVLDHPRSFXXXXXXXXXXXXXRFLIQ 169
           +          S D +G      + P  + ++L +L++P                 F+IQ
Sbjct: 121 SARYAGFTNLPSADMFGPDGGLTNMPN-QDDMLGMLENPIFQSQMNEMLSNPQMVDFMIQ 179

Query: 170 TNPHLRHMDINGARQVLRDPRLQRAFMDVNFLNQQISL 207
           +NP L+ M    ARQ+L+ P  ++   +   L Q +  
Sbjct: 180 SNPQLQAMGPQ-ARQLLQSPFFRQMLTNPQMLRQSMQF 216

>Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276W
           (REAL)
          Length = 372

 Score = 60.5 bits (145), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 51/234 (21%), Positives = 102/234 (43%), Gaps = 12/234 (5%)

Query: 2   ISVNIKFKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNF 61
           ++++IK  ++K+ +    +  +S     I     +P  NQRLIYSG+IL  ++T++ Y+ 
Sbjct: 3   LNIHIKSGQDKWEVSVAPESTVSQFKEAISKANGVPVANQRLIYSGKILKDDQTVESYHI 62

Query: 62  KDGHCIIVIIHKEEKXXXXXXXXXXXXXXXXXSVYPASNTPINSPTPFGEGNIITITTT- 120
           +DGH +  ++  + K                 +    +   ++S    G   +  +T+  
Sbjct: 63  QDGHSVH-LVKSQPKPQPGAAAGTNNATATGAAAGTVATPNMSSGQSAGFNPLADLTSAR 121

Query: 121 --------SPDPYGVRSNEV-HDPEVERELLQVLDHPRSFXXXXXXXXXXXXXRFLIQTN 171
                   S D +G     + +D   + ELL+++++P                 F+IQ+N
Sbjct: 122 YAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQSN 181

Query: 172 PHLRHMDINGARQVLRDPRLQRAFMDVNFLNQQISLRRTAIEHANNGITHPGSS 225
           P L+ M    ARQ+L+ P  ++   + + + Q +   R    +A  G T   +S
Sbjct: 182 PQLQAMGPQ-ARQMLQSPMFRQMLTNPDMIRQSMQFARMMDPNAGTGSTGGAAS 234

>Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar to
           Ashbya gossypii ABL129W
          Length = 406

 Score = 60.5 bits (145), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 64/258 (24%), Positives = 108/258 (41%), Gaps = 36/258 (13%)

Query: 2   ISVNIKFKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNF 61
           IS+++K  + K+ + ++    I  +  +I +   IP  NQRLIYSG+IL  ++T++ Y  
Sbjct: 3   ISLHVKSGQNKWQVSADPSSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTVESYKI 62

Query: 62  KDGHCIIVIIHKEEKXXXXXXXXXXXXXXXXXSVYPASNTPINSPTPFGEGNIITITTTS 121
            DGH     IH                     SV    +   NS    G G+ +    T+
Sbjct: 63  ADGHS----IHLVRSGGGKVSGSSGATGGASGSVEAVGSGGRNSTA--GSGSTVPNNITA 116

Query: 122 ---------PDPYGVR--------SNEVHDPE-------VERELLQVLDHPRSFXXXXXX 157
                     D  G R        S ++  P+        + E+L +LD+P         
Sbjct: 117 GQMGGFNPLADLTGARYAGYANLPSTDMFGPDGGLNSAIGQEEILGMLDNPIFQSQVNEM 176

Query: 158 XXXXXXXRFLIQTNPHLRHMDINGARQVLRDPRLQRAFMDVNFLNQQISLRRTAIEHANN 217
                   FLIQ +PHL+ M    AR++L+ P  ++   + + + +Q+S  +  +  AN 
Sbjct: 177 LANPQMIDFLIQQHPHLQAMGP-AAREMLQSPFFRQMMTNPDVI-RQVSRFQMDMGAANG 234

Query: 218 GITH----PGSSNETITV 231
             T+    PGS+N + T 
Sbjct: 235 QSTNDFPAPGSANNSATT 252

>Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276W
           (REAL)
          Length = 366

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/218 (21%), Positives = 95/218 (43%), Gaps = 11/218 (5%)

Query: 2   ISVNIKFKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNF 61
           ++V +K  ++K+ +    +  +      I +   IP  NQRLIYSG+IL  ++T++ Y+ 
Sbjct: 3   LNVYVKSGQDKWEVSVAPESTVLQFKEAISEANGIPVANQRLIYSGKILKDDQTVESYHI 62

Query: 62  KDGHCIIVIIHKEEKXXXXXXXXXXXXXXXXXSVYPASNTPINSPTPFGEGNIITITTT- 120
           +DGH + ++  +                    +   ++   ++S    G   +  +T+  
Sbjct: 63  QDGHSVHLVKSQPRPQAGAATGAGGDAGASATNASVSATPNMSSGQSAGFNPLADLTSAR 122

Query: 121 --------SPDPYGVRSNEV-HDPEVERELLQVLDHPRSFXXXXXXXXXXXXXRFLIQTN 171
                   S D +G     + +D   + ELL+++D+P                 F+IQ+N
Sbjct: 123 YAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMDNPIFQSQMNEMLSNPQMLDFMIQSN 182

Query: 172 PHLRHMDINGARQVLRDPRLQRAFMDVNFLNQQISLRR 209
           P L+ M    ARQ+L+ P  ++   + + + Q +   R
Sbjct: 183 PQLQAMGPQ-ARQMLQSPMFRQMLTNPDMIRQSMQFAR 219

>Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276W
           (REAL)
          Length = 364

 Score = 58.9 bits (141), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 50/226 (22%), Positives = 99/226 (43%), Gaps = 12/226 (5%)

Query: 2   ISVNIKFKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNF 61
           ++++IK  ++K+ +    +  +      I     IP  NQRLIYSG+IL  ++T+  Y+ 
Sbjct: 3   LNIHIKSGQDKWEVAVAPECTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTVDSYHI 62

Query: 62  KDGHCIIVIIHKEEKXXXXXXXXXXXXXXXXXSVYPASNTPINSPTPFGEGNIITITTT- 120
           +DGH +  ++  + K                 +V  ++   ++S    G   +  +T+  
Sbjct: 63  QDGHSVH-LVKSQPKPDAGGATGANNATATSAAVGTSATPNMSSGQSAGFNPLADLTSAR 121

Query: 121 --------SPDPYGVRSNEV-HDPEVERELLQVLDHPRSFXXXXXXXXXXXXXRFLIQTN 171
                   S D +G     + +D   + ELL+++++P                 F+IQ+N
Sbjct: 122 YAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQSN 181

Query: 172 PHLRHMDINGARQVLRDPRLQRAFMDVNFLNQQISLRRTAIEHANN 217
           P L+ M    ARQ+L+ P  ++   +   + Q +   R    +A+N
Sbjct: 182 PQLQAMGPQ-ARQMLQSPMFRQMLTNPEMMRQSMQFARMMDPNADN 226

>Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa]
          {ON} YMR276W (DSK2) - ubiquitin-like protein [contig
          37] FULL
          Length = 379

 Score = 58.2 bits (139), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 41/69 (59%)

Query: 2  ISVNIKFKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNF 61
          I+V++K  + K+ +  + D  ++     I +   I P NQRLIYSG+IL  ++TL+ Y  
Sbjct: 3  ITVHVKSGQSKWDVSVDADSTVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTLESYKI 62

Query: 62 KDGHCIIVI 70
           DGH + ++
Sbjct: 63 LDGHAVHLV 71

>TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa]
          {ON} Anc_8.837 YMR276W
          Length = 375

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 42/69 (60%)

Query: 2  ISVNIKFKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNF 61
          ISV+IK  +  + +E E    I D   KI    +IP  NQRLIYSG+IL  ++T++ Y  
Sbjct: 3  ISVHIKSGQNTWDVEIEASSTIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTIESYKI 62

Query: 62 KDGHCIIVI 70
          +DGH I ++
Sbjct: 63 QDGHSIHMV 71

>KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {ON}
           some similarities with uniprot|P48510 Saccharomyces
           cerevisiae YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 376

 Score = 57.0 bits (136), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/222 (22%), Positives = 90/222 (40%), Gaps = 20/222 (9%)

Query: 2   ISVNIKFKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNF 61
           I+V+IK  + K+ +  +    I+     I    +I P NQRLIYSG+IL  ++T++ Y  
Sbjct: 3   ITVHIKSGQNKWDVAIDPSSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTVESYKI 62

Query: 62  KDGHCIIVIIHKEEK-------XXXXXXXXXXXXXXXXXSVYPASNTPINSPTPFGEG-N 113
            D H + ++     K                        +  P  + P N  T  G G N
Sbjct: 63  LDDHSVHLVKSGGSKKATSPGATAAASGDATATGATSTPAAQPQQSAPANLSTGQGNGFN 122

Query: 114 IITITTT----------SPDPYGVRSNEVHDPEVERELLQVLDHPRSFXXXXXXXXXXXX 163
            ++  T+          S D +G        P  + ++L++L++P               
Sbjct: 123 PLSDLTSARYAGFLNLPSADSFGPDGGMTSAPNSD-DVLRMLENPVMQSQMNEMLSNPQM 181

Query: 164 XRFLIQTNPHLRHMDINGARQVLRDPRLQRAFMDVNFLNQQI 205
             FLIQ +P L+ M    AR +L+ P  ++   + + + Q +
Sbjct: 182 IDFLIQQSPQLQSMGPQ-ARTLLQSPFFRQMMTNPDMIRQSM 222

>NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {ON}
           Anc_8.837 YMR276W
          Length = 404

 Score = 56.6 bits (135), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/227 (21%), Positives = 95/227 (41%), Gaps = 38/227 (16%)

Query: 2   ISVNIKFKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNF 61
           IS++IK  +  + +  +    I+ +  +I    +IP  NQRLIYSG+IL  ++ +  YN 
Sbjct: 4   ISIHIKSGQNNWQVSIDTTASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDFYNI 63

Query: 62  KDGHCIIVIIHKEEKX---------------------XXXXXXXXXXXXXXXXSVYPASN 100
           +DGH + ++   ++                                       + Y   N
Sbjct: 64  QDGHSVHLVRSGKKSTPTPATTNTTTNASNNTVPSNISAGQTGGFNPLADLTSARYAGYN 123

Query: 101 TPINSPTPFGEGNIITITTTSPDPYGVRSNEVHDPEVERELLQVLDHPRSFXXXXXXXXX 160
             + S   FG    +  + T+PD +    + + +P V+ ++ ++L +P+           
Sbjct: 124 LNLPSADAFGPDGGMNQSGTNPDEF---LSMLDNPIVQSQMNEMLSNPQMID-------- 172

Query: 161 XXXXRFLIQTNPHLRHMDINGARQVLRDPRLQRAFMDVNFLNQQISL 207
                F+IQ+NP L+ M    ARQ+ + P  ++   + + + Q + L
Sbjct: 173 -----FMIQSNPQLQAMGPQ-ARQMFQSPMFRQMLTNPDMIRQSMQL 213

>TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837
           YMR276W
          Length = 377

 Score = 55.5 bits (132), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 50/220 (22%), Positives = 89/220 (40%), Gaps = 14/220 (6%)

Query: 2   ISVNIKFKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNF 61
           ISV IK  + K+ +  E    I +    I    DIP  NQRLIYSG+IL   +T++ Y  
Sbjct: 3   ISVQIKSGQNKWDVAVEPSNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETVESYKI 62

Query: 62  KDGHCIIVIIHKEEKXXXXXXXXXXXXXXXXXSVYPASNTPIN--SPTPFGEGNIITITT 119
           +DGH I ++   +                   +    S  P N  S    G   +  +T+
Sbjct: 63  QDGHSIHLVKSGDASANAAKSSTAAAATANAAAGSAESAVPTNITSGQTNGFNPLADLTS 122

Query: 120 T----------SPDPYGVRSNEVHDPEVERELLQVLDHPRSFXXXXXXXXXXXXXRFLIQ 169
                      S D +G      + P  + ++L +L++P                 ++I 
Sbjct: 123 ARYAGYNLPMPSADMFGPDGGMTNMPN-QDDMLSMLENPVFQSQMNEMLSNPQMVEYMIN 181

Query: 170 TNPHLRHMDINGARQVLRDPRLQRAFMDVNFLNQQISLRR 209
           +NP L+ +    AR++ + P  ++   + + + Q + + R
Sbjct: 182 SNPQLQALGPQ-AREMFQSPFFRQMLTNPDMIRQSMEMAR 220

>YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}
           DSK2Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein, required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle, involved in proteolysis,
           interacts with the proteasome
          Length = 373

 Score = 54.7 bits (130), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 47/218 (21%), Positives = 95/218 (43%), Gaps = 12/218 (5%)

Query: 2   ISVNIKFKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNF 61
           ++++IK  ++K+ +    +  +      I     IP  NQRLIYSG+IL  ++T++ Y+ 
Sbjct: 3   LNIHIKSGQDKWEVNVAPESTVLQFKEAINKANGIPVANQRLIYSGKILKDDQTVESYHI 62

Query: 62  KDGHCIIVIIHKEEKXXXXXXXXXXXXXXXXXSVYPASNTPINSPTPFGEGNIITITTT- 120
           +DGH  + ++  + K                 +    +   ++S    G   +  +T+  
Sbjct: 63  QDGHS-VHLVKSQPKPQTASAAGANNATATGAAAGTGATPNMSSGQSAGFNPLADLTSAR 121

Query: 121 --------SPDPYGVRSNEV-HDPEVERELLQVLDHPRSFXXXXXXXXXXXXXRFLIQTN 171
                   S D +G     + +D   + ELL+++++P                 F+IQ+N
Sbjct: 122 YAGYLNMPSADMFGPDGGALNNDSNNQDELLRMMENPIFQSQMNEMLSNPQMLDFMIQSN 181

Query: 172 PHLRHMDINGARQVLRDPRLQRAFMDVNFLNQQISLRR 209
           P L+ M    ARQ+L+ P  ++   + + + Q +   R
Sbjct: 182 PQLQAMGPQ-ARQMLQSPMFRQMLTNPDMIRQSMQFAR 218

>SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {ON}
           similar to uniprot|P48510 Saccharomyces cerevisiae
           YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin- binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 365

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/217 (22%), Positives = 89/217 (41%), Gaps = 12/217 (5%)

Query: 2   ISVNIKFKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNF 61
           I+++IK  + K+ +  E    + ++   I    +IPP NQRLIYSG+IL  ++T++ Y  
Sbjct: 3   ITLHIKSGQNKWDVSIEPTNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTVESYKI 62

Query: 62  KDGHCIIVIIHKEEKXXXXXXXXXXXXXXXXXSVYPASNTPINSPTPFGEGNIITITTT- 120
            D H + ++     K                 +     +  I+S    G   +  +T   
Sbjct: 63  ADDHAVHLVRSGGPKPAASKSESTSATDTGAAAAAAVPSN-ISSGQTGGFNPLADLTGAR 121

Query: 121 --------SPDPYGVRSNEVHDPEVERELLQVLDHPRSFXXXXXXXXXXXXXRFLIQTNP 172
                   S D +G      + P  + E+L +LD+P                 F+IQ NP
Sbjct: 122 YAGYANLPSADMFGPDGGLTNAPNSD-EILNMLDNPIVQSQMNEMLSNPQMVDFMIQQNP 180

Query: 173 HLRHMDINGARQVLRDPRLQRAFMDVNFLNQQISLRR 209
            L+ M    AR++L+    ++   + + + Q +   R
Sbjct: 181 QLQAMGPR-ARELLQSDYFRQMMTNPDMIRQSMQFAR 216

>Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {ON}
           complement(21199..22344) [1146 nt, 382 aa]
          Length = 381

 Score = 52.0 bits (123), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 51/237 (21%), Positives = 98/237 (41%), Gaps = 16/237 (6%)

Query: 2   ISVNIKFKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNF 61
           I ++IK  + K+ +  ++   +  +  +I    +IP  NQRLIYSG+IL  ++ L+ Y  
Sbjct: 3   IKIHIKSGQNKWEVTVDVSNTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVLEFYKI 62

Query: 62  KDGHCIIVIIHKEEKXXXXXXXXXXXXXXXXXSVYPASNTPINSPTPFGEGN----IITI 117
           +D H I ++  K                    +    SN P+ S    G+      +  +
Sbjct: 63  QDEHSIHLV--KSGGASKTNTSASAAAASTSTATNSDSNAPLPSNIAAGQSGGFNPLSDL 120

Query: 118 TTTSPDPYGVR--SNEVHDPEV-------ERELLQVLDHPRSFXXXXXXXXXXXXXRFLI 168
           T+     YG+   S ++  P+        + ++L++L++P                 F+I
Sbjct: 121 TSARYAGYGLNLPSADMFGPDGGMNSMPNQDDMLRMLENPVFQSQMNEMLSNPQMIDFMI 180

Query: 169 QTNPHLRHMDINGARQVLRDPRLQRAFMDVNFLNQQISLRRTAIEHANNGITHPGSS 225
           Q+NP L+ M    ARQ+ + P  ++   +   + Q + +      +   G     SS
Sbjct: 181 QSNPQLQAMGPE-ARQMFQSPFFRQMLTNPEMIRQSMQMANMMGGNGQFGANAAASS 236

>ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YMR276W (DSK2)
          Length = 345

 Score = 52.0 bits (123), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 40/69 (57%)

Query: 2  ISVNIKFKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNF 61
          I + +K  + ++ +  E    + ++  +I    +IP  NQRLIYSG+IL  ++T++ Y  
Sbjct: 3  IKIQVKSGQNRWEVSVEASGSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTVESYKI 62

Query: 62 KDGHCIIVI 70
           DGH I ++
Sbjct: 63 ADGHAIHLV 71

>Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa]
          {ON} YEL037C (RAD23) - ubiquitin-like protein [contig
          41] FULL
          Length = 381

 Score = 51.6 bits (122), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 44/72 (61%), Gaps = 1/72 (1%)

Query: 1  MISVNIK-FKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDY 59
          M+ +N K FK++   +E EL   +++   K+ ++ +   +  +LIYSG+IL  ++T+ DY
Sbjct: 1  MVKINFKDFKKQVLALELELSSTVNEAKQKLAENKECDDSQIKLIYSGKILQDDRTIGDY 60

Query: 60 NFKDGHCIIVII 71
            KDG  +I +I
Sbjct: 61 KLKDGDQVIFMI 72

>NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score = 51.6 bits (122), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 53/237 (22%), Positives = 97/237 (40%), Gaps = 18/237 (7%)

Query: 2   ISVNIKFKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNF 61
           IS+++K  +  + +  +    I  +  +I    ++P  NQRLI+SG+IL  ++T++ Y  
Sbjct: 3   ISIHVKSGQNNWQVSIDPASTILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTVEFYKI 62

Query: 62  KDGHCIIVIIHKEEKXXXXXXXXXXXXXXXXXSVYP-ASNTPINSPTPFGEGNIIT---- 116
            DG    + IH  +                  +  P A N        F   + +T    
Sbjct: 63  LDG----LSIHMVKSGGGSANKNKSPPPQANTTATPVAPNMAAGETGGFNPLSDLTSARY 118

Query: 117 ---ITTTSPDPYGVRSNEVHDPEVERELLQVLDHPRSFXXXXXXXXXXXXXRFLIQTNPH 173
              +   S D +G      +    + E+L++LD+P                 F+IQ NP 
Sbjct: 119 AGYLNLPSADTFGPDGGLNNSGPNQDEMLRMLDNPVFQSQMNEMLSNPQMLDFIIQANPQ 178

Query: 174 LRHMDINGARQVLRDPRLQRAFMDVNFLNQQISLRRTAIEHANNGITHPGSSNETIT 230
           L+ M    ARQ+L++P  ++   + + + Q + + R     A NG   P  + +  T
Sbjct: 179 LQAMGPQ-ARQILQNPMFRQMLTNPDMIRQSMQMAR-----AMNGGVDPNGNGQANT 229

>CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa]
           {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
           YEL037c RAD23 nucleotide excision repair protein
          Length = 392

 Score = 50.4 bits (119), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 52/109 (47%), Gaps = 3/109 (2%)

Query: 1   MISVNIK-FKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDY 59
           M+SV  K FK+EK+ ++ E  + I  +   + + L   P+  +LI+SG++L    +++  
Sbjct: 1   MVSVTFKNFKKEKYPLDLESSQSIVAVKEALSEKLSCDPSQIKLIFSGKVLKDGDSVESC 60

Query: 60  NFKDGHCIIVIIHKEEKXXXXXXXXXXXXXXXXXSVYPASNTPINSPTP 108
           NFKDG+ +I ++    K                    P+ +TP  S  P
Sbjct: 61  NFKDGNEVIFMVSA--KKATATKVTESSAPKAQSEETPSESTPATSTQP 107

>TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16
          YLL039C
          Length = 77

 Score = 45.8 bits (107), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON}
          Anc_4.16
          Length = 77

 Score = 45.8 bits (107), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp,
          128 aa] {ON} Syntenic homolog of Saccharomyces
          cerevisiae YKR094C (RPL40B) and YIL148W (RPL40A);
          1-intron
          Length = 128

 Score = 47.0 bits (110), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387
          bp, 128 aa] {ON} 
          Length = 128

 Score = 47.0 bits (110), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}
          similar to Ashbya gossypii AFR285C 1-intron
          Length = 128

 Score = 47.0 bits (110), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128
          aa] {ON} highly similar to uniprot|P14796 Saccharomyces
          cerevisiae YKR094C RPL40B
          Length = 128

 Score = 46.6 bits (109), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C
          (REAL)
          Length = 124

 Score = 46.2 bits (108), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 9  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 58

>KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa]
          {ON} highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YKR094C RPL40B Fusion protein, identical to
          Rpl40Ap, that is cleaved to yield ubiquitin and a
          ribosomal protein of the large (60S) ribosomal subunit
          with similarity to rat L40; ubiquitin may facilitate
          assembly of the ribosomal protein into ribosomes
          Length = 128

 Score = 46.2 bits (108), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa]
          {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 46.2 bits (108), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083)
          [387 bp, 128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 46.2 bits (108), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387
          bp, 128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 46.2 bits (108), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387
          bp, 128 aa] {ON} highly similar to uniprot|P04838
          Saccharomyces cerevisiae YKR094c UBI2 ubiquitin and
          highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YIL148w UBI1 ubiquitin
          Length = 128

 Score = 46.2 bits (108), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212)
          [387 bp, 128 aa] {ON} highly similar to uniprot|P61864
          Saccharomyces cerevisiae YLR167W RPS31 and highly
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YIL148W and highly similar to uniprot|P04838
          Saccharomyces cerevisiae YKR094C and highly similar to
          uniprot|P04838 Saccharomyces cerevisiae YLL039C Fusion
          proteins that are cleaved to yield a ribosomal protein
          of the small (40S) subunit and ubiquitin
          Length = 128

 Score = 46.2 bits (108), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C
          (REAL)
          Length = 125

 Score = 46.2 bits (108), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 10 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 59

>Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa]
          {ON} YKR094C (REAL)
          Length = 125

 Score = 46.2 bits (108), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 10 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 59

>Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128
          aa] {ON} ANNOTATED BY YGOB -
          Length = 128

 Score = 46.2 bits (108), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128
          aa] {ON} highly similar to uniprot|P61864 Saccharomyces
          cerevisiae YKR094c RPL40B and highly similar to
          uniprot|P61864 Saccharomyces cerevisiae YIL148w RPL40A
          Length = 128

 Score = 46.2 bits (108), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa]
          {ON} 
          Length = 128

 Score = 46.2 bits (108), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa]
          {ON} complement(145335..145721) [387 nt, 129 aa]
          Length = 128

 Score = 46.2 bits (108), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON}
          Anc_8.386 YLR167W
          Length = 150

 Score = 46.6 bits (109), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 33/49 (67%)

Query: 14 TIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
          T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 14 TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YLR167W (RPS31)
          Length = 152

 Score = 46.6 bits (109), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 33/49 (67%)

Query: 14 TIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
          T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 14 TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa]
          {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 46.2 bits (108), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa]
          {ON} 
          Length = 128

 Score = 46.2 bits (108), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387
          bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score = 46.2 bits (108), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387
          bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score = 46.2 bits (108), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}
          RPL40AFusion protein, identical to Rpl40Bp, that is
          cleaved to yield ubiquitin and a ribosomal protein of
          the large (60S) ribosomal subunit with similarity to
          rat L40; ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes
          Length = 128

 Score = 46.2 bits (108), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,
          128 aa] {ON}  RPL40BFusion protein, identical to
          Rpl40Ap, that is cleaved to yield ubiquitin and a
          ribosomal protein of the large (60S) ribosomal subunit
          with similarity to rat L40; ubiquitin may facilitate
          assembly of the ribosomal protein into ribosomes
          Length = 128

 Score = 46.2 bits (108), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634)
          [387 bp, 128 aa] {ON} Anc_5.701
          Length = 128

 Score = 46.2 bits (108), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa]
          {ON} Anc_5.701
          Length = 128

 Score = 46.2 bits (108), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa]
          {ON} Anc_5.701
          Length = 128

 Score = 46.2 bits (108), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON}
          YLL039C (REAL)
          Length = 62

 Score = 44.3 bits (103), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 32/48 (66%)

Query: 15 IESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
          +E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 1  LEVEYSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 48

>NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON}
          Anc_8.386
          Length = 152

 Score = 46.6 bits (109), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 33/49 (67%)

Query: 14 TIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
          T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 14 TLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}
          complement(10263..10721) [459 nt, 153 aa]
          Length = 152

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 33/49 (67%)

Query: 14 TIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
          T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 14 TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON}
          complement(58683..59141) [459 nt, 153 aa]
          Length = 152

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 33/49 (67%)

Query: 14 TIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
          T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 14 TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304)
          [450 bp, 149 aa] {ON} 
          Length = 149

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 33/49 (67%)

Query: 14 TIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
          T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 14 TLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON}
          Anc_8.386 YLR167W
          Length = 150

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 33/49 (67%)

Query: 14 TIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
          T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 14 TLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON}
          Anc_8.386
          Length = 152

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 33/49 (67%)

Query: 14 TIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
          T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 14 TLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON}
          Anc_8.386 YLR167W
          Length = 152

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 33/49 (67%)

Query: 14 TIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
          T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 14 TLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON}
          YLR167W (RPS31) - Ribosomal protein S31 (S37) (YS24)
          [contig 251] FULL
          Length = 150

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 33/49 (67%)

Query: 14 TIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
          T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 14 TLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa]
          {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167W RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 150

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 33/49 (67%)

Query: 14 TIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
          T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 14 TLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusion
          protein that is cleaved to yield a ribosomal protein of
          the small (40S) subunit and ubiquitin; ubiquitin may
          facilitate assembly of the ribosomal protein into
          ribosomes; interacts genetically with translation
          factor eIF2B
          Length = 152

 Score = 46.2 bits (108), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 33/49 (67%)

Query: 14 TIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
          T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 14 TLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.386
          YLR167W
          Length = 150

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 33/49 (67%)

Query: 14 TIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
          T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 14 TLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly
          similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167w UBI3 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 152

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 33/49 (67%)

Query: 14 TIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
          T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 14 TLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037C RAD23
          Length = 391

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 42/72 (58%), Gaps = 1/72 (1%)

Query: 1  MISVNIK-FKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDY 59
          M+ +N K FK++   +E +    IS+   ++ ++ D   +  +LIYSG+IL  ++T+ DY
Sbjct: 1  MVKINFKDFKKQVLALELDSGSTISEAKQRLAENKDCDESQIKLIYSGKILQDDRTIADY 60

Query: 60 NFKDGHCIIVII 71
             DG  +I +I
Sbjct: 61 KLNDGDQVIFMI 72

>ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar
          to uniprot|P05759 Saccharomyces cerevisiae YLR167W
          RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes interacts genetically
          with translation factor eIF2B
          Length = 152

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 33/49 (67%)

Query: 14 TIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
          T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 14 TLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.386
          YLR167W
          Length = 152

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 33/49 (67%)

Query: 14 TIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
          T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 14 TLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON}
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLR167W RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin; ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes; interacts genetically
          with translation factor eIF2B
          Length = 150

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 33/49 (67%)

Query: 14 TIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
          T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 14 TLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON}
          similar to Ashbya gossypii AGL128W
          Length = 152

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 33/49 (67%)

Query: 14 TIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
          T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 14 TLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to
          Ashbya gossypii ACL062C
          Length = 153

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 89  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 138

>SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa]
          {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167W RPS31 and similar to uniprot|P04838
          Saccharomyces cerevisiae YIL148W and similar to
          uniprot|P04838 Saccharomyces cerevisiae YKR094C and
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLL039C Fusion proteins that are cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 154

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 33/49 (67%)

Query: 14 TIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
          T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 14 TLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

>TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.16
          YLL039C
          Length = 153

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 89  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 138

>KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.16
          YLL039C
          Length = 153

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 89  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 138

>TDEL0C02590 Chr3 complement(448900..450006) [1107 bp, 368 aa]
          {ON} Anc_1.480 YEL037C
          Length = 368

 Score = 47.4 bits (111), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 41/72 (56%), Gaps = 1/72 (1%)

Query: 1  MISVNIK-FKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDY 59
          M+S+  K FK+EK  ++ +L   + D  +++    +      +LIYSG++L   K+L++ 
Sbjct: 1  MVSITFKDFKKEKIPLDLDLSSSVLDAKVQLAQKKECEEGQIKLIYSGKVLQDSKSLQES 60

Query: 60 NFKDGHCIIVII 71
            KDG  +I +I
Sbjct: 61 GLKDGDQVIFMI 72

>Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W
          (REAL)
          Length = 144

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/47 (44%), Positives = 32/47 (68%)

Query: 14 TIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYN 60
          T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN
Sbjct: 30 TLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 76

>Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON}
          YALI0E18986g (REAL)
          Length = 151

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 33/49 (67%)

Query: 14 TIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
          T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 14 TLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 33/49 (67%)

Query: 14  TIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 90  TLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 138

>TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16
          YLL039C
          Length = 229

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 89  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 138

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 165 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 214

>NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON} 
          Length = 229

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 89  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 138

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 165 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 214

>KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.701
          YIL148W
          Length = 229

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 89  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 138

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 165 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 214

>Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa]
          {ON} YLL039C (UBI4) - 1:1 [contig 144] FULL
          Length = 231

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 89  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 138

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 165 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 214

>KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {ON}
           highly similar to uniprot|P04838 Saccharomyces
           cerevisiae YLL039c UBI4 ubiquitin
          Length = 409

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 117 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 166

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 193 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 242

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 269 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 318

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 345 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 394

>Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON}
          YLL039C (REAL)
          Length = 254

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 89  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 138

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 165 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 214

>NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701
          Length = 187

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 33/49 (67%)

Query: 14  TIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 73  TLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 121

>SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highly
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLL039c UBI4 ubiquitin
          Length = 305

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 89  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 138

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 165 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 214

 Score = 45.8 bits (107), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 241 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 290

>Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,
          381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 89  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 138

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 165 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 214

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 241 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 290

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 317 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 366

>YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}
          UBI4Ubiquitin, becomes conjugated to proteins, marking
          them for selective degradation via the ubiquitin-26S
          proteasome system; essential for the cellular stress
          response; encoded as a polyubiquitin precursor
          comprised of 5 head-to-tail repeats
          Length = 381

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 89  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 138

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 165 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 214

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 241 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 290

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 317 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 366

>ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YLL039C
          (UBI4)
          Length = 382

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 89  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 138

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 165 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 214

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 241 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 290

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 317 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 366

>NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON} 
          Length = 388

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 89  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 138

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 165 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 214

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 241 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 290

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 317 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 366

>Smik_12.18 Chr12
          complement(49088..49552,49091..49552,49091..49546)
          [1383 bp, 460 aa] {ON} YLL039C (REAL)
          Length = 460

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 89  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 138

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 167 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 216

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 243 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 292

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 321 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 370

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 397 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 446

>Suva_10.30 Chr10
          complement(67747..67841,68061..68288,68558..69013,
          69256..69622) [1146 bp, 381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 89  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 138

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 165 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 214

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 241 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 290

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 32/50 (64%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++ + L+  +TL DYN +
Sbjct: 317 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAEKQLEDGRTLSDYNIQ 366

>KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON}
          highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YLL039c UBI4 ubiquitin
          Length = 381

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 89  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 138

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 165 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 214

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 241 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 290

 Score = 45.8 bits (107), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 317 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 366

>ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa]
          {ON} highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YLL039c UBI4 ubiquitin
          Length = 460

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 89  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 138

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 165 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 214

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 241 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 290

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 317 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 366

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 393 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 442

>Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON}
          complement(16980..18581) [1602 nt, 534 aa]
          Length = 533

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 89  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 138

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 165 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 214

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 241 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 290

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 317 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 366

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 393 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 442

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 469 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 518

>CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} similar
          to uniprot|P04838 Saccharomyces cerevisiae YLL039c UBI4
          ubiquitin
          Length = 533

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13 FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
           T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 13 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 89  ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 138

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 165 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 214

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 241 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 290

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 317 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 366

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 393 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 442

 Score = 45.8 bits (107), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 33/50 (66%)

Query: 13  FTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
            T+E E  + I ++  KI+D   IPP+ QRLI++G+ L+  +TL DYN +
Sbjct: 469 ITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 518

>NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON}
          Anc_1.480 YEL037C
          Length = 392

 Score = 45.4 bits (106), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 1  MISVNIK-FKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDY 59
          MI++  K FK+EK  +  E    + D   ++  +     +  +LIYSG++L   KTL+D 
Sbjct: 1  MINITFKDFKKEKIPLALESTNTVLDAKTQLAQNKSCEESQIKLIYSGKVLQDAKTLEDC 60

Query: 60 NFKDGHCIIVII 71
            KDG  +I +I
Sbjct: 61 GLKDGDQVIFMI 72

>KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON}
          Anc_8.837 YMR276W
          Length = 367

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 40/72 (55%), Gaps = 3/72 (4%)

Query: 2  ISVNIKFKEEKF--TIESELDEL-ISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKD 58
          I+V +K  + ++   + SE  E  ++     +     +P  NQRLIYSG+IL   +TL++
Sbjct: 3  ITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEE 62

Query: 59 YNFKDGHCIIVI 70
          Y   DGH + ++
Sbjct: 63 YKITDGHTVHLV 74

>Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON}
          YEL037C (REAL)
          Length = 397

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 41/74 (55%), Gaps = 1/74 (1%)

Query: 1  MISVNIK-FKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDY 59
          M+S+  K FK+EK  ++ E    I ++  K+   +    +  +LIYSG++L   KT+ + 
Sbjct: 1  MVSLTFKNFKKEKVPLDLEPSNTIFEVKSKLAQSISCEESQIKLIYSGKVLQDSKTVSEC 60

Query: 60 NFKDGHCIIVIIHK 73
            KDG  ++ ++ +
Sbjct: 61 GLKDGDQVVFMVSQ 74

>Kpol_370.6 s370 (10094..11308) [1215 bp, 404 aa] {ON}
          (10094..11308) [1215 nt, 405 aa]
          Length = 404

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 40/74 (54%), Gaps = 1/74 (1%)

Query: 1  MISVNIK-FKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDY 59
          M+S+  K FK+EK  ++ E    + D   +I    D   +  +LIYSG++L  + T+ D 
Sbjct: 1  MVSITFKDFKKEKIPLDLEGSVTVLDAKKQIAVKKDCEDSQIKLIYSGKVLQNDSTIGDC 60

Query: 60 NFKDGHCIIVIIHK 73
            KDG  +I +I K
Sbjct: 61 GLKDGDQVIFMISK 74

>YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}
          RAD23Protein with ubiquitin-like N terminus, subunit of
          Nuclear Excision Repair Factor 2 (NEF2) with Rad4p that
          binds damaged DNA; enhances protein deglycosylation
          activity of Png1p; also involved, with Rad4p, in
          ubiquitylated protein turnover
          Length = 398

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 40/74 (54%), Gaps = 1/74 (1%)

Query: 1  MISVNIK-FKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDY 59
          M+S+  K FK+EK  ++ E    I +   K+   +    +  +LIYSG++L   KT+ + 
Sbjct: 1  MVSLTFKNFKKEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSEC 60

Query: 60 NFKDGHCIIVIIHK 73
            KDG  ++ ++ +
Sbjct: 61 GLKDGDQVVFMVSQ 74

>KLLA0E22133g Chr5 complement(1974635..1975786) [1152 bp, 383 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037C RAD23
          Length = 383

 Score = 43.9 bits (102), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 39/74 (52%), Gaps = 1/74 (1%)

Query: 4  VNIK-FKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
          +N K FK+EK  IE   D  IS     I +      +  +LIY+G+IL   KT+   N K
Sbjct: 3  INFKDFKKEKLPIELADDATISHAKELIAEQKQCDASQIKLIYAGKILQDPKTVSGCNLK 62

Query: 63 DGHCIIVIIHKEEK 76
          +G  +I +I K +K
Sbjct: 63 EGDQVIFMISKTKK 76

>Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON}
          YEL037C (REAL)
          Length = 397

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 39/74 (52%), Gaps = 1/74 (1%)

Query: 1  MISVNIK-FKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDY 59
          M+S+  K FK+EK  ++ E    I +   K+        +  +LIYSG++L   KT+ + 
Sbjct: 1  MVSLTFKNFKKEKVPLDLEPSNTIFEAKTKLAQSTSCEESQIKLIYSGKVLQDSKTVSEC 60

Query: 60 NFKDGHCIIVIIHK 73
            KDG  ++ +I +
Sbjct: 61 GLKDGDQVVFMISQ 74

>ZYRO0F05192g Chr6 (434982..436136) [1155 bp, 384 aa] {ON} similar
          to uniprot|P32628 Saccharomyces cerevisiae YEL037C
          RAD23
          Length = 384

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 40/73 (54%), Gaps = 1/73 (1%)

Query: 1  MISVNIK-FKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDY 59
          MI++  K FK+EK ++E +    + D  +++        +  +LIYSG++L   K L++ 
Sbjct: 1  MINIIFKDFKKEKISLELDPSSSVKDAKVRLATEKSCEESQIKLIYSGKVLQDAKNLQES 60

Query: 60 NFKDGHCIIVIIH 72
            KDG  +I +I 
Sbjct: 61 GLKDGDQVIFMIS 73

>SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} similar
          to uniprot|P32628 Saccharomyces cerevisiae YEL037C
          RAD23
          Length = 400

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 40/74 (54%), Gaps = 1/74 (1%)

Query: 1  MISVNIK-FKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDY 59
          MI++N K FK+EK  +E +    +     ++        +  +LI+SG++L   KTL++ 
Sbjct: 1  MITINFKDFKKEKLPLELDPTSTVLQAKQQLASTKSCDEDQIKLIFSGKVLQDGKTLEEC 60

Query: 60 NFKDGHCIIVIIHK 73
            KDG  +I +I K
Sbjct: 61 KLKDGDQVIFMISK 74

>Suva_10.31 Chr10 complement(68008..68199) [192 bp, 64 aa] {ON}
          YLR167W (REAL)
          Length = 64

 Score = 38.9 bits (89), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 19/49 (38%), Positives = 30/49 (61%)

Query: 14 TIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFK 62
          T+E E  + I ++  KI+D   IPP+ QRLI++G+ L  E+  +   FK
Sbjct: 14 TLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLGMEELCQTTTFK 62

>Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON}
          YEL037C (REAL)
          Length = 409

 Score = 42.4 bits (98), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 39/74 (52%), Gaps = 1/74 (1%)

Query: 1  MISVNIK-FKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDY 59
          M+S+  K FK+EK  ++ E    I +   K+        +  +LIYSG++L   KT+ + 
Sbjct: 1  MVSLTFKNFKKEKVPLDLEPSNTIFEAKTKLAQSSSCEESQIKLIYSGKVLQDSKTVSEC 60

Query: 60 NFKDGHCIIVIIHK 73
            KDG  ++ +I +
Sbjct: 61 GLKDGDQVVFMISQ 74

>TBLA0B02160 Chr2 complement(496901..498115) [1215 bp, 404 aa]
          {ON} Anc_1.480 YEL037C
          Length = 404

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 42/77 (54%), Gaps = 1/77 (1%)

Query: 1  MISVNIK-FKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDY 59
          M+S+  K FK+EK  +E + D  I     +I    +   +  +LIYSG+IL  + T+ + 
Sbjct: 1  MVSLIFKDFKKEKIPLELDADSTIESAKGQIASEKNCDIDQIKLIYSGKILKNDATILNS 60

Query: 60 NFKDGHCIIVIIHKEEK 76
            KD   II +I K++K
Sbjct: 61 GLKDNDHIIFMISKKKK 77

>TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]
          {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 38.9 bits (89), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 28/45 (62%), Gaps = 4/45 (8%)

Query: 24 SDITIKIKDHLD----IPPNNQRLIYSGRILDPEKTLKDYNFKDG 64
          SD    IKD L+    IPP+ QRLI+ G+ +D E+T++  N  DG
Sbjct: 20 SDKVFHIKDLLEEKEGIPPSQQRLIFQGKQIDDEQTVESANLIDG 64

>NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}
          Anc_1.480 YEL037C
          Length = 427

 Score = 38.9 bits (89), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 43/76 (56%), Gaps = 1/76 (1%)

Query: 1  MISVNIK-FKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDY 59
          M++V  K FK+EK  ++ E    I D+  ++        +  ++IYSG++L   +T+++ 
Sbjct: 1  MVNVIFKDFKKEKIPLDLEPSNTILDVKSQLAQAKACEESQIKIIYSGKVLQDGQTVEEC 60

Query: 60 NFKDGHCIIVIIHKEE 75
            K+G  II +I K++
Sbjct: 61 QLKEGDQIIFMISKKK 76

>NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234
          bp, 77 aa] {ON}
          Length = 77

 Score = 36.2 bits (82), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 28/45 (62%), Gaps = 4/45 (8%)

Query: 24 SDITIKIKDHLD----IPPNNQRLIYSGRILDPEKTLKDYNFKDG 64
          +D   +IK+ L+    IPP+ QRLI+ G+ +D E+T+   N  DG
Sbjct: 20 TDPVYRIKEMLEEKEGIPPSQQRLIFQGKQIDDEQTVSSANLIDG 64

>NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa]
          {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 34.7 bits (78), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 26/40 (65%), Gaps = 4/40 (10%)

Query: 29 KIKDHLD----IPPNNQRLIYSGRILDPEKTLKDYNFKDG 64
          +IK+ L+    IPP+ QRLI+ G+ +D E+++   N  DG
Sbjct: 25 RIKELLEEKEGIPPSQQRLIFQGKQIDDEQSVSSANLVDG 64

>YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp,
          77 aa] {ON}  RUB1Ubiquitin-like protein with similarity
          to mammalian NEDD8; conjugation (neddylation)
          substrates include the cullins Cdc53p, Rtt101p, and
          Cul3p; activated by Ula1p and Uba3p (E1 enzyme pair);
          conjugation mediated by Ubc12p (E2 enzyme)
          Length = 77

 Score = 34.3 bits (77), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 6/54 (11%)

Query: 15 IESELDELISDITIKIKDHLD----IPPNNQRLIYSGRILDPEKTLKDYNFKDG 64
          I  EL E  SD+   IK+ L+    IPP+ QRLI+ G+ +D + T+ D +  +G
Sbjct: 13 ISVELKE--SDLVYHIKELLEEKEGIPPSQQRLIFQGKQIDDKLTVTDAHLVEG 64

>Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [234
          bp, 77 aa] {ON}
          complement(173662..173746,173844..173992) [234 nt, 78
          aa]
          Length = 77

 Score = 34.3 bits (77), Expect = 0.042,   Method: Composition-based stats.
 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 4/45 (8%)

Query: 24 SDITIKIKDHLD----IPPNNQRLIYSGRILDPEKTLKDYNFKDG 64
          SD    IK+ L+    IPP+ QRLI+ G+ +D E+T+      DG
Sbjct: 20 SDKVYHIKELLEEKEGIPPSQQRLIFQGKQIDDEQTVDSAKLTDG 64

>KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa]
          {ON} Anc_1.480 YEL037C
          Length = 379

 Score = 37.0 bits (84), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 34/66 (51%)

Query: 8  FKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFKDGHCI 67
          FK+EK  +E E    I D   K+        +  +LI+SG++L  ++T+     KD   +
Sbjct: 8  FKKEKIPVELESSSTILDAKNKLASIKSCDIDQIKLIFSGKVLKDDQTVSSCGLKDNDQV 67

Query: 68 IVIIHK 73
          I++I K
Sbjct: 68 IMMISK 73

>TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234
          bp, 77 aa] {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 33.9 bits (76), Expect = 0.052,   Method: Composition-based stats.
 Identities = 17/61 (27%), Positives = 34/61 (55%)

Query: 11 EKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFKDGHCIIVI 70
          ++  +E + D  I  I   +++   IPP+ QRLI+ G+ +D  +TL+     DG  + ++
Sbjct: 11 KEIAVELKSDAPIYRIKQLLEEKEGIPPSQQRLIFQGKQIDDRQTLEAAKLVDGMVLHLV 70

Query: 71 I 71
          +
Sbjct: 71 L 71

>KNAG0G00510 Chr7 complement(85742..86869) [1128 bp, 375 aa] {ON}
          Anc_1.480 YEL037C
          Length = 375

 Score = 36.6 bits (83), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 40/75 (53%), Gaps = 2/75 (2%)

Query: 1  MISVNIK-FKEEKFTIESELD-ELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKD 58
          M+ V  K FK+ K T++ +L+ E + D+  K+    D      +LI+SG++L   K   +
Sbjct: 1  MVQVVFKDFKKNKETLDVDLEHESVKDVKEKLAAARDCDAEQIKLIFSGKVLQDAKPFAE 60

Query: 59 YNFKDGHCIIVIIHK 73
             K+   +I+++ K
Sbjct: 61 TGLKENDHVIMMVSK 75

>KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 33.9 bits (76), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 7/53 (13%)

Query: 25 DITIKIKDHLD----IPPNNQRLIYSGRILDPEKTLKDYNFKDG---HCIIVI 70
          D   +IK++L+    IPP  QRLI+ G+ +D +K++   N   G   H ++ +
Sbjct: 21 DKVYRIKEYLEEKEGIPPTQQRLIFQGKQIDDDKSVSSANLSSGMQLHLVLTL 73

>TPHA0O00440 Chr15 (78697..79806) [1110 bp, 369 aa] {ON} Anc_1.480
          YEL037C
          Length = 369

 Score = 36.2 bits (82), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 41/76 (53%), Gaps = 1/76 (1%)

Query: 1  MISVNIK-FKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDY 59
          M+S+  K FK++K +++      +     ++ +  +   +  +LIYSG++L    +++  
Sbjct: 1  MVSILFKDFKKQKISLDLPASSTVLHAKKQLAEQKECDDSQIKLIYSGKVLQDSNSIEGC 60

Query: 60 NFKDGHCIIVIIHKEE 75
            KDG  +I +I K++
Sbjct: 61 GLKDGDQVIFMISKKK 76

>Ecym_3572 Chr3 complement(1083184..1084515) [1332 bp, 443 aa]
          {ON} similar to Ashbya gossypii AFR358W
          Length = 443

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 2  ISVNIK-FKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYN 60
          I++N K FK+EK  ++      I++    +        +  ++I+SG++L    TL    
Sbjct: 3  ITINFKDFKKEKLPLQLSPTATIAEAKQLLAKEKQCDESQLKMIFSGKVLQDGHTLDACK 62

Query: 61 FKDGHCIIVIIHKEE 75
           KDG  +I +I K++
Sbjct: 63 LKDGDQVIFMISKKK 77

>KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 32.3 bits (72), Expect = 0.18,   Method: Composition-based stats.
 Identities = 13/61 (21%), Positives = 35/61 (57%)

Query: 11 EKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFKDGHCIIVI 70
          ++ +++ +  E +  I   +++   IPP+ Q+LI+ G+ +D   T+   + +DG  + ++
Sbjct: 11 KEISVDVQSSETVYHIKELLEEKEGIPPSQQKLIFQGKQIDDNATIGSADLQDGSLLHLV 70

Query: 71 I 71
          +
Sbjct: 71 L 71

>ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa]
          {ON} similar to uniprot|Q03919 Saccharomyces cerevisiae
          YDR139C RUB1 Ubiquitin-like protein with similarity to
          mammalian NEDD8
          Length = 77

 Score = 32.0 bits (71), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 25/40 (62%), Gaps = 4/40 (10%)

Query: 29 KIKDHLD----IPPNNQRLIYSGRILDPEKTLKDYNFKDG 64
          +IK+ L+    IPP+ QRLI+ G+ +D ++T+      DG
Sbjct: 25 RIKELLEEKEGIPPSQQRLIFQGKQIDDQQTVSSAKLVDG 64

>AFR358W Chr6 (1087725..1088966) [1242 bp, 413 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YEL037C (RAD23)
          Length = 413

 Score = 33.1 bits (74), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 39/75 (52%), Gaps = 1/75 (1%)

Query: 2  ISVNIK-FKEEKFTIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYN 60
          I+++ K FK+E+  ++      I++    +        +  ++I+SG++L    TL+   
Sbjct: 3  ITIHFKDFKKERLPLQLSPSATIAEAKQMLARAKQCDESQLKMIFSGKVLQDGNTLEGCK 62

Query: 61 FKDGHCIIVIIHKEE 75
           KDG  +I +I K++
Sbjct: 63 LKDGDQVIFMISKKK 77

>SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 30.4 bits (67), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 29/49 (59%), Gaps = 7/49 (14%)

Query: 29 KIKDHLD----IPPNNQRLIYSGRILDPEKTLKDYNFKDG---HCIIVI 70
          +IK+ L+    IPP+ QRLI+ G+ ++ ++T+   N   G   H ++ +
Sbjct: 25 RIKELLEEKEGIPPSQQRLIFQGKQIEDDQTVDSANLSSGMQLHLVLTL 73

>KAFR0I02780 Chr9 (560687..561331) [645 bp, 214 aa] {ON} Anc_1.480
          YEL037C
          Length = 214

 Score = 29.3 bits (64), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 20/31 (64%)

Query: 43 LIYSGRILDPEKTLKDYNFKDGHCIIVIIHK 73
          LIYSG++L  + TL   + KD   I+++I +
Sbjct: 46 LIYSGKLLQDDATLNSLHLKDNAQIVMLIRR 76

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.136    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 27,830,185
Number of extensions: 1097839
Number of successful extensions: 3893
Number of sequences better than 10.0: 134
Number of HSP's gapped: 3963
Number of HSP's successfully gapped: 202
Length of query: 284
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 176
Effective length of database: 41,097,471
Effective search space: 7233154896
Effective search space used: 7233154896
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)